Citrus Sinensis ID: 033259

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA
ccHHHHHHHHHHHHHHHHccccHHHHcccccccEEEEcccccccHHHHHHHHcccccccEEEEEEEEEEEEccccccEEEEEEEEEEEccccccccEEEEEEEEEcccccEEEEccEEEECcc
MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPDSVAKAFVEHYYTTFDANRTGLANLYQEGSMLTFEGQKIQGSQNIVAKLTSLPFQQCQHSITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQMFHLMPTPQGSFYVLNDIFRLNYA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.confidentQ9C7F5
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.probableQ9XJ54
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.probableQ6CQX4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GY7, chain A
Confidence level:very confident
Coverage over the Query: 2-123
View the alignment between query and template
View the model in PyMOL