Query         033273
Match_columns 123
No_of_seqs    95 out of 97
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 11:54:44 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033273.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033273hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05251 UPF0197:  Uncharacteri  66.2      23 0.00049   24.5   5.3   25   19-43     16-40  (77)
  2 COG5336 Uncharacterized protei  43.7      15 0.00033   27.3   1.5   16   87-102    68-83  (116)
  3 PF03032 Brevenin:  Brevenin/es  40.7      17 0.00037   22.7   1.2   16   18-33      6-21  (46)
  4 PTZ00370 STEVOR; Provisional    35.9      26 0.00056   29.8   1.9   15   93-107   256-270 (296)
  5 TIGR01478 STEVOR variant surfa  35.1      27 0.00058   29.7   1.9   15   93-107   260-274 (295)
  6 PRK12772 bifunctional flagella  35.0 3.6E+02  0.0079   24.8   9.2   46   20-65    215-261 (609)
  7 PF09323 DUF1980:  Domain of un  29.4      75  0.0016   24.1   3.4   17   50-66     74-90  (182)
  8 PF04120 Iron_permease:  Low af  29.2      57  0.0012   24.5   2.6   21   89-109    11-31  (132)
  9 PF07835 COX4_pro_2:  Bacterial  26.1      76  0.0016   19.5   2.4   16   92-107    25-40  (44)
 10 PF11457 DUF3021:  Protein of u  21.5 1.7E+02  0.0037   20.6   3.9   26   25-50    110-135 (136)
 11 PF13956 Ibs_toxin:  Toxin Ibs,  20.7      66  0.0014   16.8   1.1   12  100-111     7-18  (19)
 12 PF08563 P53_TAD:  P53 transact  20.6      36 0.00078   19.0   0.1    9  110-118    12-20  (25)

No 1  
>PF05251 UPF0197:  Uncharacterised protein family (UPF0197);  InterPro: IPR007915 This family of proteins is functionally uncharacterised, but is thought to be a transmembrane protein.
Probab=66.24  E-value=23  Score=24.53  Aligned_cols=25  Identities=20%  Similarity=0.465  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHhhhhhhhHHH
Q 033273           19 LPLFFFMLILFFVLGLSWYINYESV   43 (123)
Q Consensus        19 ~~ll~~l~iv~~ll~~S~Y~~ye~~   43 (123)
                      +|.+.++...+=+....|++-||-.
T Consensus        16 ~p~La~vll~iGl~fta~Ffiyevt   40 (77)
T PF05251_consen   16 YPHLAVVLLAIGLFFTAWFFIYEVT   40 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            5556666666666778899888766


No 2  
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=43.73  E-value=15  Score=27.29  Aligned_cols=16  Identities=50%  Similarity=1.016  Sum_probs=11.7

Q ss_pred             ccCCCChHHHHHHHHH
Q 033273           87 HRAGGSPWGVAALLVL  102 (123)
Q Consensus        87 hr~GsSPWGVA~lLvl  102 (123)
                      |-+|+||||.-.++++
T Consensus        68 ~~agTsPwglIv~lll   83 (116)
T COG5336          68 KFAGTSPWGLIVFLLL   83 (116)
T ss_pred             HhcCCCcHHHHHHHHH
Confidence            3588999997666543


No 3  
>PF03032 Brevenin:  Brevenin/esculentin/gaegurin/rugosin family;  InterPro: IPR004275 In addition to the highly specific cell-mediated immune system, vertebrates possess an efficient host-defence mechanism against invading microorganisms which involves the synthesis of highly potent antimicrobial peptides with a large spectrum of activity. This entry represents a number of these defence peptides secreted from the skin of amphibians, including the opiate-like dermorphins and deltorphins, and the antimicrobial dermoseptins and temporins.; GO: 0006952 defense response, 0042742 defense response to bacterium, 0005576 extracellular region
Probab=40.71  E-value=17  Score=22.75  Aligned_cols=16  Identities=31%  Similarity=0.478  Sum_probs=11.1

Q ss_pred             cHHHHHHHHHHHHHHH
Q 033273           18 PLPLFFFMLILFFVLG   33 (123)
Q Consensus        18 P~~ll~~l~iv~~ll~   33 (123)
                      ++-|++|+++|.+.++
T Consensus         6 sllLlfflG~ISlSlC   21 (46)
T PF03032_consen    6 SLLLLFFLGTISLSLC   21 (46)
T ss_pred             HHHHHHHHHHcccchH
Confidence            6677777777776553


No 4  
>PTZ00370 STEVOR; Provisional
Probab=35.87  E-value=26  Score=29.85  Aligned_cols=15  Identities=53%  Similarity=1.057  Sum_probs=12.2

Q ss_pred             hHHHHHHHHHHHHHH
Q 033273           93 PWGVAALLVLVLFMV  107 (123)
Q Consensus        93 PWGVA~lLvlLL~lv  107 (123)
                      |||.|++++++|..+
T Consensus       256 Pygiaalvllil~vv  270 (296)
T PTZ00370        256 PYGIAALVLLILAVV  270 (296)
T ss_pred             ccHHHHHHHHHHHHH
Confidence            999999888777554


No 5  
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=35.09  E-value=27  Score=29.73  Aligned_cols=15  Identities=47%  Similarity=1.032  Sum_probs=12.1

Q ss_pred             hHHHHHHHHHHHHHH
Q 033273           93 PWGVAALLVLVLFMV  107 (123)
Q Consensus        93 PWGVA~lLvlLL~lv  107 (123)
                      |||.|++++++|..+
T Consensus       260 Pcgiaalvllil~vv  274 (295)
T TIGR01478       260 PYGIAALVLIILTVV  274 (295)
T ss_pred             ccHHHHHHHHHHHHH
Confidence            999999888777554


No 6  
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional
Probab=35.00  E-value=3.6e+02  Score=24.76  Aligned_cols=46  Identities=20%  Similarity=0.480  Sum_probs=32.7

Q ss_pred             HHHHHHHHHHHHHHhhhhh-hhHHHHHHHHHHHHHHHHHHHHHHHHH
Q 033273           20 PLFFFMLILFFVLGLSWYI-NYESVFEDFMNQVKFYLMLSPLILLLI   65 (123)
Q Consensus        20 ~ll~~l~iv~~ll~~S~Y~-~ye~~~e~~~~ql~~~L~llPl~Lil~   65 (123)
                      |+=.+++++++.+.++... .+++..++..+++.-++-..|++++++
T Consensus       215 Plki~~gl~~l~l~lp~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  261 (609)
T PRK12772        215 PIKILVGLTAFVIALPLFLKVISSAFSNLPDAIRGFYKAIPLLLIFA  261 (609)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhhc
Confidence            4444455555555555554 567888888888888999999999875


No 7  
>PF09323 DUF1980:  Domain of unknown function (DUF1980);  InterPro: IPR015402  Members of this occur in gene pairs with members of PF03773 from PFAM. The N-terminal region contains several predicted transmembrane helix regions while the few invariant residues (G, CxxD, and W) occur in the C-terminal region.  Members of this family are found in a set of prokaryotic hypothetical proteins. Their exact function has not, as yet, been defined. 
Probab=29.39  E-value=75  Score=24.11  Aligned_cols=17  Identities=24%  Similarity=0.620  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 033273           50 QVKFYLMLSPLILLLIV   66 (123)
Q Consensus        50 ql~~~L~llPl~Lil~v   66 (123)
                      ...-+++++|+++.+++
T Consensus        74 ~~~y~l~~iPll~g~l~   90 (182)
T PF09323_consen   74 LWSYFLFLIPLLIGFLF   90 (182)
T ss_pred             cHHHHHHHHHHHHHHcC
Confidence            34467999999888876


No 8  
>PF04120 Iron_permease:  Low affinity iron permease ;  InterPro: IPR007251  Although originally identified as a low-affinity iron(II) permease [, ], Fet4 has since been shown to import several other transition metal ions, including copper [, ] and zinc []. Copper, cobalt, and cadmium inhibit Fet4 [, ]. Fet4 is an integral protein of the plasma membrane [, ]. FET4 is not essential, not even in fet3 fet4 double mutants []. Over expression of FET4 improves growth under alkaline conditions [].   Transcription of FET4 is induced by Aft1 in response to low levels of iron [, , ] or by Zap1 in response to low zinc [, ], but not in response to low copper []. When the high-affinity iron permease component Fet3 is deleted, FET4 is induced by the addition of copper, zinc, cobalt, or manganese []. It is also induced under anaerobic conditions [, , ] and repressed by Rox1 in aerobic conditions [, ]. Rox1 attenuates the activation of FET4 by Aft1 or Zap1 []. ; GO: 0055085 transmembrane transport
Probab=29.22  E-value=57  Score=24.49  Aligned_cols=21  Identities=19%  Similarity=0.583  Sum_probs=15.6

Q ss_pred             CCCChHHHHHHHHHHHHHHHh
Q 033273           89 AGGSPWGVAALLVLVLFMVSH  109 (123)
Q Consensus        89 ~GsSPWGVA~lLvlLL~lvsy  109 (123)
                      .-||||++.+.++++++.+--
T Consensus        11 ~~gs~~~f~~~~~~Ii~W~i~   31 (132)
T PF04120_consen   11 VAGSPWAFVIAVAVIIVWAIS   31 (132)
T ss_pred             HHCCHHHHHHHHHHHHHHHHH
Confidence            458999988887777766543


No 9  
>PF07835 COX4_pro_2:  Bacterial aa3 type cytochrome c oxidase subunit IV;  InterPro: IPR012422 Bacterial cytochrome c oxidase is found bound to the to the cell membrane, where it is involved in the generation of the transmembrane proton electrochemical gradient. It is composed of four subunits. Subunit IV consists of one transmembrane helix that does not interact directly with the other subunits, but maintains its position by indirect contacts via phospholipid molecules found in the structure. The function of subunit IV is as yet unknown []. ; PDB: 1QLE_D 1M57_J 1M56_J.
Probab=26.10  E-value=76  Score=19.46  Aligned_cols=16  Identities=25%  Similarity=0.881  Sum_probs=11.0

Q ss_pred             ChHHHHHHHHHHHHHH
Q 033273           92 SPWGVAALLVLVLFMV  107 (123)
Q Consensus        92 SPWGVA~lLvlLL~lv  107 (123)
                      +-||..+++++|++|.
T Consensus        25 ~k~~~~~~~~~li~la   40 (44)
T PF07835_consen   25 TKWGTIAIAAILIFLA   40 (44)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5577777777776664


No 10 
>PF11457 DUF3021:  Protein of unknown function (DUF3021);  InterPro: IPR021560  This is a bacterial family of uncharacterised proteins. 
Probab=21.45  E-value=1.7e+02  Score=20.59  Aligned_cols=26  Identities=12%  Similarity=0.534  Sum_probs=16.5

Q ss_pred             HHHHHHHHHhhhhhhhHHHHHHHHHH
Q 033273           25 MLILFFVLGLSWYINYESVFEDFMNQ   50 (123)
Q Consensus        25 l~iv~~ll~~S~Y~~ye~~~e~~~~q   50 (123)
                      +.++-++.++-.|..+|...++.+++
T Consensus       110 fi~IYliIw~~~y~~~k~~i~kiN~k  135 (136)
T PF11457_consen  110 FIIIYLIIWLIFYLYWKKDIKKINEK  135 (136)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            34555666666677777777766654


No 11 
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=20.70  E-value=66  Score=16.79  Aligned_cols=12  Identities=25%  Similarity=0.686  Sum_probs=7.2

Q ss_pred             HHHHHHHHHhcc
Q 033273          100 LVLVLFMVSHQS  111 (123)
Q Consensus       100 LvlLL~lvsyQS  111 (123)
                      +..+|+++||+.
T Consensus         7 IlvvLLliSf~a   18 (19)
T PF13956_consen    7 ILVVLLLISFPA   18 (19)
T ss_pred             HHHHHHhccccC
Confidence            345566777763


No 12 
>PF08563 P53_TAD:  P53 transactivation motif;  InterPro: IPR013872  The binding of this protein by regulatory proteins regulates p53 transcription activation. This entry is comprised of a single amphipathic alpha helix and contains a highly conserved motif [, ]. ; GO: 0005515 protein binding; PDB: 1YCQ_B 2Z5T_R 3DAB_B 3DAC_B 2Z5S_Q 2K8F_B 2L14_B 1YCR_B.
Probab=20.57  E-value=36  Score=18.96  Aligned_cols=9  Identities=22%  Similarity=0.660  Sum_probs=7.4

Q ss_pred             cccchhhcc
Q 033273          110 QSSLHERWF  118 (123)
Q Consensus       110 QSsf~~~Wf  118 (123)
                      |.+|++.|-
T Consensus        12 QeTF~~LW~   20 (25)
T PF08563_consen   12 QETFSDLWN   20 (25)
T ss_dssp             TCCHHHHHH
T ss_pred             HHHHHHHHH
Confidence            788888884


Done!