BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033262
         (123 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Q6D|A Chain A, Crystal Structure Of Infectious Bronchitis Virus (Ibv)
          Main Protease
 pdb|2Q6D|B Chain B, Crystal Structure Of Infectious Bronchitis Virus (Ibv)
          Main Protease
 pdb|2Q6D|C Chain C, Crystal Structure Of Infectious Bronchitis Virus (Ibv)
          Main Protease
 pdb|2Q6F|A Chain A, Crystal Structure Of Infectious Bronchitis Virus (Ibv)
          Main Protease In Complex With A Michael Acceptor
          Inhibitor N3
 pdb|2Q6F|B Chain B, Crystal Structure Of Infectious Bronchitis Virus (Ibv)
          Main Protease In Complex With A Michael Acceptor
          Inhibitor N3
          Length = 309

 Score = 30.8 bits (68), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%)

Query: 1  MGNCIRHQHQPSMQWAGDDWGAVVESASNHRTEEAKQEGLLL 42
          +G+ I        +++GD WG V+  A+NH  E   Q G+ L
Sbjct: 34 LGDSIYCPRHVLGKFSGDQWGDVLNLANNHEFEVVTQNGVTL 75


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.125    0.372 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,079,979
Number of Sequences: 62578
Number of extensions: 84140
Number of successful extensions: 90
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 89
Number of HSP's gapped (non-prelim): 1
length of query: 123
length of database: 14,973,337
effective HSP length: 85
effective length of query: 38
effective length of database: 9,654,207
effective search space: 366859866
effective search space used: 366859866
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 45 (21.9 bits)