Query         033276
Match_columns 123
No_of_seqs    101 out of 282
Neff          4.1 
Searched_HMMs 46136
Date          Fri Mar 29 11:56:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033276.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033276hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2463 Predicted RNA-binding  100.0 3.4E-34 7.3E-39  241.6   4.8   86   18-105   176-277 (376)
  2 COG1439 Predicted nucleic acid  99.9 3.6E-24 7.7E-29  167.3   4.4   78   20-99     77-167 (177)
  3 PRK12496 hypothetical protein;  99.8 5.1E-20 1.1E-24  140.7   4.0   67   32-99     89-158 (164)
  4 PF08772 NOB1_Zn_bind:  Nin one  99.7 4.6E-17 9.9E-22  111.7   2.5   41   62-104     1-43  (73)
  5 TIGR03875 RNA_lig_partner RNA   97.9 7.7E-06 1.7E-10   65.9   2.6   27   32-58    169-195 (206)
  6 PRK04358 hypothetical protein;  97.7 1.6E-05 3.5E-10   64.4   2.3   27   32-58    173-199 (217)
  7 PF13248 zf-ribbon_3:  zinc-rib  97.2 0.00019 4.1E-09   40.0   1.1   21   73-93      4-25  (26)
  8 PF13240 zinc_ribbon_2:  zinc-r  97.0 0.00037 8.1E-09   38.2   1.2   21   73-93      1-22  (23)
  9 PF08745 UPF0278:  UPF0278 fami  96.8 0.00055 1.2E-08   55.3   1.7   28   32-59    166-193 (205)
 10 PF15017 AF1Q:  Drug resistance  96.3  0.0019   4E-08   46.0   1.5   18   13-30     63-80  (87)
 11 PF09723 Zn-ribbon_8:  Zinc rib  96.2  0.0057 1.2E-07   37.3   2.8   30   68-99      3-40  (42)
 12 PF10571 UPF0547:  Uncharacteri  96.0  0.0033 7.1E-08   35.5   1.2   21   73-93      2-23  (26)
 13 PRK12380 hydrogenase nickel in  95.8   0.008 1.7E-07   43.6   2.9   41   66-111    66-109 (113)
 14 PRK03681 hypA hydrogenase nick  95.8  0.0074 1.6E-07   43.8   2.6   40   67-111    67-110 (114)
 15 PRK00564 hypA hydrogenase nick  95.8   0.011 2.4E-07   43.1   3.3   39   68-111    69-111 (117)
 16 PF01155 HypA:  Hydrogenase exp  95.5   0.011 2.4E-07   42.7   2.6   42   65-111    65-109 (113)
 17 PF12172 DUF35_N:  Rubredoxin-l  95.5  0.0081 1.8E-07   35.3   1.5   25   68-93      9-34  (37)
 18 PRK00398 rpoP DNA-directed RNA  95.4   0.014   3E-07   35.8   2.4   24   70-94      3-31  (46)
 19 smart00834 CxxC_CXXC_SSSS Puta  95.3   0.013 2.9E-07   34.2   2.1   25   68-93      3-35  (41)
 20 PRK03824 hypA hydrogenase nick  95.3   0.018 3.9E-07   42.9   3.2   38   69-111    69-130 (135)
 21 TIGR00100 hypA hydrogenase nic  95.3   0.018 3.8E-07   41.8   3.1   40   67-111    67-109 (115)
 22 TIGR02605 CxxC_CxxC_SSSS putat  95.2   0.029 6.2E-07   34.7   3.5   32   68-101     3-42  (52)
 23 COG1545 Predicted nucleic-acid  94.7   0.031 6.8E-07   41.9   2.9   33   66-99     25-58  (140)
 24 PF12773 DZR:  Double zinc ribb  93.9   0.028 6.1E-07   34.4   1.1   21   74-94      1-22  (50)
 25 COG0375 HybF Zn finger protein  93.6   0.072 1.6E-06   39.6   2.9   42   65-111    65-109 (115)
 26 smart00659 RPOLCX RNA polymera  93.5   0.074 1.6E-06   33.1   2.4   24   70-94      2-29  (44)
 27 cd00729 rubredoxin_SM Rubredox  93.3   0.063 1.4E-06   31.6   1.9   22   71-93      3-27  (34)
 28 PF12773 DZR:  Double zinc ribb  92.9   0.053 1.2E-06   33.1   1.2   19   73-91     31-50  (50)
 29 PF10263 SprT-like:  SprT-like   92.9    0.11 2.3E-06   37.9   2.9   51   43-94     87-153 (157)
 30 COG1645 Uncharacterized Zn-fin  92.5   0.072 1.6E-06   40.5   1.6   21   73-93     30-53  (131)
 31 COG2093 DNA-directed RNA polym  92.5   0.059 1.3E-06   36.6   1.1   21   73-93      6-27  (64)
 32 PRK00762 hypA hydrogenase nick  92.5    0.13 2.8E-06   37.9   2.9   39   67-111    67-115 (124)
 33 PF03604 DNA_RNApol_7kD:  DNA d  91.9     0.2 4.2E-06   29.5   2.7   25   73-98      2-30  (32)
 34 cd00350 rubredoxin_like Rubred  91.8    0.11 2.5E-06   30.0   1.6   22   71-93      2-26  (33)
 35 PF14803 Nudix_N_2:  Nudix N-te  91.2     0.1 2.2E-06   31.1   1.0   11   85-95      1-11  (34)
 36 COG1996 RPC10 DNA-directed RNA  91.2    0.13 2.8E-06   33.2   1.5   26   68-94      4-34  (49)
 37 COG1592 Rubrerythrin [Energy p  91.0    0.14 3.1E-06   40.0   1.9   23   70-93    134-158 (166)
 38 PRK13130 H/ACA RNA-protein com  90.6    0.12 2.7E-06   34.0   1.0   20   73-93      7-26  (56)
 39 PRK00420 hypothetical protein;  90.4    0.17 3.7E-06   37.4   1.7   21   73-93     25-49  (112)
 40 PF11023 DUF2614:  Protein of u  89.7    0.19 4.1E-06   37.5   1.5   33   65-98     64-99  (114)
 41 PRK14559 putative protein seri  89.3    0.15 3.2E-06   46.9   0.8   27   73-100    29-56  (645)
 42 PRK04351 hypothetical protein;  89.2    0.54 1.2E-05   35.8   3.7   50   41-94     85-142 (149)
 43 COG1579 Zn-ribbon protein, pos  89.0    0.26 5.6E-06   40.6   1.9   21   73-93    199-230 (239)
 44 PF07295 DUF1451:  Protein of u  88.8    0.31 6.6E-06   37.3   2.1   29   70-100   112-145 (146)
 45 COG5257 GCD11 Translation init  88.6    0.46   1E-05   41.8   3.3   32   68-100    55-89  (415)
 46 COG1656 Uncharacterized conser  88.5    0.11 2.4E-06   40.9  -0.5   23   33-56     47-69  (165)
 47 PRK14559 putative protein seri  88.1    0.18 3.9E-06   46.4   0.6   23   73-95      3-26  (645)
 48 COG2260 Predicted Zn-ribbon RN  87.8    0.25 5.5E-06   33.1   0.9   23   71-94      5-27  (59)
 49 PF02150 RNA_POL_M_15KD:  RNA p  87.7    0.32   7E-06   28.8   1.3   10   85-94      2-11  (35)
 50 PF07282 OrfB_Zn_ribbon:  Putat  87.6    0.74 1.6E-05   29.7   3.1   44   43-93      7-55  (69)
 51 PRK11032 hypothetical protein;  86.6    0.48   1E-05   36.9   2.0   29   70-100   124-157 (160)
 52 PF09297 zf-NADH-PPase:  NADH p  86.2    0.39 8.4E-06   27.4   1.0   11   84-94      3-13  (32)
 53 PF14369 zf-RING_3:  zinc-finge  86.0     0.8 1.7E-05   27.2   2.3   22   71-93      3-30  (35)
 54 PF14205 Cys_rich_KTR:  Cystein  85.9       1 2.2E-05   29.9   3.0   30   68-100     3-43  (55)
 55 COG1198 PriA Primosomal protei  85.9    0.62 1.3E-05   43.7   2.7   27   69-98    461-488 (730)
 56 TIGR02827 RNR_anaer_Bdell anae  85.8    0.62 1.4E-05   42.6   2.7   53   42-104   509-565 (586)
 57 PF09538 FYDLN_acid:  Protein o  85.4    0.47   1E-05   34.6   1.3   25   73-97     11-39  (108)
 58 PF14205 Cys_rich_KTR:  Cystein  85.2    0.45 9.7E-06   31.5   1.1   14   85-99      5-18  (55)
 59 PF14446 Prok-RING_1:  Prokaryo  85.1    0.24 5.3E-06   32.5  -0.2   35   73-108     7-44  (54)
 60 PF13638 PIN_4:  PIN domain; PD  85.1     1.1 2.3E-05   31.5   3.0   27   32-58    106-132 (133)
 61 PF05191 ADK_lid:  Adenylate ki  84.9    0.82 1.8E-05   27.3   2.1   22   73-94      3-31  (36)
 62 PRK08351 DNA-directed RNA poly  84.8    0.49 1.1E-05   31.7   1.2   21   73-94      5-25  (61)
 63 PF04135 Nop10p:  Nucleolar RNA  84.7     1.2 2.6E-05   29.1   2.9   25   68-94      3-27  (53)
 64 COG2331 Uncharacterized protei  84.6    0.74 1.6E-05   32.6   2.0   42   65-107     7-58  (82)
 65 cd01675 RNR_III Class III ribo  84.6    0.89 1.9E-05   40.8   3.0   58   40-104   493-551 (555)
 66 TIGR02487 NrdD anaerobic ribon  84.5    0.49 1.1E-05   42.7   1.3   43   42-93    501-547 (579)
 67 PRK14714 DNA polymerase II lar  84.4    0.97 2.1E-05   45.0   3.4   32   61-94    658-689 (1337)
 68 smart00731 SprT SprT homologue  84.1     1.1 2.4E-05   33.0   2.9   52   42-94     83-143 (146)
 69 PRK06393 rpoE DNA-directed RNA  83.9    0.52 1.1E-05   31.9   1.0   20   73-93      7-26  (64)
 70 PRK07111 anaerobic ribonucleos  83.7    0.64 1.4E-05   43.3   1.8   33   71-104   680-712 (735)
 71 TIGR00595 priA primosomal prot  83.3    0.93   2E-05   40.1   2.6   26   70-98    240-266 (505)
 72 PRK02935 hypothetical protein;  82.9    0.79 1.7E-05   34.1   1.7   31   67-98     67-100 (110)
 73 PF13597 NRDD:  Anaerobic ribon  82.2    0.49 1.1E-05   42.4   0.4   24   70-93    490-513 (546)
 74 PRK08270 anaerobic ribonucleos  81.9    0.99 2.2E-05   41.6   2.3   44   42-94    602-649 (656)
 75 PF04216 FdhE:  Protein involve  81.8       1 2.3E-05   36.7   2.1   27   73-100   199-226 (290)
 76 PF08792 A2L_zn_ribbon:  A2L zi  81.7    0.87 1.9E-05   26.8   1.2   21   73-93      5-30  (33)
 77 PF14319 Zn_Tnp_IS91:  Transpos  81.6    0.96 2.1E-05   32.7   1.7   25   70-95     42-71  (111)
 78 PRK14890 putative Zn-ribbon RN  81.1    0.97 2.1E-05   30.3   1.4   26   73-99      9-39  (59)
 79 cd04476 RPA1_DBD_C RPA1_DBD_C:  81.1     2.6 5.6E-05   31.3   3.9   26   68-93     31-60  (166)
 80 PRK08271 anaerobic ribonucleos  81.1    0.89 1.9E-05   41.8   1.7   43   42-93    543-589 (623)
 81 TIGR02098 MJ0042_CXXC MJ0042 f  81.0     1.1 2.4E-05   26.0   1.5   22   73-94      4-35  (38)
 82 PRK06260 threonine synthase; V  80.9       1 2.3E-05   38.1   1.9   25   69-94      2-29  (397)
 83 PRK07591 threonine synthase; V  79.9     1.4 3.1E-05   37.8   2.5   27   68-95     16-44  (421)
 84 TIGR00375 conserved hypothetic  79.4     1.2 2.6E-05   38.7   1.9   50   44-94    213-268 (374)
 85 PRK08579 anaerobic ribonucleos  79.1     1.1 2.4E-05   41.2   1.6   45   40-93    543-591 (625)
 86 COG2888 Predicted Zn-ribbon RN  79.1    0.85 1.8E-05   30.8   0.7   26   73-99     11-41  (61)
 87 cd00730 rubredoxin Rubredoxin;  79.0     1.3 2.9E-05   28.2   1.5   22   71-93      2-43  (50)
 88 PF09845 DUF2072:  Zn-ribbon co  78.7     1.2 2.7E-05   33.9   1.5   21   73-93      3-28  (131)
 89 PF01096 TFIIS_C:  Transcriptio  78.6     2.3   5E-05   25.5   2.4    8   86-93      2-9   (39)
 90 PF02591 DUF164:  Putative zinc  78.5     1.2 2.6E-05   28.1   1.2   20   73-92     24-54  (56)
 91 PF03119 DNA_ligase_ZBD:  NAD-d  78.5     1.1 2.5E-05   25.3   1.0    9   86-94      1-9   (28)
 92 TIGR03844 cysteate_syn cysteat  77.5     1.5 3.4E-05   37.7   2.0   27   69-96      1-29  (398)
 93 CHL00174 accD acetyl-CoA carbo  77.4     1.2 2.7E-05   37.6   1.3   42   69-112    38-88  (296)
 94 smart00661 RPOL9 RNA polymeras  77.2     1.1 2.3E-05   27.3   0.6   10   85-94      1-10  (52)
 95 PRK05654 acetyl-CoA carboxylas  77.0     1.3 2.9E-05   37.1   1.4   44   68-113    26-78  (292)
 96 PF06221 zf-C2HC5:  Putative zi  76.9     1.5 3.1E-05   29.0   1.3   32   62-94     10-45  (57)
 97 PRK00415 rps27e 30S ribosomal   76.9       2 4.4E-05   28.6   2.0   23   72-94     12-40  (59)
 98 TIGR00354 polC DNA polymerase,  76.8     1.5 3.3E-05   42.8   1.9   29   68-97   1010-1041(1095)
 99 TIGR00515 accD acetyl-CoA carb  76.5     1.4   3E-05   36.9   1.4   42   69-112    26-76  (285)
100 TIGR00354 polC DNA polymerase,  76.4     2.1 4.5E-05   41.9   2.7   27   65-93    620-646 (1095)
101 PRK06450 threonine synthase; V  76.0     1.7 3.7E-05   36.5   1.8   26   71-97      4-31  (338)
102 PF08271 TF_Zn_Ribbon:  TFIIB z  75.9     1.7 3.7E-05   26.1   1.3   21   73-93      2-28  (43)
103 PF01396 zf-C4_Topoisom:  Topoi  75.5     1.7 3.7E-05   26.1   1.2   14   85-98      2-15  (39)
104 PF01783 Ribosomal_L32p:  Ribos  75.1     1.8 3.8E-05   27.9   1.3   20   73-92     28-47  (56)
105 PF09082 DUF1922:  Domain of un  75.0    0.64 1.4E-05   31.9  -0.8   28   70-100     3-35  (68)
106 PF07754 DUF1610:  Domain of un  75.0     1.8 3.9E-05   24.1   1.1   19   74-92      1-24  (24)
107 PF00301 Rubredoxin:  Rubredoxi  74.5     2.4 5.3E-05   26.7   1.8   23   70-93      1-43  (47)
108 COG3364 Zn-ribbon containing p  73.9     1.7 3.7E-05   32.3   1.1   27   73-100     4-35  (112)
109 PRK04023 DNA polymerase II lar  73.5     2.1 4.5E-05   42.1   1.8   29   68-97   1035-1066(1121)
110 COG1933 Archaeal DNA polymeras  73.0     1.7 3.7E-05   36.4   1.0   27   67-94    164-193 (253)
111 TIGR01031 rpmF_bact ribosomal   72.8     1.9 4.2E-05   27.9   1.1   20   73-92     28-47  (55)
112 COG1096 Predicted RNA-binding   72.7     2.4 5.3E-05   34.0   1.8   30   72-102   150-182 (188)
113 PF05991 NYN_YacP:  YacP-like N  72.6     4.3 9.3E-05   30.9   3.1   43   17-59     74-121 (166)
114 PRK14704 anaerobic ribonucleos  72.5     2.1 4.6E-05   39.3   1.6   23   71-93    559-581 (618)
115 PF04606 Ogr_Delta:  Ogr/Delta-  72.3     2.3 4.9E-05   26.3   1.3   13   86-98      1-13  (47)
116 PRK12286 rpmF 50S ribosomal pr  72.3     2.3 4.9E-05   27.8   1.3   21   73-93     29-49  (57)
117 COG1458 Predicted DNA-binding   72.3     3.3   7E-05   34.1   2.5   29   31-59    172-200 (221)
118 PRK14714 DNA polymerase II lar  72.3     2.3 4.9E-05   42.6   1.8   29   68-97   1251-1282(1337)
119 COG3091 SprT Zn-dependent meta  71.9     1.8 3.8E-05   34.0   0.9   42   51-94     96-150 (156)
120 PF06677 Auto_anti-p27:  Sjogre  71.8     2.5 5.5E-05   26.0   1.4    9   85-93     18-26  (41)
121 PRK05580 primosome assembly pr  71.3     3.2   7E-05   38.0   2.5   24   73-98    410-434 (679)
122 PF07191 zinc-ribbons_6:  zinc-  70.5     2.5 5.4E-05   29.1   1.2   25   70-95     17-41  (70)
123 PRK07218 replication factor A;  70.3     2.1 4.5E-05   37.7   1.0   50   42-93    267-318 (423)
124 COG4640 Predicted membrane pro  70.0     2.3   5E-05   38.1   1.2   24   73-96      3-27  (465)
125 TIGR02300 FYDLN_acid conserved  70.0     2.7 5.9E-05   32.0   1.5   22   73-94     11-36  (129)
126 TIGR01562 FdhE formate dehydro  69.6     5.2 0.00011   33.9   3.2   21   73-93    212-233 (305)
127 PRK14873 primosome assembly pr  69.1     3.8 8.1E-05   37.9   2.5   20   73-93    412-431 (665)
128 COG0777 AccD Acetyl-CoA carbox  68.7     2.6 5.6E-05   36.0   1.2   27   67-95     26-58  (294)
129 PF13719 zinc_ribbon_5:  zinc-r  68.7     2.2 4.8E-05   25.2   0.6   21   73-93      4-34  (37)
130 COG0267 RpmG Ribosomal protein  68.7       4 8.8E-05   26.4   1.9   29   68-98      5-47  (50)
131 smart00440 ZnF_C2C2 C2C2 Zinc   68.6     6.2 0.00013   23.7   2.6    8   86-93      2-9   (40)
132 PRK14715 DNA polymerase II lar  68.5       3 6.6E-05   42.2   1.8   28   68-97   1540-1570(1627)
133 PRK09263 anaerobic ribonucleos  68.3     4.5 9.7E-05   37.7   2.8   58   43-110   620-684 (711)
134 PF06906 DUF1272:  Protein of u  68.1     1.7 3.7E-05   29.0   0.0   30   67-97     23-54  (57)
135 PRK03564 formate dehydrogenase  68.0     5.8 0.00013   33.8   3.2   21   73-93    214-235 (309)
136 PF09889 DUF2116:  Uncharacteri  68.0     1.3 2.9E-05   29.3  -0.5   21   73-93      5-27  (59)
137 PF03833 PolC_DP2:  DNA polymer  67.8     1.7 3.7E-05   41.8   0.0   20   73-93    657-676 (900)
138 TIGR01405 polC_Gram_pos DNA po  67.7     2.8 6.1E-05   41.4   1.4   22   71-93    684-717 (1213)
139 COG2176 PolC DNA polymerase II  67.5     3.3 7.1E-05   41.6   1.8   22   71-93    915-948 (1444)
140 PRK00448 polC DNA polymerase I  67.3     2.9 6.2E-05   42.1   1.4   22   71-93    909-942 (1437)
141 PF04828 GFA:  Glutathione-depe  66.7     1.6 3.5E-05   28.3  -0.3   14   81-94     45-58  (92)
142 PRK05978 hypothetical protein;  66.5     2.8 6.1E-05   32.3   1.0   28   68-96     31-64  (148)
143 PRK11788 tetratricopeptide rep  66.2     3.4 7.3E-05   33.0   1.4   27   73-99    356-383 (389)
144 COG2051 RPS27A Ribosomal prote  66.1     4.2 9.1E-05   27.9   1.6   26   68-93     16-47  (67)
145 PLN02569 threonine synthase     65.8     6.1 0.00013   35.1   3.0   54   35-94     18-74  (484)
146 PTZ00083 40S ribosomal protein  65.3     6.8 0.00015   28.0   2.6   42   69-110    33-83  (85)
147 PF09332 Mcm10:  Mcm10 replicat  65.1     6.3 0.00014   34.1   2.9   38   62-102   278-320 (344)
148 PF14206 Cys_rich_CPCC:  Cystei  65.1     3.5 7.6E-05   28.7   1.1   20   73-92      3-28  (78)
149 PRK04860 hypothetical protein;  64.6     8.8 0.00019   29.6   3.4   55   41-97     87-156 (160)
150 cd01121 Sms Sms (bacterial rad  64.5     4.4 9.6E-05   34.7   1.8   26   73-98      2-28  (372)
151 PRK09521 exosome complex RNA-b  64.2     4.3 9.3E-05   31.2   1.6   27   73-100   151-181 (189)
152 PF12677 DUF3797:  Domain of un  64.0     3.5 7.7E-05   26.7   0.9   10   84-93     13-22  (49)
153 COG4031 Predicted metal-bindin  63.9     3.6 7.9E-05   33.7   1.2   19   73-93      2-21  (227)
154 PRK11823 DNA repair protein Ra  63.8     4.9 0.00011   35.0   2.1   30   68-98      5-35  (446)
155 smart00547 ZnF_RBZ Zinc finger  63.6     4.1   9E-05   21.7   1.0   21   73-93      4-25  (26)
156 PF08646 Rep_fac-A_C:  Replicat  63.4     7.9 0.00017   28.2   2.8   35   68-102    15-57  (146)
157 PF10601 zf-LITAF-like:  LITAF-  63.3     2.9 6.3E-05   27.5   0.4   26   82-108     5-30  (73)
158 PF08274 PhnA_Zn_Ribbon:  PhnA   63.3     3.1 6.6E-05   24.2   0.5   21   73-93      4-28  (30)
159 PF10367 Vps39_2:  Vacuolar sor  63.2     5.6 0.00012   26.7   1.8   11   84-94     78-88  (109)
160 PRK15103 paraquat-inducible me  62.8     4.3 9.2E-05   35.5   1.5   24   70-94    221-245 (419)
161 COG4469 CoiA Competence protei  62.6     3.5 7.6E-05   35.9   0.9   14   84-97     25-38  (342)
162 TIGR00155 pqiA_fam integral me  62.5     4.3 9.3E-05   35.2   1.4   23   73-95    217-241 (403)
163 smart00531 TFIIE Transcription  61.8     3.9 8.5E-05   30.4   1.0   26   68-94     97-133 (147)
164 PRK04023 DNA polymerase II lar  61.8     4.3 9.4E-05   40.0   1.5   20   73-93    628-647 (1121)
165 PF06676 DUF1178:  Protein of u  61.4       9  0.0002   29.5   2.9   33   67-102     2-49  (148)
166 PRK06266 transcription initiat  61.3     5.3 0.00012   31.0   1.6   57   36-94     83-146 (178)
167 COG3791 Uncharacterized conser  61.0     4.9 0.00011   29.5   1.3   17   81-97     66-82  (133)
168 smart00714 LITAF Possible memb  60.7     2.7 5.8E-05   27.3  -0.1   22   84-106     3-24  (67)
169 PF13453 zf-TFIIB:  Transcripti  60.6     3.9 8.5E-05   24.3   0.6    8   85-92     20-27  (41)
170 PHA02942 putative transposase;  60.1      12 0.00027   32.1   3.8   40   47-93    308-351 (383)
171 KOG3084 NADH pyrophosphatase I  59.7     4.5 9.8E-05   35.2   1.1    7   74-80    153-159 (345)
172 PF14949 ARF7EP_C:  ARF7 effect  59.7       5 0.00011   29.3   1.1   15   73-93     69-83  (103)
173 COG1328 NrdD Oxygen-sensitive   59.4     6.8 0.00015   36.9   2.2   62   39-113   615-680 (700)
174 COG1885 Uncharacterized protei  58.7     7.7 0.00017   29.0   2.0   22   80-103    45-66  (115)
175 COG0846 SIR2 NAD-dependent pro  58.5     5.7 0.00012   32.7   1.4   60   35-104    94-165 (250)
176 PF08394 Arc_trans_TRASH:  Arch  58.1      10 0.00022   23.1   2.1   23   87-109     1-23  (37)
177 TIGR00308 TRM1 tRNA(guanine-26  57.9     8.5 0.00019   33.1   2.5   26   68-94    231-262 (374)
178 COG2995 PqiA Uncharacterized p  57.8     4.6  0.0001   36.0   0.8   29   68-98    219-249 (418)
179 PF13408 Zn_ribbon_recom:  Reco  57.7     6.4 0.00014   23.9   1.3   15   83-97      4-18  (58)
180 PF01667 Ribosomal_S27e:  Ribos  57.7       6 0.00013   26.0   1.2   21   73-93      9-35  (55)
181 COG1110 Reverse gyrase [DNA re  57.6     4.6 9.9E-05   40.0   0.8   30   63-93    687-717 (1187)
182 PF01780 Ribosomal_L37ae:  Ribo  57.3     7.5 0.00016   27.9   1.7   20   83-103    34-53  (90)
183 TIGR00416 sms DNA repair prote  57.2     6.6 0.00014   34.4   1.7   29   69-98      6-35  (454)
184 PRK04136 rpl40e 50S ribosomal   56.8     6.3 0.00014   25.5   1.1   24   73-97     16-40  (48)
185 PHA00626 hypothetical protein   56.7     8.1 0.00018   25.9   1.7    8   86-93      2-9   (59)
186 PRK15103 paraquat-inducible me  56.6     5.6 0.00012   34.8   1.1   24   73-96     12-42  (419)
187 PRK00241 nudC NADH pyrophospha  56.5     5.4 0.00012   32.4   1.0   21   73-93    101-126 (256)
188 COG1997 RPL43A Ribosomal prote  56.4     8.1 0.00018   27.8   1.7   17   84-101    35-51  (89)
189 PRK05452 anaerobic nitric oxid  56.3     7.2 0.00016   34.3   1.8   23   70-93    425-467 (479)
190 PRK04338 N(2),N(2)-dimethylgua  56.1     9.4  0.0002   32.8   2.4   26   68-94    242-271 (382)
191 TIGR00686 phnA alkylphosphonat  55.4     6.6 0.00014   29.2   1.2   22   73-94      4-29  (109)
192 PRK08197 threonine synthase; V  55.2     9.2  0.0002   32.4   2.2   24   70-95      7-33  (394)
193 PRK12775 putative trifunctiona  54.9     5.9 0.00013   38.0   1.1   23   70-93    821-847 (1006)
194 PF14690 zf-ISL3:  zinc-finger   54.7     6.2 0.00013   23.4   0.8   10   85-94      3-12  (47)
195 COG0384 Predicted epimerase, P  54.5     9.4  0.0002   32.1   2.1   49   40-97     32-80  (291)
196 PF09862 DUF2089:  Protein of u  54.3     5.2 0.00011   29.6   0.5   20   74-93      1-21  (113)
197 PRK12366 replication factor A;  54.1      16 0.00035   33.5   3.7   26   67-93    529-557 (637)
198 PF13717 zinc_ribbon_4:  zinc-r  53.6      10 0.00022   22.4   1.6   21   73-93      4-34  (36)
199 COG1645 Uncharacterized Zn-fin  53.5     7.9 0.00017   29.5   1.4   26   82-121    26-51  (131)
200 PRK00504 rpmG 50S ribosomal pr  52.8     7.9 0.00017   24.8   1.1   29   68-98      5-47  (50)
201 PLN00209 ribosomal protein S27  52.8      11 0.00023   27.0   1.9   25   69-93     34-64  (86)
202 PF00641 zf-RanBP:  Zn-finger i  52.3     8.2 0.00018   21.4   1.0   21   73-93      6-27  (30)
203 TIGR01384 TFS_arch transcripti  52.0     8.5 0.00018   26.6   1.3   23   73-95      2-27  (104)
204 cd01410 SIRT7 SIRT7: Eukaryoti  52.0       5 0.00011   31.4   0.1   35   69-106    94-140 (206)
205 TIGR00373 conserved hypothetic  51.4     7.6 0.00016   29.5   1.0   24   70-94    109-138 (158)
206 COG3478 Predicted nucleic-acid  50.9     8.1 0.00017   26.6   1.0   16   87-102     7-23  (68)
207 COG5270 PUA domain (predicted   50.3      12 0.00027   30.4   2.1   30   67-98     11-40  (202)
208 COG0333 RpmF Ribosomal protein  50.0      13 0.00028   24.6   1.8   21   73-93     29-49  (57)
209 PF12760 Zn_Tnp_IS1595:  Transp  49.7      12 0.00026   22.7   1.6   10   84-93     18-27  (46)
210 PRK14715 DNA polymerase II lar  49.6      14  0.0003   37.8   2.7   31   65-97    669-699 (1627)
211 TIGR03831 YgiT_finger YgiT-typ  49.5      26 0.00055   20.2   2.9   13   81-93     29-41  (46)
212 PRK13764 ATPase; Provisional    49.5      15 0.00033   33.8   2.8   30   32-61    101-130 (602)
213 PF07975 C1_4:  TFIIH C1-like d  49.4     7.3 0.00016   25.1   0.6   11   69-80     20-30  (51)
214 PRK00464 nrdR transcriptional   48.4      17 0.00037   28.0   2.6   27   85-113    29-56  (154)
215 PRK05638 threonine synthase; V  48.4      12 0.00026   32.3   1.8   26   70-97      1-28  (442)
216 PF11781 RRN7:  RNA polymerase   48.1     9.4  0.0002   22.7   0.9   21   73-93     10-34  (36)
217 PF01907 Ribosomal_L37e:  Ribos  48.1     9.8 0.00021   25.2   1.0   29   68-98     14-44  (55)
218 PF00471 Ribosomal_L33:  Riboso  48.0      10 0.00022   24.0   1.0   14   84-98     32-45  (48)
219 PRK10220 hypothetical protein;  47.7      11 0.00024   28.1   1.3   22   73-94      5-30  (111)
220 TIGR02820 formald_GSH S-(hydro  47.7     8.1 0.00017   30.6   0.7   14   81-94     86-99  (182)
221 COG1594 RPB9 DNA-directed RNA   47.3       8 0.00017   28.2   0.6   11   84-94      2-12  (113)
222 KOG2906 RNA polymerase III sub  47.2     8.9 0.00019   28.3   0.8   12   85-96      2-13  (105)
223 COG1412 Uncharacterized protei  46.8      23  0.0005   26.9   3.0   30   34-63     99-128 (136)
224 PRK06386 replication factor A;  46.4      12 0.00027   32.4   1.7   23   68-93    234-257 (358)
225 COG1867 TRM1 N2,N2-dimethylgua  46.3      12 0.00025   33.1   1.5   25   68-93    238-266 (380)
226 PRK00432 30S ribosomal protein  45.9      14  0.0003   23.4   1.4   21   73-93     22-46  (50)
227 PTZ00157 60S ribosomal protein  45.8      14  0.0003   26.3   1.5   17   84-101     9-25  (84)
228 TIGR00155 pqiA_fam integral me  45.7      11 0.00025   32.6   1.4   22   73-94     15-43  (403)
229 KOG1779 40s ribosomal protein   45.7      13 0.00027   26.6   1.3   25   69-93     32-62  (84)
230 PRK00595 rpmG 50S ribosomal pr  45.6      12 0.00026   24.0   1.2   29   68-98      8-50  (53)
231 TIGR02387 rpoC1_cyan DNA-direc  45.2     7.6 0.00017   36.2   0.2   30   66-99     59-91  (619)
232 PF14354 Lar_restr_allev:  Rest  44.6      19  0.0004   22.5   1.9    8   86-93      5-12  (61)
233 PRK08402 replication factor A;  44.5      33 0.00072   29.6   3.9   32   69-101   211-249 (355)
234 PF09567 RE_MamI:  MamI restric  44.3     9.6 0.00021   32.6   0.7   27   72-99     83-110 (314)
235 PF09151 DUF1936:  Domain of un  44.3      19 0.00041   21.7   1.7   14   85-99      2-15  (36)
236 cd00296 SIR2 SIR2 superfamily   44.2      35 0.00076   26.0   3.7   51   35-94     83-144 (222)
237 PRK08329 threonine synthase; V  44.1      15 0.00032   30.7   1.8   25   71-97      2-28  (347)
238 COG2405 Predicted nucleic acid  44.1      18 0.00038   28.5   2.0   29   32-60     85-114 (157)
239 PRK01110 rpmF 50S ribosomal pr  44.0      12 0.00026   24.6   1.0   19   73-92     29-47  (60)
240 TIGR00280 L37a ribosomal prote  43.9      26 0.00057   25.2   2.7   20   83-103    34-53  (91)
241 PF03833 PolC_DP2:  DNA polymer  43.8     7.7 0.00017   37.6   0.0   27   66-93    663-689 (900)
242 PF10058 DUF2296:  Predicted in  43.6      14 0.00031   23.7   1.3   26   67-93     19-53  (54)
243 TIGR01023 rpmG_bact ribosomal   43.5      14  0.0003   23.9   1.2   29   68-98      9-51  (54)
244 PF04423 Rad50_zn_hook:  Rad50   43.4     7.2 0.00016   24.3  -0.2   10   85-94     21-30  (54)
245 PRK05767 rpl44e 50S ribosomal   43.3      16 0.00034   26.4   1.5   17   84-101     8-24  (92)
246 PF11672 DUF3268:  Protein of u  43.2      14 0.00031   26.9   1.3   29   85-118     3-31  (102)
247 PF03854 zf-P11:  P-11 zinc fin  43.2       4 8.7E-05   26.6  -1.4   22   73-94     23-45  (50)
248 PF11648 RIG-I_C-RD:  C-termina  43.2      20 0.00044   26.2   2.1   27   82-119    58-85  (123)
249 PRK05417 glutathione-dependent  43.1      10 0.00023   30.1   0.7   17   82-99     91-107 (191)
250 PTZ00255 60S ribosomal protein  43.0      26 0.00057   25.1   2.6   20   83-103    35-54  (90)
251 PRK02625 rpoC1 DNA-directed RN  43.0     9.7 0.00021   35.5   0.5   30   66-99     66-98  (627)
252 cd01408 SIRT1 SIRT1: Eukaryoti  42.6      18 0.00039   28.9   1.9   43   55-106   107-160 (235)
253 PF09855 DUF2082:  Nucleic-acid  42.6      11 0.00024   25.2   0.6    8   86-93      2-9   (64)
254 PF02005 TRM:  N2,N2-dimethylgu  42.1      18 0.00039   31.2   2.0   27   67-94    237-269 (377)
255 PF02146 SIR2:  Sir2 family;  I  42.1      25 0.00054   26.3   2.5   35   68-105   103-148 (178)
256 PF15616 TerY-C:  TerY-C metal   41.6      16 0.00035   27.7   1.4   22   73-95     91-116 (131)
257 PRK03976 rpl37ae 50S ribosomal  41.2      31 0.00068   24.7   2.8   20   83-103    35-54  (90)
258 PF14255 Cys_rich_CPXG:  Cystei  40.9      22 0.00048   22.9   1.8   23   86-109     2-24  (52)
259 COG5134 Uncharacterized conser  40.9      20 0.00044   30.1   2.0   52   58-113    30-105 (272)
260 KOG2932 E3 ubiquitin ligase in  40.7      19  0.0004   31.7   1.9   70   36-123    42-114 (389)
261 KOG2691 RNA polymerase II subu  40.6      25 0.00054   26.3   2.3   20   83-113    72-91  (113)
262 COG2995 PqiA Uncharacterized p  40.5      16 0.00035   32.6   1.5   27   68-95     16-49  (418)
263 TIGR00201 comF comF family pro  40.2      15 0.00032   28.0   1.1   21   74-94      1-22  (190)
264 PRK04179 rpl37e 50S ribosomal   39.7      16 0.00034   24.7   1.0   21   73-93     19-42  (62)
265 PF14447 Prok-RING_4:  Prokaryo  39.4      18 0.00038   23.9   1.2   20   73-94     29-49  (55)
266 COG1066 Sms Predicted ATP-depe  39.3      18  0.0004   32.6   1.7   28   69-97      6-34  (456)
267 CHL00018 rpoC1 RNA polymerase   39.0      10 0.00023   35.5   0.1   31   66-100    64-100 (663)
268 COG2956 Predicted N-acetylgluc  38.4     7.9 0.00017   34.2  -0.7   39   59-100   345-384 (389)
269 COG0675 Transposase and inacti  38.2      17 0.00036   28.2   1.1   21   73-93    311-331 (364)
270 PRK09678 DNA-binding transcrip  38.1      21 0.00046   24.4   1.5   13   85-97      2-14  (72)
271 PF02639 DUF188:  Uncharacteriz  37.9      43 0.00093   24.9   3.2   29   36-64     54-82  (130)
272 PF06054 CoiA:  Competence prot  37.3      18 0.00038   31.0   1.2   16   82-97     28-43  (375)
273 COG1552 RPL40A Ribosomal prote  37.2     6.6 0.00014   25.6  -1.0   24   73-97     16-40  (50)
274 COG1998 RPS31 Ribosomal protei  37.2      33 0.00072   22.4   2.2   36   54-93      6-46  (51)
275 PF01599 Ribosomal_S27:  Riboso  37.1      14 0.00031   23.5   0.5   20   73-92     20-46  (47)
276 CHL00104 rpl33 ribosomal prote  37.1      19 0.00041   24.4   1.1   14   84-98     49-62  (66)
277 PRK14892 putative transcriptio  36.7      20 0.00044   25.8   1.3   21   73-93     23-51  (99)
278 TIGR02642 phage_xxxx uncharact  36.4      81  0.0017   25.1   4.7   27   70-97     99-128 (186)
279 smart00653 eIF2B_5 domain pres  36.1      21 0.00045   26.0   1.3   25   66-92     77-109 (110)
280 PRK03988 translation initiatio  36.0      21 0.00047   26.9   1.4   27   66-94     99-133 (138)
281 TIGR00311 aIF-2beta translatio  35.8      23 0.00049   26.7   1.5   27   66-94     94-128 (133)
282 PRK00566 DNA-directed RNA poly  35.7      18  0.0004   35.9   1.2   31   66-100    55-88  (1156)
283 PRK00241 nudC NADH pyrophospha  35.6      35 0.00076   27.7   2.6   12   83-94     98-109 (256)
284 COG3813 Uncharacterized protei  35.3     9.9 0.00022   26.9  -0.5   25   73-98     31-55  (84)
285 PRK07217 replication factor A;  35.3      22 0.00048   30.5   1.5   24   68-93    186-211 (311)
286 PRK00481 NAD-dependent deacety  35.2      34 0.00074   27.1   2.5   24   70-94    122-152 (242)
287 PF12387 Peptidase_C74:  Pestiv  35.1      17 0.00036   29.5   0.7   23   73-95    164-186 (200)
288 KOG0823 Predicted E3 ubiquitin  35.1      14 0.00031   30.5   0.3   28   73-100    69-100 (230)
289 cd01407 SIR2-fam SIR2 family o  35.0      32 0.00069   26.8   2.2   39   48-93     92-142 (218)
290 TIGR03826 YvyF flagellar opero  34.6      12 0.00025   28.5  -0.3   20   73-92      5-26  (137)
291 cd01411 SIR2H SIR2H: Uncharact  34.5      28  0.0006   27.5   1.8   23   70-93    118-145 (225)
292 COG3058 FdhE Uncharacterized p  34.4      19  0.0004   31.0   0.9   12   82-93    183-194 (308)
293 COG2816 NPY1 NTP pyrophosphohy  34.0      22 0.00047   30.2   1.2   21   73-93    113-138 (279)
294 PF01927 Mut7-C:  Mut7-C RNAse   33.5      22 0.00047   26.3   1.1    8   73-80     93-100 (147)
295 TIGR02159 PA_CoA_Oxy4 phenylac  33.1      18 0.00039   27.4   0.6   10   85-94    106-115 (146)
296 COG2126 RPL37A Ribosomal prote  33.1      21 0.00045   24.1   0.8   21   73-93     18-40  (61)
297 PF09986 DUF2225:  Uncharacteri  33.1      26 0.00057   27.7   1.5   28   84-113     5-32  (214)
298 cd03361 TOPRIM_TopoIA_RevGyr T  32.9      36 0.00078   25.9   2.2   25   68-93     75-100 (170)
299 TIGR01206 lysW lysine biosynth  32.4      18 0.00039   23.5   0.4   13   86-98      4-16  (54)
300 PRK14138 NAD-dependent deacety  32.4      32  0.0007   27.6   1.9   33   70-105   119-162 (244)
301 KOG2907 RNA polymerase I trans  32.4      19 0.00042   27.0   0.6   10   84-93     74-83  (116)
302 PRK08764 ferredoxin; Provision  32.0      55  0.0012   23.9   2.9   41   39-79     48-92  (135)
303 PRK14289 chaperone protein Dna  31.8      69  0.0015   27.3   3.9   26   70-96    197-223 (386)
304 PF14353 CpXC:  CpXC protein     31.6      21 0.00046   25.5   0.7   11   84-94     38-48  (128)
305 PTZ00073 60S ribosomal protein  31.5      22 0.00048   25.7   0.8   26   67-94     14-41  (91)
306 PTZ00408 NAD-dependent deacety  31.1      26 0.00056   28.3   1.2   36   69-105   116-158 (242)
307 TIGR00595 priA primosomal prot  31.0      27 0.00058   31.0   1.3   21   73-97    215-235 (505)
308 PF08996 zf-DNA_Pol:  DNA Polym  30.9      27 0.00058   27.0   1.2   34   59-93      7-54  (188)
309 PRK07418 acetolactate synthase  30.8      25 0.00054   31.4   1.1   21   73-93    594-615 (616)
310 cd03472 Rieske_RO_Alpha_BPDO_l  30.7      74  0.0016   23.0   3.4   93   23-116    22-126 (128)
311 COG1631 RPL42A Ribosomal prote  30.7      32 0.00069   25.0   1.5   16   84-100     8-23  (94)
312 PRK14873 primosome assembly pr  30.7      27 0.00059   32.4   1.4   26   68-98    381-406 (665)
313 COG1040 ComFC Predicted amidop  30.6      12 0.00026   29.9  -0.8   22   73-94     26-48  (225)
314 PRK12495 hypothetical protein;  30.3      27 0.00059   28.9   1.2   21   73-93     44-67  (226)
315 cd01413 SIR2_Af2 SIR2_Af2: Arc  30.1      21 0.00046   28.0   0.5   24   69-93    112-145 (222)
316 smart00290 ZnF_UBP Ubiquitin C  29.9      31 0.00066   20.6   1.1   19   73-92      1-19  (50)
317 PF13005 zf-IS66:  zinc-finger   29.8      49  0.0011   19.6   2.0   18   60-78     30-47  (47)
318 PHA02325 hypothetical protein   29.7      25 0.00053   24.4   0.7   11   83-93      2-12  (72)
319 TIGR00627 tfb4 transcription f  29.3      37  0.0008   28.4   1.8   25   67-93    252-278 (279)
320 PRK14906 DNA-directed RNA poly  29.2      20 0.00043   36.6   0.3   30   66-99     57-89  (1460)
321 COG2401 ABC-type ATPase fused   29.0      39 0.00085   31.2   2.0   71   36-116   104-194 (593)
322 TIGR00575 dnlj DNA ligase, NAD  28.6      96  0.0021   28.8   4.5   47   46-94    349-402 (652)
323 KOG3799 Rab3 effector RIM1 and  28.4      30 0.00066   27.2   1.1   14   84-97     89-102 (169)
324 PRK14810 formamidopyrimidine-D  28.3      31 0.00067   28.2   1.2   11   84-94    244-254 (272)
325 PTZ00410 NAD-dependent SIR2; P  27.9      63  0.0014   28.0   3.1   35   69-106   146-191 (349)
326 PF13824 zf-Mss51:  Zinc-finger  27.7      42 0.00091   22.1   1.5   20   74-93      2-23  (55)
327 COG3529 Predicted nucleic-acid  27.6      17 0.00038   24.8  -0.3   21   73-93     12-41  (66)
328 PF07131 DUF1382:  Protein of u  27.5      49  0.0011   22.3   1.8   17   43-59     14-30  (61)
329 PF14569 zf-UDP:  Zinc-binding   27.4      11 0.00025   26.6  -1.3   21   73-93     38-60  (80)
330 PRK12267 methionyl-tRNA synthe  27.3      94   0.002   28.2   4.1   57   43-111   104-165 (648)
331 PRK03922 hypothetical protein;  27.2      47   0.001   24.9   1.9   14   80-93     45-58  (113)
332 KOG3022 Predicted ATPase, nucl  27.2      80  0.0017   27.2   3.5   45   35-94    185-232 (300)
333 COG1327 Predicted transcriptio  27.1      56  0.0012   25.7   2.4   39   73-113     2-56  (156)
334 TIGR00622 ssl1 transcription f  27.1      38 0.00083   25.1   1.4   20   73-93      3-24  (112)
335 PRK12336 translation initiatio  26.9      37  0.0008   26.8   1.4   21   58-79    107-127 (201)
336 smart00778 Prim_Zn_Ribbon Zinc  26.9      29 0.00063   20.9   0.6   10   85-94      4-13  (37)
337 COG1379 PHP family phosphoeste  26.6      14  0.0003   32.7  -1.2   34   65-99    240-279 (403)
338 PF11682 DUF3279:  Protein of u  26.6      44 0.00094   25.3   1.6   31   61-94     90-120 (128)
339 PF06827 zf-FPG_IleRS:  Zinc fi  26.2      47   0.001   18.2   1.4   10   85-94      2-11  (30)
340 cd01409 SIRT4 SIRT4: Eukaryoti  26.2      35 0.00075   27.7   1.1   20   86-107   171-190 (260)
341 PF00609 DAGK_acc:  Diacylglyce  26.2      56  0.0012   24.3   2.2    9  106-114   152-160 (161)
342 PF04475 DUF555:  Protein of un  26.1      50  0.0011   24.3   1.8   14   80-93     43-56  (102)
343 TIGR03655 anti_R_Lar restricti  25.9      45 0.00097   20.7   1.4   11   85-95      2-12  (53)
344 PF06044 DRP:  Dam-replacing fa  25.6      32 0.00069   29.0   0.8   15   84-99     31-45  (254)
345 PRK10445 endonuclease VIII; Pr  25.6      41 0.00089   27.3   1.5   11   84-94    235-245 (263)
346 PF10122 Mu-like_Com:  Mu-like   25.6      30 0.00065   22.6   0.5   25   73-97      6-37  (51)
347 cd07973 Spt4 Transcription elo  25.5      36 0.00079   24.5   1.0   19   73-91      5-27  (98)
348 PF10083 DUF2321:  Uncharacteri  25.5       7 0.00015   30.7  -2.9   34   59-94     12-49  (158)
349 TIGR03676 aRF1/eRF1 peptide ch  25.5      48  0.0011   28.9   1.9   27   67-94    317-352 (403)
350 PF10013 DUF2256:  Uncharacteri  25.4      23  0.0005   22.2  -0.0   15   81-95      5-19  (42)
351 COG4888 Uncharacterized Zn rib  25.1      69  0.0015   23.7   2.4   13   84-97     22-34  (104)
352 TIGR00244 transcriptional regu  25.1      73  0.0016   24.7   2.7   39   73-113     2-56  (147)
353 PRK14289 chaperone protein Dna  25.1 1.2E+02  0.0026   25.9   4.2   31   64-94    147-181 (386)
354 KOG0856 Predicted pilin-like t  24.9      53  0.0011   25.6   1.8   45   47-93     32-78  (146)
355 cd01412 SIRT5_Af1_CobB SIRT5_A  24.8      62  0.0014   25.1   2.3   24   69-93    108-139 (224)
356 PRK13795 hypothetical protein;  24.7      79  0.0017   29.0   3.2   32   66-101     8-39  (636)
357 KOG3475 60S ribosomal protein   24.3      25 0.00054   25.4  -0.0   32   64-97     11-44  (92)
358 PRK04011 peptide chain release  24.3      53  0.0012   28.6   2.0   26   68-94    326-360 (411)
359 PF08273 Prim_Zn_Ribbon:  Zinc-  24.2      40 0.00086   20.6   0.9   10   85-94      4-13  (40)
360 cd00817 ValRS_core catalytic c  24.2 1.9E+02  0.0042   24.5   5.3   45   62-112   132-176 (382)
361 TIGR00577 fpg formamidopyrimid  24.2      46   0.001   27.1   1.5   12   84-95    245-256 (272)
362 PF05876 Terminase_GpA:  Phage   24.1      54  0.0012   29.6   2.1   29   66-95    196-240 (557)
363 COG1571 Predicted DNA-binding   24.1      41 0.00088   30.1   1.2   32   62-93    339-376 (421)
364 PF01485 IBR:  IBR domain;  Int  24.0      43 0.00093   20.2   1.0   21   73-93     20-49  (64)
365 PTZ00409 Sir2 (Silent Informat  24.0      36 0.00079   28.0   0.9   33   69-105   136-183 (271)
366 PRK14811 formamidopyrimidine-D  23.9      42 0.00091   27.4   1.2   12   84-95    235-246 (269)
367 PF13913 zf-C2HC_2:  zinc-finge  23.8      39 0.00085   18.3   0.7   10   84-93      2-11  (25)
368 PF03850 Tfb4:  Transcription f  23.6      40 0.00088   28.0   1.1   25   66-91    249-276 (276)
369 PF09334 tRNA-synt_1g:  tRNA sy  23.4      45 0.00098   28.6   1.4   31   43-80     99-129 (391)
370 PRK01103 formamidopyrimidine/5  23.3      44 0.00095   27.2   1.2   11   84-94    245-255 (274)
371 PRK05333 NAD-dependent deacety  23.2      76  0.0017   25.9   2.6    8   86-93    181-188 (285)
372 PF04161 Arv1:  Arv1-like famil  23.0      33 0.00072   26.9   0.4   21   73-93      2-33  (208)
373 PRK00124 hypothetical protein;  23.0 1.2E+02  0.0026   23.4   3.5   40   23-63     58-97  (151)
374 PF01020 Ribosomal_L40e:  Ribos  23.0      79  0.0017   20.7   2.1   25   73-97     19-46  (52)
375 PF14471 DUF4428:  Domain of un  23.0      35 0.00076   21.6   0.5   11   86-96      1-11  (51)
376 COG3357 Predicted transcriptio  22.9      40 0.00087   24.6   0.8   21   73-93     60-85  (97)
377 smart00532 LIGANc Ligase N fam  22.7      47   0.001   29.4   1.3   47   45-94    355-409 (441)
378 COG1138 CcmF Cytochrome c biog  22.7      40 0.00086   31.8   0.9   18   35-52     59-76  (648)
379 PF05495 zf-CHY:  CHY zinc fing  22.6      40 0.00088   22.3   0.7   22   70-92     41-69  (71)
380 TIGR00269 conserved hypothetic  22.6      39 0.00084   23.7   0.7   17   73-90     82-98  (104)
381 PRK14276 chaperone protein Dna  22.5 1.2E+02  0.0027   25.8   3.8   35   73-108   148-186 (380)
382 PF02132 RecR:  RecR protein;    22.5     5.6 0.00012   23.9  -3.1   28   64-93     11-38  (41)
383 PRK07225 DNA-directed RNA poly  22.4      56  0.0012   30.2   1.8   28   73-100   546-578 (605)
384 PF00628 PHD:  PHD-finger;  Int  22.4      63  0.0014   19.1   1.5   20   73-92      1-22  (51)
385 PRK13945 formamidopyrimidine-D  22.3      48   0.001   27.2   1.3   11   84-94    254-264 (282)
386 PF00645 zf-PARP:  Poly(ADP-rib  22.2      45 0.00098   21.9   0.9   39   83-123     6-45  (82)
387 PF02348 CTP_transf_3:  Cytidyl  22.0 1.3E+02  0.0027   22.3   3.4   28   33-60     41-68  (217)
388 PF12674 Zn_ribbon_2:  Putative  21.8      42 0.00091   23.1   0.7   11   85-95      1-11  (81)
389 PF11062 DUF2863:  Protein of u  21.8      40 0.00087   30.0   0.8   20   82-114   362-381 (398)
390 PF13920 zf-C3HC4_3:  Zinc fing  21.4      18  0.0004   21.8  -1.0   22   73-94     25-47  (50)
391 PF14599 zinc_ribbon_6:  Zinc-r  21.1 1.1E+02  0.0023   20.3   2.5   31   64-96     25-60  (61)
392 KOG3507 DNA-directed RNA polym  20.9      32 0.00069   23.3  -0.0   29   65-94     15-47  (62)
393 KOG4718 Non-SMC (structural ma  20.7      48   0.001   27.6   1.0   28   64-92    188-224 (235)
394 PF04502 DUF572:  Family of unk  20.7      54  0.0012   27.6   1.3   17   63-80     33-49  (324)
395 PF09526 DUF2387:  Probable met  20.7      53  0.0012   22.3   1.0   21   73-93     10-39  (71)
396 PRK00076 recR recombination pr  20.7      41 0.00089   26.9   0.5   38   63-102    46-83  (196)
397 TIGR02386 rpoC_TIGR DNA-direct  20.6      50  0.0011   33.0   1.2   31   65-99     46-79  (1140)
398 COG1671 Uncharacterized protei  20.4 1.4E+02  0.0029   23.3   3.3   42   20-62     54-95  (150)
399 PRK00423 tfb transcription ini  20.2      53  0.0012   27.2   1.1   21   73-93     13-39  (310)
400 PRK14290 chaperone protein Dna  20.1 1.5E+02  0.0033   25.0   3.9   24   73-96    193-217 (365)

No 1  
>KOG2463 consensus Predicted RNA-binding protein Nob1p involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones]
Probab=100.00  E-value=3.4e-34  Score=241.61  Aligned_cols=86  Identities=36%  Similarity=0.665  Sum_probs=77.7

Q ss_pred             CCCCCCceeccCC--------------CCceeEEecccHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc--c
Q 033276           18 DECSEQSWMLRSL--------------SESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS--P   81 (123)
Q Consensus        18 ~~~~~~~WIt~~~--------------~~~~va~vTdDyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~--~   81 (123)
                      ||.++++||||+|              ....|||+|+||||||||+||||+++++.|++|+++|+|++ ||+|||++  +
T Consensus       176 ed~DdDgwitp~ni~~~~~e~~al~~pe~~~Vac~TtDfamQNVlLqm~L~l~~~~G~~Ir~~r~~iL-RCh~Cfsit~~  254 (376)
T KOG2463|consen  176 EDADDDGWITPSNITEAIIELGALNRPENQLVACLTTDFAMQNVLLQMNLNLLAMSGMKIRSVRSYIL-RCHGCFSITSE  254 (376)
T ss_pred             cccccccccccchHHHHHHhhhcccccccceeeeecccHHHHHHHHHhcccccCccchhhhhhhhhee-EeeeeeEecCc
Confidence            4444444999995              36679999999999999999999999999999999999999 99999998  7


Q ss_pred             cCccccccCCCCCeeeEEEEEeeE
Q 033276           82 FPLVICIKSNHEIRISPVFMLILI  105 (123)
Q Consensus        82 ~~~~fCp~CG~~~tl~rV~~~~~~  105 (123)
                      +++.|||+||++ ||+||+|+++.
T Consensus       255 m~k~FCp~CG~~-TL~K~aVsv~~  277 (376)
T KOG2463|consen  255 MPKDFCPSCGHK-TLTKCAVSVDE  277 (376)
T ss_pred             cchhcccccCCC-eeeEEEEEecC
Confidence            899999999999 99999998864


No 2  
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=99.89  E-value=3.6e-24  Score=167.33  Aligned_cols=78  Identities=23%  Similarity=0.310  Sum_probs=65.0

Q ss_pred             CCCCceeccCC-----------CCceeEEecccHHHHHHHHHhCceeeCCC-CCcceeeeEEeeccccCCccc-ccCccc
Q 033276           20 CSEQSWMLRSL-----------SESTVACITGDYAMQNVILQMGLRLLAPG-GMQIRQLHRYIVDKCLKLFSS-PFPLVI   86 (123)
Q Consensus        20 ~~~~~WIt~~~-----------~~~~va~vTdDyAmQNVllqlGL~l~sv~-g~~I~~v~~wvl~rC~gC~k~-~~~~~f   86 (123)
                      .++-.|++++.           .+.+|+++||||||||||+||||+|+++. +.+|+++++|++ ||+||+++ +++.+|
T Consensus        77 tgd~~~LS~tDi~VlalAlel~~~~~v~l~TdDysvQNVa~~Lgi~~~~~~~~~~I~~v~~w~~-rC~GC~~~f~~~~~~  155 (177)
T COG1439          77 TGDLGNLSPTDIEVLALALELGEEVQVALATDDYSVQNVALQLGLNVRSISYKGKIKKVRKWRL-RCHGCKRIFPEPKDF  155 (177)
T ss_pred             hCcccccChhhHHHHHHHHhhccccceeEEecchHHHHHHHHhCceEEeeeccCccceEeeeeE-EEecCceecCCCCCc
Confidence            34445787762           23458999999999999999999999854 566999999999 99999999 888999


Q ss_pred             cccCCCCCeeeEE
Q 033276           87 CIKSNHEIRISPV   99 (123)
Q Consensus        87 Cp~CG~~~tl~rV   99 (123)
                      ||.||++ ++++.
T Consensus       156 Cp~CG~~-~~~~~  167 (177)
T COG1439         156 CPICGSP-LKRKR  167 (177)
T ss_pred             CCCCCCc-eEEee
Confidence            9999999 44443


No 3  
>PRK12496 hypothetical protein; Provisional
Probab=99.79  E-value=5.1e-20  Score=140.68  Aligned_cols=67  Identities=19%  Similarity=0.320  Sum_probs=60.0

Q ss_pred             CceeEEecccHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc-c--cCccccccCCCCCeeeEE
Q 033276           32 ESTVACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-P--FPLVICIKSNHEIRISPV   99 (123)
Q Consensus        32 ~~~va~vTdDyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~--~~~~fCp~CG~~~tl~rV   99 (123)
                      ++.+.++||||++||||++|||++.++++++|+++++|++ +|+||++. +  .+.+|||+||+++.++++
T Consensus        89 el~~~lvtDD~~~~~vA~~lgi~v~~~~~~~i~~~~~w~~-~C~gC~~~~~~~~~~~~C~~CG~~~~r~~~  158 (164)
T PRK12496         89 ELNGTLYTDDYGIQNVAKKLNIKFENIKTKGIKKVIKWRK-VCKGCKKKYPEDYPDDVCEICGSPVKRKMV  158 (164)
T ss_pred             HhCCcEECcHHHHHHHHHHcCCeEeccccccchhheeeeE-ECCCCCccccCCCCCCcCCCCCChhhhcch
Confidence            3457999999999999999999999999999999999999 99999998 4  467999999999655544


No 4  
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=99.65  E-value=4.6e-17  Score=111.73  Aligned_cols=41  Identities=15%  Similarity=0.406  Sum_probs=19.5

Q ss_pred             cceeeeEEeeccccCCccc--ccCccccccCCCCCeeeEEEEEee
Q 033276           62 QIRQLHRYIVDKCLKLFSS--PFPLVICIKSNHEIRISPVFMLIL  104 (123)
Q Consensus        62 ~I~~v~~wvl~rC~gC~k~--~~~~~fCp~CG~~~tl~rV~~~~~  104 (123)
                      +|+++|+|++ ||+|||++  ++++.|||+|||+ ||+||+|++.
T Consensus         1 rIk~~k~~vl-rC~aCf~~t~~~~k~FCp~CGn~-TL~rvsvsv~   43 (73)
T PF08772_consen    1 RIKRVKTWVL-RCHACFKITKDMTKQFCPKCGNA-TLKRVSVSVD   43 (73)
T ss_dssp             -------EEE-E-SSS--EES-SS--S-SSS--S---EEEE-B--
T ss_pred             CcchhheeeE-EccccccCcCCCCceeCcccCCC-cceEEEEEEC
Confidence            6899999999 99999998  7999999999999 9999999876


No 5  
>TIGR03875 RNA_lig_partner RNA ligase partner, MJ_0950 family. This uncharacterized protein family is found almost perfectly in the same set of genomes as the Pab1020 family described by model TIGR01209. These pairs are found mostly in Archaea, but also in a few bacteria (e.g. Alkalilimnicola ehrlichei MLHE-1, Aquifex aeolicus). While the partner protein has been described as homodimeric ligase that has RNA circularization activity, the function of this protein (also called UPF0278) is unknown.
Probab=97.89  E-value=7.7e-06  Score=65.89  Aligned_cols=27  Identities=22%  Similarity=0.416  Sum_probs=25.1

Q ss_pred             CceeEEecccHHHHHHHHHhCceeeCC
Q 033276           32 ESTVACITGDYAMQNVILQMGLRLLAP   58 (123)
Q Consensus        32 ~~~va~vTdDyAmQNVllqlGL~l~sv   58 (123)
                      +++++++||||+|||+|.+|||++++.
T Consensus       169 ELda~lvTdD~giqn~A~~Lgi~~~~~  195 (206)
T TIGR03875       169 ELDAAVVSADEGIRKWAERLGLRFVDA  195 (206)
T ss_pred             HcCcEEEeCcHHHHHHHHHcCCeeecH
Confidence            678999999999999999999999974


No 6  
>PRK04358 hypothetical protein; Provisional
Probab=97.74  E-value=1.6e-05  Score=64.43  Aligned_cols=27  Identities=22%  Similarity=0.416  Sum_probs=25.0

Q ss_pred             CceeEEecccHHHHHHHHHhCceeeCC
Q 033276           32 ESTVACITGDYAMQNVILQMGLRLLAP   58 (123)
Q Consensus        32 ~~~va~vTdDyAmQNVllqlGL~l~sv   58 (123)
                      +++++++|+||+|||+|.+|||++++.
T Consensus       173 ELda~lvTdD~giqn~A~~LGI~~~~~  199 (217)
T PRK04358        173 ELDAAVVSADEGIRKWAERLGLRFVDA  199 (217)
T ss_pred             HhCCEEEeCCHHHHHHHHHcCCeeecH
Confidence            568899999999999999999999985


No 7  
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=97.15  E-value=0.00019  Score=40.01  Aligned_cols=21  Identities=10%  Similarity=0.078  Sum_probs=19.1

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|+.|++. +....|||.||.+
T Consensus         4 ~Cp~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    4 FCPNCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCcccCCcCCcccccChhhCCC
Confidence            79999998 7778999999987


No 8  
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=96.96  E-value=0.00037  Score=38.22  Aligned_cols=21  Identities=10%  Similarity=0.070  Sum_probs=18.3

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      +|+-|++. +..-.|||.||.+
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCCc
Confidence            59999998 6667999999987


No 9  
>PF08745 UPF0278:  UPF0278 family;  InterPro: IPR022785 This entry contains proteins of the UPF0278 family and proteins containing PIN domains. Members of the UPF0278 family are uncharacterised and about 200 amino acids in length.; PDB: 2LCQ_A.
Probab=96.84  E-value=0.00055  Score=55.27  Aligned_cols=28  Identities=29%  Similarity=0.523  Sum_probs=16.9

Q ss_pred             CceeEEecccHHHHHHHHHhCceeeCCC
Q 033276           32 ESTVACITGDYAMQNVILQMGLRLLAPG   59 (123)
Q Consensus        32 ~~~va~vTdDyAmQNVllqlGL~l~sv~   59 (123)
                      +++++++|+||+|||++.+|||+++...
T Consensus       166 El~a~lvt~D~gi~~~A~~lGi~~i~~~  193 (205)
T PF08745_consen  166 ELDAVLVTDDYGIQNWAEKLGIRFIDAR  193 (205)
T ss_dssp             HHT--EE---HHHHHHHHHTT--EE---
T ss_pred             HcCCEEEeCCHhHHHHHHHCCCEEEecc
Confidence            5678999999999999999999999874


No 10 
>PF15017 AF1Q:  Drug resistance and apoptosis regulator
Probab=96.34  E-value=0.0019  Score=46.03  Aligned_cols=18  Identities=11%  Similarity=0.213  Sum_probs=13.3

Q ss_pred             ccccCCCCCCCceeccCC
Q 033276           13 VSYVDDECSEQSWMLRSL   30 (123)
Q Consensus        13 ~~~~~~~~~~~~WIt~~~   30 (123)
                      .+++++++++|+||||+|
T Consensus        63 ~eee~~ddD~gGWITPsN   80 (87)
T PF15017_consen   63 EEEEEEDDDGGGWITPSN   80 (87)
T ss_pred             cccccccCCCCccccchh
Confidence            344456677899999996


No 11 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=96.16  E-value=0.0057  Score=37.30  Aligned_cols=30  Identities=17%  Similarity=0.184  Sum_probs=23.0

Q ss_pred             EEeeccccCCccc--------ccCccccccCCCCCeeeEE
Q 033276           68 RYIVDKCLKLFSS--------PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        68 ~wvl~rC~gC~k~--------~~~~~fCp~CG~~~tl~rV   99 (123)
                      .|.| +|..|+..        +.....||.||+. .++|+
T Consensus         3 ~Yey-~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~-~~~r~   40 (42)
T PF09723_consen    3 IYEY-RCEECGHEFEVLQSISEDDPVPCPECGST-EVRRV   40 (42)
T ss_pred             CEEE-EeCCCCCEEEEEEEcCCCCCCcCCCCCCC-ceEEe
Confidence            4788 99999954        2346889999996 66665


No 12 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=96.05  E-value=0.0033  Score=35.50  Aligned_cols=21  Identities=14%  Similarity=0.284  Sum_probs=19.0

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|+.|++. +..-.+||.||+.
T Consensus         2 ~CP~C~~~V~~~~~~Cp~CG~~   23 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCPHCGYD   23 (26)
T ss_pred             cCCCCcCCchhhcCcCCCCCCC
Confidence            79999998 7778999999987


No 13 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=95.85  E-value=0.008  Score=43.59  Aligned_cols=41  Identities=10%  Similarity=-0.039  Sum_probs=29.6

Q ss_pred             eeEEeeccccCCccc-c--cCccccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           66 LHRYIVDKCLKLFSS-P--FPLVICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        66 v~~wvl~rC~gC~k~-~--~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      ...=+. +|..|+.. .  .....||.||+.    .+.++-|.-+||++
T Consensus        66 ~vp~~~-~C~~Cg~~~~~~~~~~~CP~Cgs~----~~~i~~G~El~i~~  109 (113)
T PRK12380         66 YKPAQA-WCWDCSQVVEIHQHDAQCPHCHGE----RLRVDTGDSLIVKS  109 (113)
T ss_pred             eeCcEE-EcccCCCEEecCCcCccCcCCCCC----CcEEccCCeEEEEE
Confidence            334466 99999987 3  234559999988    35667788888874


No 14 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=95.83  E-value=0.0074  Score=43.82  Aligned_cols=40  Identities=10%  Similarity=-0.007  Sum_probs=28.8

Q ss_pred             eEEeeccccCCccc-ccC--c-cccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           67 HRYIVDKCLKLFSS-PFP--L-VICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        67 ~~wvl~rC~gC~k~-~~~--~-~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      ..=.. +|..|+.. +..  . ..||.||+. .   +.++-|.-++|++
T Consensus        67 ~p~~~-~C~~Cg~~~~~~~~~~~~CP~Cgs~-~---~~i~~G~El~i~~  110 (114)
T PRK03681         67 QEAEC-WCETCQQYVTLLTQRVRRCPQCHGD-M---LRIVADDGLQIRR  110 (114)
T ss_pred             eCcEE-EcccCCCeeecCCccCCcCcCcCCC-C---cEEccCCeEEEEE
Confidence            34456 89999987 432  2 449999988 2   5566788888874


No 15 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=95.75  E-value=0.011  Score=43.07  Aligned_cols=39  Identities=10%  Similarity=-0.004  Sum_probs=28.1

Q ss_pred             EEeeccccCCccc-cc--Cccc-cccCCCCCeeeEEEEEeeEEEEEee
Q 033276           68 RYIVDKCLKLFSS-PF--PLVI-CIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~~--~~~f-Cp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      .-.. +|..|++. +.  ...+ ||.||++ .   +.++-|.-+||++
T Consensus        69 p~~~-~C~~Cg~~~~~~~~~~~~CP~Cgs~-~---~~i~~G~El~I~~  111 (117)
T PRK00564         69 KVEL-ECKDCSHVFKPNALDYGVCEKCHSK-N---VIITQGNEMRLLS  111 (117)
T ss_pred             CCEE-EhhhCCCccccCCccCCcCcCCCCC-c---eEEecCCEEEEEE
Confidence            4456 89999987 33  2234 9999998 3   5556688888874


No 16 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=95.54  E-value=0.011  Score=42.68  Aligned_cols=42  Identities=12%  Similarity=-0.043  Sum_probs=26.6

Q ss_pred             eeeEEeeccccCCccc---ccCccccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           65 QLHRYIVDKCLKLFSS---PFPLVICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      ....-+. +|..|++.   +.....||.||+. .   +.++-|.-+||++
T Consensus        65 e~~p~~~-~C~~Cg~~~~~~~~~~~CP~Cgs~-~---~~i~~G~el~i~~  109 (113)
T PF01155_consen   65 EEVPARA-RCRDCGHEFEPDEFDFSCPRCGSP-D---VEIISGRELRIKS  109 (113)
T ss_dssp             EEE--EE-EETTTS-EEECHHCCHH-SSSSSS-----EEEEESS-EEEEE
T ss_pred             EecCCcE-ECCCCCCEEecCCCCCCCcCCcCC-C---cEEccCCeEEEEE
Confidence            3445567 99999987   2344669999999 3   4556788888875


No 17 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=95.51  E-value=0.0081  Score=35.30  Aligned_cols=25  Identities=12%  Similarity=0.109  Sum_probs=15.0

Q ss_pred             EEeeccccCCccc-ccCccccccCCCC
Q 033276           68 RYIVDKCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      -... ||..|++. -+++.+||.||+.
T Consensus         9 l~~~-rC~~Cg~~~~pPr~~Cp~C~s~   34 (37)
T PF12172_consen    9 LLGQ-RCRDCGRVQFPPRPVCPHCGSD   34 (37)
T ss_dssp             EEEE-E-TTT--EEES--SEETTTT--
T ss_pred             EEEE-EcCCCCCEecCCCcCCCCcCcc
Confidence            3445 99999999 6778999999976


No 18 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=95.41  E-value=0.014  Score=35.84  Aligned_cols=24  Identities=21%  Similarity=0.085  Sum_probs=18.7

Q ss_pred             eeccccCCccc---c--cCccccccCCCCC
Q 033276           70 IVDKCLKLFSS---P--FPLVICIKSNHEI   94 (123)
Q Consensus        70 vl~rC~gC~k~---~--~~~~fCp~CG~~~   94 (123)
                      .+ +|..|+..   +  .....||.||+++
T Consensus         3 ~y-~C~~CG~~~~~~~~~~~~~Cp~CG~~~   31 (46)
T PRK00398          3 EY-KCARCGREVELDEYGTGVRCPYCGYRI   31 (46)
T ss_pred             EE-ECCCCCCEEEECCCCCceECCCCCCeE
Confidence            46 99999986   2  2258899999994


No 19 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=95.34  E-value=0.013  Score=34.22  Aligned_cols=25  Identities=20%  Similarity=0.349  Sum_probs=19.5

Q ss_pred             EEeeccccCCccc-c-------cCccccccCCCC
Q 033276           68 RYIVDKCLKLFSS-P-------FPLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~-------~~~~fCp~CG~~   93 (123)
                      .|.+ +|..|++. .       .....||.||.+
T Consensus         3 ~Y~y-~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~   35 (41)
T smart00834        3 IYEY-RCEDCGHTFEVLQKISDDPLATCPECGGD   35 (41)
T ss_pred             CEEE-EcCCCCCEEEEEEecCCCCCCCCCCCCCc
Confidence            4788 99999985 1       235679999996


No 20 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=95.33  E-value=0.018  Score=42.93  Aligned_cols=38  Identities=16%  Similarity=0.267  Sum_probs=28.1

Q ss_pred             EeeccccCCccc-cc-----------------------CccccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           69 YIVDKCLKLFSS-PF-----------------------PLVICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        69 wvl~rC~gC~k~-~~-----------------------~~~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      =.+ +|..|+.. ..                       ....||.||+. .   +.++-|.-+||++
T Consensus        69 ~~~-~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~-~---~~i~~G~el~i~~  130 (135)
T PRK03824         69 AVL-KCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR-D---FEIVKGRGVYIEE  130 (135)
T ss_pred             eEE-ECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCC-C---cEEecCceEEEEE
Confidence            456 89999987 32                       23449999988 2   5667799999984


No 21 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=95.31  E-value=0.018  Score=41.83  Aligned_cols=40  Identities=13%  Similarity=0.006  Sum_probs=28.9

Q ss_pred             eEEeeccccCCccc-cc--CccccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           67 HRYIVDKCLKLFSS-PF--PLVICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        67 ~~wvl~rC~gC~k~-~~--~~~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      ..=.. +|..|++. +.  ....||.||++ .   +.++-|.-++|++
T Consensus        67 ~p~~~-~C~~Cg~~~~~~~~~~~CP~Cgs~-~---~~i~~G~El~I~~  109 (115)
T TIGR00100        67 EPVEC-ECEDCSEEVSPEIDLYRCPKCHGI-M---LQVRAGKELNLKS  109 (115)
T ss_pred             eCcEE-EcccCCCEEecCCcCccCcCCcCC-C---cEEecCCeEEEEE
Confidence            34456 89999987 33  24559999998 3   5566788888874


No 22 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=95.24  E-value=0.029  Score=34.72  Aligned_cols=32  Identities=19%  Similarity=0.342  Sum_probs=22.7

Q ss_pred             EEeeccccCCccc-c-------cCccccccCCCCCeeeEEEE
Q 033276           68 RYIVDKCLKLFSS-P-------FPLVICIKSNHEIRISPVFM  101 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~-------~~~~fCp~CG~~~tl~rV~~  101 (123)
                      .|.| +|..|+.. .       .....||.||+. .++|+--
T Consensus         3 ~Yey-~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~~-~~~r~~s   42 (52)
T TIGR02605         3 IYEY-RCTACGHRFEVLQKMSDDPLATCPECGGE-KLRRLLS   42 (52)
T ss_pred             CEEE-EeCCCCCEeEEEEecCCCCCCCCCCCCCC-ceeEEec
Confidence            4789 99999984 1       123479999996 5666543


No 23 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=94.66  E-value=0.031  Score=41.88  Aligned_cols=33  Identities=24%  Similarity=0.121  Sum_probs=25.5

Q ss_pred             eeEEeeccccCCccc-ccCccccccCCCCCeeeEE
Q 033276           66 LHRYIVDKCLKLFSS-PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        66 v~~wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~rV   99 (123)
                      -+-..- ||..|+++ -+++.+||.||+++.+.-|
T Consensus        25 ~kl~g~-kC~~CG~v~~PPr~~Cp~C~~~~~~E~v   58 (140)
T COG1545          25 GKLLGT-KCKKCGRVYFPPRAYCPKCGSETELEWV   58 (140)
T ss_pred             CcEEEE-EcCCCCeEEcCCcccCCCCCCCCceEEE
Confidence            344555 99999999 7889999999999543444


No 24 
>PF12773 DZR:  Double zinc ribbon
Probab=93.94  E-value=0.028  Score=34.41  Aligned_cols=21  Identities=14%  Similarity=0.279  Sum_probs=13.8

Q ss_pred             ccCCccc-ccCccccccCCCCC
Q 033276           74 CLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        74 C~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      |+.|++. +....|||.||.++
T Consensus         1 Cp~Cg~~~~~~~~fC~~CG~~l   22 (50)
T PF12773_consen    1 CPHCGTPNPDDAKFCPHCGTPL   22 (50)
T ss_pred             CCCcCCcCCccccCChhhcCCh
Confidence            5667766 55567777777764


No 25 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=93.57  E-value=0.072  Score=39.62  Aligned_cols=42  Identities=14%  Similarity=-0.074  Sum_probs=30.4

Q ss_pred             eeeEEeeccccCCccc---ccCccccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           65 QLHRYIVDKCLKLFSS---PFPLVICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      +...=.. +|.-|...   ......||+||++    ++.+.-|..++|++
T Consensus        65 e~~p~~~-~C~~C~~~~~~e~~~~~CP~C~s~----~~~i~~G~el~i~~  109 (115)
T COG0375          65 EEEPAEC-WCLDCGQEVELEELDYRCPKCGSI----NLRIIGGDELIIKS  109 (115)
T ss_pred             EEeccEE-EeccCCCeecchhheeECCCCCCC----ceEEecCCeeEEEE
Confidence            3344556 89999776   3345569999999    35567789998875


No 26 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=93.46  E-value=0.074  Score=33.14  Aligned_cols=24  Identities=21%  Similarity=0.204  Sum_probs=19.3

Q ss_pred             eeccccCCccc----ccCccccccCCCCC
Q 033276           70 IVDKCLKLFSS----PFPLVICIKSNHEI   94 (123)
Q Consensus        70 vl~rC~gC~k~----~~~~~fCp~CG~~~   94 (123)
                      .| +|..|++.    ......||.||+++
T Consensus         2 ~Y-~C~~Cg~~~~~~~~~~irC~~CG~rI   29 (44)
T smart00659        2 IY-ICGECGRENEIKSKDVVRCRECGYRI   29 (44)
T ss_pred             EE-ECCCCCCEeecCCCCceECCCCCceE
Confidence            47 89999986    24468899999994


No 27 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=93.35  E-value=0.063  Score=31.63  Aligned_cols=22  Identities=9%  Similarity=-0.173  Sum_probs=17.5

Q ss_pred             eccccCCccc---ccCccccccCCCC
Q 033276           71 VDKCLKLFSS---PFPLVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~---~~~~~fCp~CG~~   93 (123)
                      + +|.-|+.+   +..-..||.||.+
T Consensus         3 ~-~C~~CG~i~~g~~~p~~CP~Cg~~   27 (34)
T cd00729           3 W-VCPVCGYIHEGEEAPEKCPICGAP   27 (34)
T ss_pred             E-ECCCCCCEeECCcCCCcCcCCCCc
Confidence            5 89999988   2234789999987


No 28 
>PF12773 DZR:  Double zinc ribbon
Probab=92.91  E-value=0.053  Score=33.14  Aligned_cols=19  Identities=16%  Similarity=0.242  Sum_probs=10.4

Q ss_pred             cccCCccc-ccCccccccCC
Q 033276           73 KCLKLFSS-PFPLVICIKSN   91 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG   91 (123)
                      +|+.|++. +....||+.||
T Consensus        31 ~C~~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen   31 ICPNCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CCcCCcCCCcCCcCccCccc
Confidence            45555555 44445555555


No 29 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=92.86  E-value=0.11  Score=37.92  Aligned_cols=51  Identities=12%  Similarity=0.234  Sum_probs=34.2

Q ss_pred             HHHHHHHHhCceee----CC---CCCcce--eeeEEeeccccCCccc---c----cCccccccCCCCC
Q 033276           43 AMQNVILQMGLRLL----AP---GGMQIR--QLHRYIVDKCLKLFSS---P----FPLVICIKSNHEI   94 (123)
Q Consensus        43 AmQNVllqlGL~l~----sv---~g~~I~--~v~~wvl~rC~gC~k~---~----~~~~fCp~CG~~~   94 (123)
                      +=|.++.++|..+.    .+   +...|.  +.++|.+ +|..|+..   .    ..+..|+.||.++
T Consensus        87 ~fk~~~~~ig~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~C~~C~~~~~r~~~~~~~~~~C~~C~~~l  153 (157)
T PF10263_consen   87 EFKQWARRIGASPPRGRPNPTTCHSYEIEGKEYKKYVY-RCPSCGREYKRHRRSKRKRYRCGRCGGPL  153 (157)
T ss_pred             HHHHHHHHHCCcccccccccccccccccccccccceEE-EcCCCCCEeeeecccchhhEECCCCCCEE
Confidence            67889999998542    11   222232  2368999 99999965   1    2245799999773


No 30 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=92.51  E-value=0.072  Score=40.50  Aligned_cols=21  Identities=19%  Similarity=0.145  Sum_probs=18.1

Q ss_pred             cccCCccc---ccCccccccCCCC
Q 033276           73 KCLKLFSS---PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~---~~~~~fCp~CG~~   93 (123)
                      -|+.|+.+   .....|||+||..
T Consensus        30 hCp~Cg~PLF~KdG~v~CPvC~~~   53 (131)
T COG1645          30 HCPKCGTPLFRKDGEVFCPVCGYR   53 (131)
T ss_pred             hCcccCCcceeeCCeEECCCCCce
Confidence            79999987   4668999999975


No 31 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=92.51  E-value=0.059  Score=36.62  Aligned_cols=21  Identities=19%  Similarity=0.222  Sum_probs=18.7

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|.-|++. +...+.||+||++
T Consensus         6 AC~~Ck~l~~~d~e~CP~Cgs~   27 (64)
T COG2093           6 ACKNCKRLTPEDTEICPVCGST   27 (64)
T ss_pred             HHhhccccCCCCCccCCCCCCc
Confidence            69999998 7777889999998


No 32 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=92.48  E-value=0.13  Score=37.86  Aligned_cols=39  Identities=10%  Similarity=0.072  Sum_probs=27.0

Q ss_pred             eEEeeccccCCccc-cc---C------ccccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           67 HRYIVDKCLKLFSS-PF---P------LVICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        67 ~~wvl~rC~gC~k~-~~---~------~~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      ..=.. +| .|++. ..   .      ...||.||+. .   +.++-|.-+||++
T Consensus        67 vp~~~-~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs~-~---~~i~~G~El~i~~  115 (124)
T PRK00762         67 IPVEI-EC-ECGYEGVVDEDEIDHYAAVIECPVCGNK-R---AHILGGRECNVKN  115 (124)
T ss_pred             cCeeE-Ee-eCcCcccccccchhccccCCcCcCCCCC-C---CEEecCCeEEEEE
Confidence            34456 89 99977 22   1      1459999988 3   5566788888874


No 33 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=91.94  E-value=0.2  Score=29.53  Aligned_cols=25  Identities=16%  Similarity=0.212  Sum_probs=17.8

Q ss_pred             cccCCccc----ccCccccccCCCCCeeeE
Q 033276           73 KCLKLFSS----PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~~tl~r   98 (123)
                      .|..|++.    .....-||.||+. .|.|
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG~R-IlyK   30 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECGHR-ILYK   30 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS-S-EEBE
T ss_pred             CCCcCCCeeEcCCCCcEECCcCCCe-EEEe
Confidence            78999986    3345789999999 4443


No 34 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.81  E-value=0.11  Score=30.04  Aligned_cols=22  Identities=9%  Similarity=-0.099  Sum_probs=17.6

Q ss_pred             eccccCCccc-cc--CccccccCCCC
Q 033276           71 VDKCLKLFSS-PF--PLVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~-~~--~~~fCp~CG~~   93 (123)
                      + +|..|+.+ +.  .-..||.||.+
T Consensus         2 ~-~C~~CGy~y~~~~~~~~CP~Cg~~   26 (33)
T cd00350           2 Y-VCPVCGYIYDGEEAPWVCPVCGAP   26 (33)
T ss_pred             E-ECCCCCCEECCCcCCCcCcCCCCc
Confidence            5 89999988 32  35789999987


No 35 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=91.21  E-value=0.1  Score=31.08  Aligned_cols=11  Identities=9%  Similarity=0.350  Sum_probs=5.2

Q ss_pred             cccccCCCCCe
Q 033276           85 VICIKSNHEIR   95 (123)
Q Consensus        85 ~fCp~CG~~~t   95 (123)
                      .|||.||+++.
T Consensus         1 kfC~~CG~~l~   11 (34)
T PF14803_consen    1 KFCPQCGGPLE   11 (34)
T ss_dssp             -B-TTT--B-E
T ss_pred             CccccccChhh
Confidence            59999999943


No 36 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=91.20  E-value=0.13  Score=33.22  Aligned_cols=26  Identities=15%  Similarity=0.105  Sum_probs=20.5

Q ss_pred             EEeeccccCCccc-c----cCccccccCCCCC
Q 033276           68 RYIVDKCLKLFSS-P----FPLVICIKSNHEI   94 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~----~~~~fCp~CG~~~   94 (123)
                      .-.| +|.-|++. .    .....||.||+++
T Consensus         4 ~~~Y-~C~~Cg~~~~~~~~~~~irCp~Cg~rI   34 (49)
T COG1996           4 MMEY-KCARCGREVELDQETRGIRCPYCGSRI   34 (49)
T ss_pred             eEEE-EhhhcCCeeehhhccCceeCCCCCcEE
Confidence            3568 99999987 2    3467899999994


No 37 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=91.05  E-value=0.14  Score=40.05  Aligned_cols=23  Identities=9%  Similarity=-0.014  Sum_probs=19.5

Q ss_pred             eeccccCCccc--ccCccccccCCCC
Q 033276           70 IVDKCLKLFSS--PFPLVICIKSNHE   93 (123)
Q Consensus        70 vl~rC~gC~k~--~~~~~fCp~CG~~   93 (123)
                      ++ +|+-|+.+  ..+-..||+||.+
T Consensus       134 ~~-vC~vCGy~~~ge~P~~CPiCga~  158 (166)
T COG1592         134 VW-VCPVCGYTHEGEAPEVCPICGAP  158 (166)
T ss_pred             EE-EcCCCCCcccCCCCCcCCCCCCh
Confidence            78 99999998  5445889999987


No 38 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=90.59  E-value=0.12  Score=33.99  Aligned_cols=20  Identities=25%  Similarity=0.261  Sum_probs=17.6

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      +|..|+.... +..||.||.+
T Consensus         7 ~C~~CgvYTL-k~~CP~CG~~   26 (56)
T PRK13130          7 KCPKCGVYTL-KEICPVCGGK   26 (56)
T ss_pred             ECCCCCCEEc-cccCcCCCCC
Confidence            8999998844 7899999998


No 39 
>PRK00420 hypothetical protein; Validated
Probab=90.44  E-value=0.17  Score=37.39  Aligned_cols=21  Identities=14%  Similarity=0.047  Sum_probs=18.1

Q ss_pred             cccCCccc----ccCccccccCCCC
Q 033276           73 KCLKLFSS----PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~   93 (123)
                      .|+.|+.+    .....|||.||..
T Consensus        25 ~CP~Cg~pLf~lk~g~~~Cp~Cg~~   49 (112)
T PRK00420         25 HCPVCGLPLFELKDGEVVCPVHGKV   49 (112)
T ss_pred             CCCCCCCcceecCCCceECCCCCCe
Confidence            89999987    3567999999998


No 40 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=89.74  E-value=0.19  Score=37.54  Aligned_cols=33  Identities=12%  Similarity=0.316  Sum_probs=25.3

Q ss_pred             eeeEEeeccccCCccc-cc--CccccccCCCCCeeeE
Q 033276           65 QLHRYIVDKCLKLFSS-PF--PLVICIKSNHEIRISP   98 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~-~~--~~~fCp~CG~~~tl~r   98 (123)
                      ..+.... +|+.|.|. .+  ..+-|+.|+.|+|+.|
T Consensus        64 Stkav~V-~CP~C~K~TKmLGr~D~CM~C~~pLTLd~   99 (114)
T PF11023_consen   64 STKAVQV-ECPNCGKQTKMLGRVDACMHCKEPLTLDP   99 (114)
T ss_pred             cccceee-ECCCCCChHhhhchhhccCcCCCcCccCc
Confidence            3445667 99999998 32  2478999999998876


No 41 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=89.29  E-value=0.15  Score=46.95  Aligned_cols=27  Identities=15%  Similarity=0.192  Sum_probs=20.3

Q ss_pred             cccCCccc-ccCccccccCCCCCeeeEEE
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl~rV~  100 (123)
                      .|+.|++. +..-.|||.||.+ +-++-.
T Consensus        29 ~Cp~CG~~~~~~~~fC~~CG~~-~~~~~~   56 (645)
T PRK14559         29 PCPQCGTEVPVDEAHCPNCGAE-TGTIWW   56 (645)
T ss_pred             cCCCCCCCCCcccccccccCCc-ccchhh
Confidence            68899987 7777899999988 444433


No 42 
>PRK04351 hypothetical protein; Provisional
Probab=89.19  E-value=0.54  Score=35.80  Aligned_cols=50  Identities=18%  Similarity=0.206  Sum_probs=34.4

Q ss_pred             cHHHHHHHHHhCc-eeeCCCCCcceeeeEEeeccccCCccc-------ccCccccccCCCCC
Q 033276           41 DYAMQNVILQMGL-RLLAPGGMQIRQLHRYIVDKCLKLFSS-------PFPLVICIKSNHEI   94 (123)
Q Consensus        41 DyAmQNVllqlGL-~l~sv~g~~I~~v~~wvl~rC~gC~k~-------~~~~~fCp~CG~~~   94 (123)
                      |-.=|-+|.++|- +..+ +-..  .-++|.| +|.+|+..       +..+..|-.||+.+
T Consensus        85 g~~fk~~~~~v~~~r~~~-~~~~--~~~~y~Y-~C~~Cg~~~~r~Rr~n~~~yrCg~C~g~L  142 (149)
T PRK04351         85 DRDFKELLKQVGGPRYCP-PLPS--QKKNYLY-ECQSCGQQYLRKRRINTKRYRCGKCRGKL  142 (149)
T ss_pred             CHHHHHHHHHhCCCcccC-CCCC--CCceEEE-ECCCCCCEeeeeeecCCCcEEeCCCCcEe
Confidence            4445888888863 3222 2222  2357999 99999974       45678999999985


No 43 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=88.96  E-value=0.26  Score=40.57  Aligned_cols=21  Identities=19%  Similarity=0.262  Sum_probs=16.4

Q ss_pred             cccCCccc-c----------cCccccccCCCC
Q 033276           73 KCLKLFSS-P----------FPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~----------~~~~fCp~CG~~   93 (123)
                      +|.||+=. +          .+..|||.||.=
T Consensus       199 ~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgRI  230 (239)
T COG1579         199 VCGGCHMKLPSQTLSKVRKKDEIVFCPYCGRI  230 (239)
T ss_pred             cccCCeeeecHHHHHHHhcCCCCccCCccchH
Confidence            99999954 2          346899999964


No 44 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=88.75  E-value=0.31  Score=37.26  Aligned_cols=29  Identities=21%  Similarity=0.230  Sum_probs=22.7

Q ss_pred             eeccccCCccc-----ccCccccccCCCCCeeeEEE
Q 033276           70 IVDKCLKLFSS-----PFPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        70 vl~rC~gC~k~-----~~~~~fCp~CG~~~tl~rV~  100 (123)
                      .| +|..|+..     +....-||+||+. .-+|.+
T Consensus       112 ~l-~C~~Cg~~~~~~~~~~l~~Cp~C~~~-~F~R~~  145 (146)
T PF07295_consen  112 TL-VCENCGHEVELTHPERLPPCPKCGHT-EFTRQP  145 (146)
T ss_pred             eE-ecccCCCEEEecCCCcCCCCCCCCCC-eeeeCC
Confidence            57 99999985     3446789999999 676654


No 45 
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=88.60  E-value=0.46  Score=41.85  Aligned_cols=32  Identities=19%  Similarity=0.194  Sum_probs=24.5

Q ss_pred             EEeeccccCCccc--ccCccccccCCCCC-eeeEEE
Q 033276           68 RYIVDKCLKLFSS--PFPLVICIKSNHEI-RISPVF  100 (123)
Q Consensus        68 ~wvl~rC~gC~k~--~~~~~fCp~CG~~~-tl~rV~  100 (123)
                      .=.+ +|+.|++.  ......||.||.++ -+||||
T Consensus        55 ~~i~-kC~~c~~~~~y~~~~~C~~cg~~~~l~R~VS   89 (415)
T COG5257          55 AKIY-KCPECYRPECYTTEPKCPNCGAETELVRRVS   89 (415)
T ss_pred             CceE-eCCCCCCCcccccCCCCCCCCCCccEEEEEE
Confidence            3467 99999986  45678899999874 357787


No 46 
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=88.50  E-value=0.11  Score=40.87  Aligned_cols=23  Identities=13%  Similarity=0.278  Sum_probs=12.9

Q ss_pred             ceeEEecccHHHHHHHHHhCceee
Q 033276           33 STVACITGDYAMQNVILQMGLRLL   56 (123)
Q Consensus        33 ~~va~vTdDyAmQNVllqlGL~l~   56 (123)
                      .+.+++|.|+.+=-=+ .+|++-+
T Consensus        47 e~rIllTRDr~L~~r~-k~g~~~i   69 (165)
T COG1656          47 EGRILLTRDRELYKRA-KLGIKAI   69 (165)
T ss_pred             CCeEEEeccHHHHHHh-hccCceE
Confidence            3456777777665444 4555433


No 47 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=88.15  E-value=0.18  Score=46.39  Aligned_cols=23  Identities=17%  Similarity=0.252  Sum_probs=19.4

Q ss_pred             cccCCccc-ccCccccccCCCCCe
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIR   95 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~t   95 (123)
                      +|+.|+.. +..-.|||.||.+++
T Consensus         3 ~Cp~Cg~~n~~~akFC~~CG~~l~   26 (645)
T PRK14559          3 ICPQCQFENPNNNRFCQKCGTSLT   26 (645)
T ss_pred             cCCCCCCcCCCCCccccccCCCCC
Confidence            79999988 666789999999864


No 48 
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=87.76  E-value=0.25  Score=33.11  Aligned_cols=23  Identities=17%  Similarity=0.226  Sum_probs=17.9

Q ss_pred             eccccCCcccccCccccccCCCCC
Q 033276           71 VDKCLKLFSSPFPLVICIKSNHEI   94 (123)
Q Consensus        71 l~rC~gC~k~~~~~~fCp~CG~~~   94 (123)
                      +-+|..|+..... +.||+||..+
T Consensus         5 ~rkC~~cg~YTLk-e~Cp~CG~~t   27 (59)
T COG2260           5 IRKCPKCGRYTLK-EKCPVCGGDT   27 (59)
T ss_pred             hhcCcCCCceeec-ccCCCCCCcc
Confidence            3389999987433 7899999993


No 49 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=87.71  E-value=0.32  Score=28.79  Aligned_cols=10  Identities=10%  Similarity=0.361  Sum_probs=7.6

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      .|||.|||=+
T Consensus         2 ~FCp~C~nlL   11 (35)
T PF02150_consen    2 RFCPECGNLL   11 (35)
T ss_dssp             -BETTTTSBE
T ss_pred             eeCCCCCccc
Confidence            6899999874


No 50 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=87.63  E-value=0.74  Score=29.66  Aligned_cols=44  Identities=11%  Similarity=0.179  Sum_probs=32.0

Q ss_pred             HHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc--c---cCccccccCCCC
Q 033276           43 AMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS--P---FPLVICIKSNHE   93 (123)
Q Consensus        43 AmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~--~---~~~~fCp~CG~~   93 (123)
                      .|+-.+..-|+.++.++-..-.+       .|+.|+..  .   ...-.||.||..
T Consensus         7 ~L~yka~~~G~~v~~v~~~~TSq-------~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen    7 RLEYKAEEYGIQVVEVDEAYTSQ-------TCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             HHHHHHHHhCCEEEEECCCCCcc-------CccCcccccccccccceEEcCCCCCE
Confidence            35666778899998887554444       89999987  2   225789999975


No 51 
>PRK11032 hypothetical protein; Provisional
Probab=86.57  E-value=0.48  Score=36.87  Aligned_cols=29  Identities=24%  Similarity=0.362  Sum_probs=23.2

Q ss_pred             eeccccCCccc-----ccCccccccCCCCCeeeEEE
Q 033276           70 IVDKCLKLFSS-----PFPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        70 vl~rC~gC~k~-----~~~~~fCp~CG~~~tl~rV~  100 (123)
                      .+ +|..|+..     +....-||+||+. .-+|.+
T Consensus       124 ~L-vC~~Cg~~~~~~~p~~i~pCp~C~~~-~F~R~~  157 (160)
T PRK11032        124 NL-VCEKCHHHLAFYTPEVLPLCPKCGHD-QFQRRP  157 (160)
T ss_pred             eE-EecCCCCEEEecCCCcCCCCCCCCCC-eeeeCC
Confidence            47 99999985     4557889999999 777765


No 52 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=86.24  E-value=0.39  Score=27.43  Aligned_cols=11  Identities=9%  Similarity=0.166  Sum_probs=6.5

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      ..|||.||+++
T Consensus         3 ~rfC~~CG~~t   13 (32)
T PF09297_consen    3 HRFCGRCGAPT   13 (32)
T ss_dssp             TSB-TTT--BE
T ss_pred             CcccCcCCccc
Confidence            47999999994


No 53 
>PF14369 zf-RING_3:  zinc-finger
Probab=85.97  E-value=0.8  Score=27.16  Aligned_cols=22  Identities=14%  Similarity=0.051  Sum_probs=16.1

Q ss_pred             eccccCCccc-c-----cCccccccCCCC
Q 033276           71 VDKCLKLFSS-P-----FPLVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~-~-----~~~~fCp~CG~~   93 (123)
                      | .|+.|.+. .     ....+||.|++.
T Consensus         3 y-wCh~C~~~V~~~~~~~~~~~CP~C~~g   30 (35)
T PF14369_consen    3 Y-WCHQCNRFVRIAPSPDSDVACPRCHGG   30 (35)
T ss_pred             E-eCccCCCEeEeCcCCCCCcCCcCCCCc
Confidence            5 79999975 1     233469999998


No 54 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=85.94  E-value=1  Score=29.86  Aligned_cols=30  Identities=20%  Similarity=0.244  Sum_probs=21.1

Q ss_pred             EEeeccccCCccc-------cc----CccccccCCCCCeeeEEE
Q 033276           68 RYIVDKCLKLFSS-------PF----PLVICIKSNHEIRISPVF  100 (123)
Q Consensus        68 ~wvl~rC~gC~k~-------~~----~~~fCp~CG~~~tl~rV~  100 (123)
                      .|++  |+-|+..       |.    --.|||+|-++ +|-.|.
T Consensus         3 ~Wi~--CP~CgnKTR~kir~DT~LkNfPlyCpKCK~E-tlI~v~   43 (55)
T PF14205_consen    3 EWIL--CPICGNKTRLKIREDTVLKNFPLYCPKCKQE-TLIDVK   43 (55)
T ss_pred             eEEE--CCCCCCccceeeecCceeccccccCCCCCce-EEEEee
Confidence            6887  9999932       21    13799999999 665554


No 55 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=85.90  E-value=0.62  Score=43.68  Aligned_cols=27  Identities=19%  Similarity=0.348  Sum_probs=20.1

Q ss_pred             EeeccccCCccc-ccCccccccCCCCCeeeE
Q 033276           69 YIVDKCLKLFSS-PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        69 wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~r   98 (123)
                      =.+ +||=|++. +.+ ..||.||+. .|+-
T Consensus       461 ~~L-~CH~Cg~~~~~p-~~Cp~Cgs~-~L~~  488 (730)
T COG1198         461 GQL-RCHYCGYQEPIP-QSCPECGSE-HLRA  488 (730)
T ss_pred             Cee-EeCCCCCCCCCC-CCCCCCCCC-eeEE
Confidence            356 78888877 555 789999999 6654


No 56 
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=85.84  E-value=0.62  Score=42.57  Aligned_cols=53  Identities=11%  Similarity=0.025  Sum_probs=33.2

Q ss_pred             HHHHHHHHHh---CceeeCCCCCcceeeeEEeeccccCCccc-ccCccccccCCCCCeeeEEEEEee
Q 033276           42 YAMQNVILQM---GLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHEIRISPVFMLIL  104 (123)
Q Consensus        42 yAmQNVllql---GL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~rV~~~~~  104 (123)
                      -|+.++.+.+   |+...++.-         ..++|..|+.+ ......||+||++ .+...+=++|
T Consensus       509 ea~~~lv~~~~~~~i~Y~tin~---------~~siC~~CGy~~g~~~~~CP~CGs~-~~ev~sRv~G  565 (586)
T TIGR02827       509 DGYRKLLRVAADTGCNYFCFNI---------KITICNDCHHIDKRTLHRCPVCGSA-NIDYGTRVIG  565 (586)
T ss_pred             HHHHHHHHHHHhcCCceEEeCC---------CCeecCCCCCcCCCcCCcCcCCCCc-cceEEEeecc
Confidence            4666666554   566665532         33589999986 3334789999987 4444444444


No 57 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=85.36  E-value=0.47  Score=34.63  Aligned_cols=25  Identities=16%  Similarity=0.295  Sum_probs=18.4

Q ss_pred             cccCCccc--ccCc--cccccCCCCCeee
Q 033276           73 KCLKLFSS--PFPL--VICIKSNHEIRIS   97 (123)
Q Consensus        73 rC~gC~k~--~~~~--~fCp~CG~~~tl~   97 (123)
                      .|+.|++.  ++.|  ..||+||....+.
T Consensus        11 ~Cp~CG~kFYDLnk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDLNKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccCCCCCccCCCCCCccCcc
Confidence            89999986  4332  5699999875444


No 58 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=85.22  E-value=0.45  Score=31.53  Aligned_cols=14  Identities=7%  Similarity=0.320  Sum_probs=10.6

Q ss_pred             cccccCCCCCeeeEE
Q 033276           85 VICIKSNHEIRISPV   99 (123)
Q Consensus        85 ~fCp~CG~~~tl~rV   99 (123)
                      ..||+||++ |..|+
T Consensus         5 i~CP~CgnK-TR~ki   18 (55)
T PF14205_consen    5 ILCPICGNK-TRLKI   18 (55)
T ss_pred             EECCCCCCc-cceee
Confidence            469999999 55544


No 59 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=85.15  E-value=0.24  Score=32.51  Aligned_cols=35  Identities=14%  Similarity=0.133  Sum_probs=25.6

Q ss_pred             cccCCccc---ccCccccccCCCCCeeeEEEEEeeEEEE
Q 033276           73 KCLKLFSS---PFPLVICIKSNHEIRISPVFMLILICLY  108 (123)
Q Consensus        73 rC~gC~k~---~~~~~fCp~CG~~~tl~rV~~~~~~~~~  108 (123)
                      +|..|++.   .....+||.||.+ -=|..-...|.|++
T Consensus         7 ~C~~Cg~~~~~~dDiVvCp~Cgap-yHR~C~~~~g~C~~   44 (54)
T PF14446_consen    7 KCPVCGKKFKDGDDIVVCPECGAP-YHRDCWEKAGGCIN   44 (54)
T ss_pred             cChhhCCcccCCCCEEECCCCCCc-ccHHHHhhCCceEe
Confidence            89999987   4568999999998 55555545555544


No 60 
>PF13638 PIN_4:  PIN domain; PDB: 2HWW_C 2HWX_A 2DOK_B 2HWY_B 2WP8_J.
Probab=85.10  E-value=1.1  Score=31.49  Aligned_cols=27  Identities=15%  Similarity=0.137  Sum_probs=19.5

Q ss_pred             CceeEEecccHHHHHHHHHhCceeeCC
Q 033276           32 ESTVACITGDYAMQNVILQMGLRLLAP   58 (123)
Q Consensus        32 ~~~va~vTdDyAmQNVllqlGL~l~sv   58 (123)
                      ..+|+++|.|..|++.|...||+..+.
T Consensus       106 ~~~vvLvT~D~~l~~~A~~~gi~~~~~  132 (133)
T PF13638_consen  106 GRKVVLVTNDKNLRLKARAEGIPAVSY  132 (133)
T ss_dssp             CEEEEEEE--HHHHHHHHHTT--EE--
T ss_pred             CCeEEEEeCCHHHHHHHhhcccccccC
Confidence            568999999999999999999998865


No 61 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=84.94  E-value=0.82  Score=27.33  Aligned_cols=22  Identities=23%  Similarity=0.230  Sum_probs=17.1

Q ss_pred             cccCCccc-------ccCccccccCCCCC
Q 033276           73 KCLKLFSS-------PFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~-------~~~~~fCp~CG~~~   94 (123)
                      .|+.|+++       +.....|.+||+++
T Consensus         3 ~C~~Cg~~Yh~~~~pP~~~~~Cd~cg~~L   31 (36)
T PF05191_consen    3 ICPKCGRIYHIEFNPPKVEGVCDNCGGEL   31 (36)
T ss_dssp             EETTTTEEEETTTB--SSTTBCTTTTEBE
T ss_pred             CcCCCCCccccccCCCCCCCccCCCCCee
Confidence            69999987       12358999999983


No 62 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=84.81  E-value=0.49  Score=31.68  Aligned_cols=21  Identities=10%  Similarity=0.009  Sum_probs=16.2

Q ss_pred             cccCCcccccCccccccCCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~~   94 (123)
                      .|.-|.++. +.+.||+||+..
T Consensus         5 AC~~C~~i~-~~~~CP~Cgs~~   25 (61)
T PRK08351          5 ACRHCHYIT-TEDRCPVCGSRD   25 (61)
T ss_pred             hhhhCCccc-CCCcCCCCcCCc
Confidence            699999882 234799999983


No 63 
>PF04135 Nop10p:  Nucleolar RNA-binding protein, Nop10p family;  InterPro: IPR007264 H/ACA ribonucleoprotein particles (RNPs) are a family of RNA pseudouridine synthases that specify modification sites through guide RNAs. More than 100 mammalian H/ACA RNAs form an equal number of ribonucleoproteins (RNPs) by associating with the same four core proteins: Cbf5, Gar1, Nhp2 and Nop10. The function of these H/ACA RNPs is essential for biogenesis of the ribosome, splicing of precursor mRNAs (pre-mRNAs), maintenance of telomeres and probably for additional cellular processes []. Recent crystal structures of archaeal H/ACA protein complexes show how the same four proteins accommodate >100 distinct but related H/ACA RNAs []. The complex contains a stable core composed of Cbf5 and Nop10, to which Gar1 and Nhp2 subsequently bind, the complex interacts with snoRNAs []. In eukaryotes Nop10 is a nucleolar protein that is specifically associated with H/ACA snoRNAs. It is essential for normal 18S rRNA production and rRNA pseudouridylation by the ribonucleoprotein particles containing H/ACA snoRNAs (H/ACA snoRNPs). Nop10 is probably necessary for the stability of these RNPs [].; PDB: 2RFK_B 3LWR_B 2HVY_C 3HAX_C 3MQK_B 3LWO_B 3LWV_B 3HAY_C 3HJY_B 2EY4_E ....
Probab=84.73  E-value=1.2  Score=29.09  Aligned_cols=25  Identities=20%  Similarity=0.195  Sum_probs=18.9

Q ss_pred             EEeeccccCCcccccCccccccCCCCC
Q 033276           68 RYIVDKCLKLFSSPFPLVICIKSNHEI   94 (123)
Q Consensus        68 ~wvl~rC~gC~k~~~~~~fCp~CG~~~   94 (123)
                      .++. .|.+|...... +-||.||.++
T Consensus         3 ~~~r-~c~~~~~YTLk-~~cp~cG~~T   27 (53)
T PF04135_consen    3 YYIR-KCPGCRVYTLK-DKCPPCGGPT   27 (53)
T ss_dssp             EEEE-ECTTTCEEESS-SBBTTTSSBS
T ss_pred             cccc-cCCCCCcEeCC-CccCCCCCCC
Confidence            4455 89999976333 6899999993


No 64 
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=84.61  E-value=0.74  Score=32.62  Aligned_cols=42  Identities=14%  Similarity=0.196  Sum_probs=30.0

Q ss_pred             eeeEEeeccccCCccc--------ccCccccccCCCCC--eeeEEEEEeeEEE
Q 033276           65 QLHRYIVDKCLKLFSS--------PFPLVICIKSNHEI--RISPVFMLILICL  107 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~--------~~~~~fCp~CG~~~--tl~rV~~~~~~~~  107 (123)
                      -+-.|.| +|..|+..        +.+...||.||.++  ++.||.++.+-+=
T Consensus         7 lMPtY~Y-~c~~cg~~~dvvq~~~ddplt~ce~c~a~~kk~l~~vgi~fKGSG   58 (82)
T COG2331           7 LMPTYSY-ECTECGNRFDVVQAMTDDPLTTCEECGARLKKLLNAVGIVFKGSG   58 (82)
T ss_pred             cccceEE-eecccchHHHHHHhcccCccccChhhChHHHHhhccceEEEecce
Confidence            3457899 99999975        45688999999752  4556666665443


No 65 
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=84.60  E-value=0.89  Score=40.82  Aligned_cols=58  Identities=12%  Similarity=0.032  Sum_probs=33.3

Q ss_pred             ccHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc-ccCccccccCCCCCeeeEEEEEee
Q 033276           40 GDYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHEIRISPVFMLIL  104 (123)
Q Consensus        40 dDyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~rV~~~~~  104 (123)
                      +=-|+.++.+.+ .    -.|..--....=.. +|..|+.. ......||+||+. -+.+++=++|
T Consensus       493 n~~al~~lv~~a-~----~~~~~y~~~~~p~~-~C~~CG~~~~~~~~~CP~CGs~-~~~~~~Rv~G  551 (555)
T cd01675         493 NPEALEALVKKA-A----KRGVIYFGINTPID-ICNDCGYIGEGEGFKCPKCGSE-DVEVISRITG  551 (555)
T ss_pred             CHHHHHHHHHHH-H----HcCCceEEEecCCc-cCCCCCCCCcCCCCCCcCCCCc-CceEEEeeee
Confidence            445677766653 0    01222223334455 89999987 3556899999987 3444433333


No 66 
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=84.50  E-value=0.49  Score=42.72  Aligned_cols=43  Identities=16%  Similarity=0.124  Sum_probs=27.7

Q ss_pred             HHHHHHHHHh---CceeeCCCCCcceeeeEEeeccccCCccc-ccCccccccCCCC
Q 033276           42 YAMQNVILQM---GLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        42 yAmQNVllql---GL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      =|+.++.+.+   |++..++.         ..+++|..|+.. ......||+||++
T Consensus       501 eal~~lv~~a~~~~i~Y~~~n---------~~~~~C~~CG~~g~~~~~~CP~Cgs~  547 (579)
T TIGR02487       501 EALKDITKKAMKNGIGYFGIN---------PPVDVCEDCGYTGEGLNDKCPKCGSH  547 (579)
T ss_pred             HHHHHHHHHHHhcCCceEEec---------cCCccCCCCCCCCCCCCCcCcCCCCc
Confidence            4666665543   44555442         234599999987 3333689999986


No 67 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=84.45  E-value=0.97  Score=45.04  Aligned_cols=32  Identities=6%  Similarity=0.043  Sum_probs=23.9

Q ss_pred             CcceeeeEEeeccccCCcccccCccccccCCCCC
Q 033276           61 MQIRQLHRYIVDKCLKLFSSPFPLVICIKSNHEI   94 (123)
Q Consensus        61 ~~I~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~~   94 (123)
                      .++-++.-... +|+.|++... ..|||.||+++
T Consensus       658 ~G~ieVEV~~r-kCPkCG~~t~-~~fCP~CGs~t  689 (1337)
T PRK14714        658 GGVIEVEVGRR-RCPSCGTETY-ENRCPDCGTHT  689 (1337)
T ss_pred             CCeEEEEEEEE-ECCCCCCccc-cccCcccCCcC
Confidence            44456777888 9999998722 24999999884


No 68 
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=84.06  E-value=1.1  Score=33.03  Aligned_cols=52  Identities=12%  Similarity=0.092  Sum_probs=33.0

Q ss_pred             HHHHHHHHHhCceeeC-CCCCcceeeeEEeeccccCCccc--------ccCccccccCCCCC
Q 033276           42 YAMQNVILQMGLRLLA-PGGMQIRQLHRYIVDKCLKLFSS--------PFPLVICIKSNHEI   94 (123)
Q Consensus        42 yAmQNVllqlGL~l~s-v~g~~I~~v~~wvl~rC~gC~k~--------~~~~~fCp~CG~~~   94 (123)
                      -.=|..+.++|-..-. -+...+..+++|.+ +|.+|+..        +..+..|-+||+++
T Consensus        83 ~~f~~~~~~~~~~~~~~~h~~~~~~~~~~~y-~C~~C~~~~~~~rr~~~~~~y~C~~C~g~l  143 (146)
T smart00731       83 DEWKRWMRQVNGLFPERCHTFLIESVKKYPY-RCTGCGQRYLRVRRSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             HHHHHHHHHHcCCCcceEcCCcccccceEEE-ECCCCCCCCceEccccCcceEEcCCCCCEE
Confidence            3446666666543111 12333444478999 99999975        12458899999984


No 69 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=83.85  E-value=0.52  Score=31.92  Aligned_cols=20  Identities=25%  Similarity=0.320  Sum_probs=16.2

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      .|..|.++. +...||.||+.
T Consensus         7 AC~~C~~i~-~~~~Cp~Cgs~   26 (64)
T PRK06393          7 ACKKCKRLT-PEKTCPVHGDE   26 (64)
T ss_pred             hHhhCCccc-CCCcCCCCCCC
Confidence            699999982 23589999998


No 70 
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=83.66  E-value=0.64  Score=43.33  Aligned_cols=33  Identities=18%  Similarity=0.079  Sum_probs=21.5

Q ss_pred             eccccCCcccccCccccccCCCCCeeeEEEEEee
Q 033276           71 VDKCLKLFSSPFPLVICIKSNHEIRISPVFMLIL  104 (123)
Q Consensus        71 l~rC~gC~k~~~~~~fCp~CG~~~tl~rV~~~~~  104 (123)
                      +++|..|+........||+||+. .+.+.+=++|
T Consensus       680 ~~~C~~CG~~~~~~~~CP~CG~~-~~~~~~Ri~G  712 (735)
T PRK07111        680 VDRCPVCGYLGVIEDKCPKCGST-NIQRIRRITG  712 (735)
T ss_pred             CeecCCCCCCCCcCccCcCCCCc-cceeeehhhh
Confidence            45899999763234789999986 3444433333


No 71 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=83.33  E-value=0.93  Score=40.07  Aligned_cols=26  Identities=19%  Similarity=0.361  Sum_probs=18.2

Q ss_pred             eeccccCCccc-ccCccccccCCCCCeeeE
Q 033276           70 IVDKCLKLFSS-PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        70 vl~rC~gC~k~-~~~~~fCp~CG~~~tl~r   98 (123)
                      .+ +||-|+.. +.+ ..||.||++ .++.
T Consensus       240 ~l-~Ch~Cg~~~~~~-~~Cp~C~s~-~l~~  266 (505)
T TIGR00595       240 KL-RCHYCGYQEPIP-KTCPQCGSE-DLVY  266 (505)
T ss_pred             eE-EcCCCcCcCCCC-CCCCCCCCC-eeEe
Confidence            45 67777776 444 679999998 5553


No 72 
>PRK02935 hypothetical protein; Provisional
Probab=82.93  E-value=0.79  Score=34.07  Aligned_cols=31  Identities=13%  Similarity=0.271  Sum_probs=24.0

Q ss_pred             eEEeeccccCCccc-cc--CccccccCCCCCeeeE
Q 033276           67 HRYIVDKCLKLFSS-PF--PLVICIKSNHEIRISP   98 (123)
Q Consensus        67 ~~wvl~rC~gC~k~-~~--~~~fCp~CG~~~tl~r   98 (123)
                      |.-.. .|+.|.|. .+  ..+-|..|+.|+||.+
T Consensus        67 kavqV-~CP~C~K~TKmLGrvD~CM~C~~PLTLd~  100 (110)
T PRK02935         67 KAVQV-ICPSCEKPTKMLGRVDACMHCNQPLTLDR  100 (110)
T ss_pred             cceee-ECCCCCchhhhccceeecCcCCCcCCcCc
Confidence            34455 89999998 32  3478999999998865


No 73 
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=82.23  E-value=0.49  Score=42.43  Aligned_cols=24  Identities=21%  Similarity=0.026  Sum_probs=11.6

Q ss_pred             eeccccCCcccccCccccccCCCC
Q 033276           70 IVDKCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        70 vl~rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      ..++|..|+........||+||++
T Consensus       490 ~~~~C~~CG~~~~~~~~CP~CGs~  513 (546)
T PF13597_consen  490 PIDICPDCGYIGGEGDKCPKCGSE  513 (546)
T ss_dssp             -EEEETTT---S--EEE-CCC---
T ss_pred             CcccccCCCcCCCCCCCCCCCCCc
Confidence            345899999983237899999999


No 74 
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=81.89  E-value=0.99  Score=41.59  Aligned_cols=44  Identities=16%  Similarity=0.093  Sum_probs=31.0

Q ss_pred             HHHHHHHHHh----CceeeCCCCCcceeeeEEeeccccCCcccccCccccccCCCCC
Q 033276           42 YAMQNVILQM----GLRLLAPGGMQIRQLHRYIVDKCLKLFSSPFPLVICIKSNHEI   94 (123)
Q Consensus        42 yAmQNVllql----GL~l~sv~g~~I~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~~   94 (123)
                      =|+.++.+.+    ++...++..         .+++|..|+........||+||+++
T Consensus       602 ~a~~~lv~~~~~~~~i~Y~~in~---------~~~~C~~CG~~~g~~~~CP~CG~~~  649 (656)
T PRK08270        602 EACKKLVKKALENYRLPYITITP---------TFSICPKHGYLSGEHEFCPKCGEET  649 (656)
T ss_pred             HHHHHHHHHHHHhCCCceEEeCC---------CCcccCCCCCcCCCCCCCcCCcCcc
Confidence            5777777754    566666632         2358999998633357899999873


No 75 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=81.75  E-value=1  Score=36.69  Aligned_cols=27  Identities=11%  Similarity=0.118  Sum_probs=14.3

Q ss_pred             cccCCccc-ccCccccccCCCCCeeeEEE
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl~rV~  100 (123)
                      .|.-|++. ...+.-||.||+. --.+..
T Consensus       199 ~Cs~C~t~W~~~R~~Cp~Cg~~-~~~~l~  226 (290)
T PF04216_consen  199 HCSLCGTEWRFVRIKCPYCGNT-DHEKLE  226 (290)
T ss_dssp             EETTT--EEE--TTS-TTT----SS-EEE
T ss_pred             EcCCCCCeeeecCCCCcCCCCC-CCccee
Confidence            59999988 8888999999988 455554


No 76 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=81.71  E-value=0.87  Score=26.81  Aligned_cols=21  Identities=24%  Similarity=0.297  Sum_probs=15.4

Q ss_pred             cccCCccc-----ccCccccccCCCC
Q 033276           73 KCLKLFSS-----PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-----~~~~~fCp~CG~~   93 (123)
                      +|.+|+..     .....||+.||.-
T Consensus         5 ~C~~C~~~~i~~~~~~~~~C~~Cg~~   30 (33)
T PF08792_consen    5 KCSKCGGNGIVNKEDDYEVCIFCGSS   30 (33)
T ss_pred             EcCCCCCCeEEEecCCeEEcccCCcE
Confidence            68888875     3457888888864


No 77 
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=81.61  E-value=0.96  Score=32.69  Aligned_cols=25  Identities=8%  Similarity=-0.025  Sum_probs=18.4

Q ss_pred             eeccccCCccc---ccC--ccccccCCCCCe
Q 033276           70 IVDKCLKLFSS---PFP--LVICIKSNHEIR   95 (123)
Q Consensus        70 vl~rC~gC~k~---~~~--~~fCp~CG~~~t   95 (123)
                      .+ +|..|+..   ..+  ..+||.||+..+
T Consensus        42 ~~-~C~~Cg~~~~~~~SCk~R~CP~C~~~~~   71 (111)
T PF14319_consen   42 RY-RCEDCGHEKIVYNSCKNRHCPSCQAKAT   71 (111)
T ss_pred             ee-ecCCCCceEEecCcccCcCCCCCCChHH
Confidence            46 99999986   221  459999998743


No 78 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=81.13  E-value=0.97  Score=30.26  Aligned_cols=26  Identities=19%  Similarity=0.220  Sum_probs=18.3

Q ss_pred             cccCCccc--c---cCccccccCCCCCeeeEE
Q 033276           73 KCLKLFSS--P---FPLVICIKSNHEIRISPV   99 (123)
Q Consensus        73 rC~gC~k~--~---~~~~fCp~CG~~~tl~rV   99 (123)
                      .|.+|+..  +   ..+-.||.||.. ++.|.
T Consensus         9 ~CtSCg~~i~~~~~~~~F~CPnCG~~-~I~RC   39 (59)
T PRK14890          9 KCTSCGIEIAPREKAVKFLCPNCGEV-IIYRC   39 (59)
T ss_pred             cccCCCCcccCCCccCEeeCCCCCCe-eEeec
Confidence            68888876  2   235679999887 56664


No 79 
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=81.10  E-value=2.6  Score=31.31  Aligned_cols=26  Identities=15%  Similarity=0.130  Sum_probs=21.1

Q ss_pred             EEeeccccCCccc--cc--CccccccCCCC
Q 033276           68 RYIVDKCLKLFSS--PF--PLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~gC~k~--~~--~~~fCp~CG~~   93 (123)
                      .|-|..|+.|.+.  +.  ..-+|++|+..
T Consensus        31 ~~~Y~aC~~C~kkv~~~~~~~~~C~~C~~~   60 (166)
T cd04476          31 NWWYPACPGCNKKVVEEGNGTYRCEKCNKS   60 (166)
T ss_pred             CeEEccccccCcccEeCCCCcEECCCCCCc
Confidence            5777799999987  22  56899999987


No 80 
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=81.10  E-value=0.89  Score=41.83  Aligned_cols=43  Identities=12%  Similarity=0.040  Sum_probs=29.0

Q ss_pred             HHHHHHHHH---hCceeeCCCCCcceeeeEEeeccccCCccc-ccCccccccCCCC
Q 033276           42 YAMQNVILQ---MGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        42 yAmQNVllq---lGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      -|+.++++.   .|+...++..         ..++|..|+.. ......||+||++
T Consensus       543 eal~~lv~~~~~~~i~Yf~in~---------~~~iC~~CG~~~~g~~~~CP~CGs~  589 (623)
T PRK08271        543 EGYRKLLNIAAKTGCNYFAFNV---------KITICNDCHHIDKRTGKRCPICGSE  589 (623)
T ss_pred             HHHHHHHHHHHHcCCceEEeCC---------CCccCCCCCCcCCCCCcCCcCCCCc
Confidence            455555444   3566665532         33589999987 5567899999976


No 81 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=81.01  E-value=1.1  Score=25.98  Aligned_cols=22  Identities=27%  Similarity=0.209  Sum_probs=16.5

Q ss_pred             cccCCccc---c-------cCccccccCCCCC
Q 033276           73 KCLKLFSS---P-------FPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~---~-------~~~~fCp~CG~~~   94 (123)
                      .|+.|++.   +       ..+..||+||+.+
T Consensus         4 ~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         4 QCPNCKTSFRVVDSQLGANGGKVRCGKCGHVW   35 (38)
T ss_pred             ECCCCCCEEEeCHHHcCCCCCEEECCCCCCEE
Confidence            79999984   2       1247999999983


No 82 
>PRK06260 threonine synthase; Validated
Probab=80.92  E-value=1  Score=38.12  Aligned_cols=25  Identities=16%  Similarity=0.312  Sum_probs=18.7

Q ss_pred             EeeccccCCccc-cc--CccccccCCCCC
Q 033276           69 YIVDKCLKLFSS-PF--PLVICIKSNHEI   94 (123)
Q Consensus        69 wvl~rC~gC~k~-~~--~~~fCp~CG~~~   94 (123)
                      +.+ +|..|++. +.  ....||.||..+
T Consensus         2 ~~~-~C~~cg~~~~~~~~~~~Cp~cg~~l   29 (397)
T PRK06260          2 YWL-KCIECGKEYDPDEIIYTCPECGGLL   29 (397)
T ss_pred             CEE-EECCCCCCCCCCCccccCCCCCCeE
Confidence            357 99999998 32  335699999864


No 83 
>PRK07591 threonine synthase; Validated
Probab=79.88  E-value=1.4  Score=37.85  Aligned_cols=27  Identities=19%  Similarity=0.369  Sum_probs=20.3

Q ss_pred             EEeeccccCCccc-c-cCccccccCCCCCe
Q 033276           68 RYIVDKCLKLFSS-P-FPLVICIKSNHEIR   95 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~-~~~~fCp~CG~~~t   95 (123)
                      .+.+ +|..|++. + .....||.||+.+.
T Consensus        16 ~~~l-~C~~Cg~~~~~~~~~~C~~cg~~l~   44 (421)
T PRK07591         16 AVAL-KCRECGAEYPLGPIHVCEECFGPLE   44 (421)
T ss_pred             eeEE-EeCCCCCcCCCCCCccCCCCCCeEE
Confidence            4468 99999998 3 23467999998753


No 84 
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=79.44  E-value=1.2  Score=38.66  Aligned_cols=50  Identities=12%  Similarity=0.011  Sum_probs=28.4

Q ss_pred             HHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc-cc--Cc---cccccCCCCC
Q 033276           44 MQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PF--PL---VICIKSNHEI   94 (123)
Q Consensus        44 mQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~--~~---~fCp~CG~~~   94 (123)
                      ++.+++.+.-+-+......--+.-+|-++.|..|+.. ++  +.   ..|| ||+++
T Consensus       213 ~~~~l~ai~~~~i~~~~g~~P~~GKYh~~~c~~C~~~~~~~~~~~~~~~Cp-CG~~i  268 (374)
T TIGR00375       213 FALALKAIDDRKIIANYGLDPLLGKYHQTACEACGEPAVSEDAETACANCP-CGGRI  268 (374)
T ss_pred             HHHHHHHhhCCceEeeeeECcCCCccchhhhcccCCcCCchhhhhcCCCCC-CCCcc
Confidence            6666665432211111111223445666799999987 32  22   6799 99995


No 85 
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=79.11  E-value=1.1  Score=41.18  Aligned_cols=45  Identities=16%  Similarity=0.098  Sum_probs=29.6

Q ss_pred             ccHHHHHHHHHh---CceeeCCCCCcceeeeEEeeccccCCccc-ccCccccccCCCC
Q 033276           40 GDYAMQNVILQM---GLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        40 dDyAmQNVllql---GL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      +=-|+..+.+.+   ++...++.         -..++|..|+.. ......||+||++
T Consensus       543 n~~al~~lv~~~~~~~i~Y~~in---------p~~~~C~~CG~~~~g~~~~CP~CGs~  591 (625)
T PRK08579        543 DPEALAKLTKRIMNTKLVYWSYT---------PAITVCNKCGRSTTGLYTRCPRCGSE  591 (625)
T ss_pred             CHHHHHHHHHHHHhcCCceEEeC---------CCCccCCCCCCccCCCCCcCcCCCCc
Confidence            446777777774   33333332         133589999985 4446889999986


No 86 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=79.06  E-value=0.85  Score=30.78  Aligned_cols=26  Identities=15%  Similarity=0.144  Sum_probs=17.2

Q ss_pred             cccCCccc--c---cCccccccCCCCCeeeEE
Q 033276           73 KCLKLFSS--P---FPLVICIKSNHEIRISPV   99 (123)
Q Consensus        73 rC~gC~k~--~---~~~~fCp~CG~~~tl~rV   99 (123)
                      +|++|+..  +   ..+--||.||.. .+.|.
T Consensus        11 ~CtSCg~~i~p~e~~v~F~CPnCGe~-~I~Rc   41 (61)
T COG2888          11 VCTSCGREIAPGETAVKFPCPNCGEV-EIYRC   41 (61)
T ss_pred             eeccCCCEeccCCceeEeeCCCCCce-eeehh
Confidence            78888876  2   224558888877 56554


No 87 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=78.99  E-value=1.3  Score=28.22  Aligned_cols=22  Identities=9%  Similarity=-0.069  Sum_probs=16.2

Q ss_pred             eccccCCccc-ccC-------------------ccccccCCCC
Q 033276           71 VDKCLKLFSS-PFP-------------------LVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~-~~~-------------------~~fCp~CG~~   93 (123)
                      + +|..|+.+ ++.                   --.||.||.+
T Consensus         2 y-~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~w~CP~C~a~   43 (50)
T cd00730           2 Y-ECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGAG   43 (50)
T ss_pred             c-CCCCCCeEECCCCCCcccCcCCCCCHhHCCCCCCCCCCCCc
Confidence            5 89999987 432                   1279999976


No 88 
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=78.69  E-value=1.2  Score=33.86  Aligned_cols=21  Identities=19%  Similarity=0.162  Sum_probs=17.0

Q ss_pred             cccCCccc--ccC---ccccccCCCC
Q 033276           73 KCLKLFSS--PFP---LVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~--~~~---~~fCp~CG~~   93 (123)
                      +|+.|+++  +..   +.=||.||++
T Consensus         3 ~Ct~Cg~~f~dgs~eil~GCP~CGg~   28 (131)
T PF09845_consen    3 QCTKCGRVFEDGSKEILSGCPECGGN   28 (131)
T ss_pred             ccCcCCCCcCCCcHHHHccCcccCCc
Confidence            89999998  322   4679999998


No 89 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=78.64  E-value=2.3  Score=25.46  Aligned_cols=8  Identities=38%  Similarity=0.725  Sum_probs=4.5

Q ss_pred             ccccCCCC
Q 033276           86 ICIKSNHE   93 (123)
Q Consensus        86 fCp~CG~~   93 (123)
                      .||+||++
T Consensus         2 ~Cp~Cg~~    9 (39)
T PF01096_consen    2 KCPKCGHN    9 (39)
T ss_dssp             --SSS-SS
T ss_pred             CCcCCCCC
Confidence            48999988


No 90 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=78.47  E-value=1.2  Score=28.11  Aligned_cols=20  Identities=20%  Similarity=0.438  Sum_probs=15.7

Q ss_pred             cccCCccc-c----------cCccccccCCC
Q 033276           73 KCLKLFSS-P----------FPLVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~-~----------~~~~fCp~CG~   92 (123)
                      +|.||+-. +          ....+||.||-
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCCCc
Confidence            89999965 2          24689999994


No 91 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=78.46  E-value=1.1  Score=25.33  Aligned_cols=9  Identities=11%  Similarity=0.405  Sum_probs=4.9

Q ss_pred             ccccCCCCC
Q 033276           86 ICIKSNHEI   94 (123)
Q Consensus        86 fCp~CG~~~   94 (123)
                      +||.||+++
T Consensus         1 ~CP~C~s~l    9 (28)
T PF03119_consen    1 TCPVCGSKL    9 (28)
T ss_dssp             B-TTT--BE
T ss_pred             CcCCCCCEe
Confidence            699999993


No 92 
>TIGR03844 cysteate_syn cysteate synthase. Members of this family are cysteate synthase, an enzyme of alternate pathway to sulfopyruvate, a precursor of coenzyme M.
Probab=77.47  E-value=1.5  Score=37.67  Aligned_cols=27  Identities=19%  Similarity=0.290  Sum_probs=20.3

Q ss_pred             EeeccccCCccc-c-cCccccccCCCCCee
Q 033276           69 YIVDKCLKLFSS-P-FPLVICIKSNHEIRI   96 (123)
Q Consensus        69 wvl~rC~gC~k~-~-~~~~fCp~CG~~~tl   96 (123)
                      |.+ +|..|++. + .....||.||+.+.+
T Consensus         1 ~~l-~C~~Cg~~~~~~~~~~C~~c~g~l~~   29 (398)
T TIGR03844         1 YTL-RCPGCGEVLPDHYTLSCPLDCGLLRA   29 (398)
T ss_pred             CEE-EeCCCCCccCCccccCCCCCCCceEE
Confidence            467 99999998 4 345789999976443


No 93 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=77.40  E-value=1.2  Score=37.63  Aligned_cols=42  Identities=14%  Similarity=0.308  Sum_probs=27.4

Q ss_pred             EeeccccCCccc----c--cCccccccCCCCCee---eEEEEEeeEEEEEeeC
Q 033276           69 YIVDKCLKLFSS----P--FPLVICIKSNHEIRI---SPVFMLILICLYIQVD  112 (123)
Q Consensus        69 wvl~rC~gC~k~----~--~~~~fCp~CG~~~tl---~rV~~~~~~~~~~~~~  112 (123)
                      |..  |+.|++.    +  .....||+||++..+   .|+..++-..-|...|
T Consensus        38 w~k--c~~C~~~~~~~~l~~~~~vcp~c~~h~rltAreRI~~L~D~gSF~E~~   88 (296)
T CHL00174         38 WVQ--CENCYGLNYKKFLKSKMNICEQCGYHLKMSSSDRIELLIDPGTWNPMD   88 (296)
T ss_pred             eeE--CCCccchhhHHHHHHcCCCCCCCCCCcCCCHHHHHHHHccCCccEEcC
Confidence            776  9999987    2  346799999998544   3555444444444443


No 94 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=77.23  E-value=1.1  Score=27.30  Aligned_cols=10  Identities=20%  Similarity=0.464  Sum_probs=8.0

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      .|||.||+-+
T Consensus         1 ~FCp~Cg~~l   10 (52)
T smart00661        1 KFCPKCGNML   10 (52)
T ss_pred             CCCCCCCCcc
Confidence            4899999874


No 95 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=77.04  E-value=1.3  Score=37.05  Aligned_cols=44  Identities=20%  Similarity=0.344  Sum_probs=27.7

Q ss_pred             EEeeccccCCccc----c--cCccccccCCCCCee---eEEEEEeeEEEEEeeCC
Q 033276           68 RYIVDKCLKLFSS----P--FPLVICIKSNHEIRI---SPVFMLILICLYIQVDT  113 (123)
Q Consensus        68 ~wvl~rC~gC~k~----~--~~~~fCp~CG~~~tl---~rV~~~~~~~~~~~~~~  113 (123)
                      -|..  |+.|++.    +  .....||+||++..+   .|+..++-..-|...+.
T Consensus        26 ~~~~--c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~areRi~~L~D~gsF~E~~~   78 (292)
T PRK05654         26 LWTK--CPSCGQVLYRKELEANLNVCPKCGHHMRISARERLDLLLDEGSFVELDA   78 (292)
T ss_pred             CeeE--CCCccchhhHHHHHhcCCCCCCCCCCeeCCHHHHHHHHccCCccEEecC
Confidence            3876  9999987    2  345799999998544   34444444433444433


No 96 
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=76.87  E-value=1.5  Score=29.00  Aligned_cols=32  Identities=19%  Similarity=0.178  Sum_probs=24.4

Q ss_pred             cceeeeEEeeccccCCccc---ccC-ccccccCCCCC
Q 033276           62 QIRQLHRYIVDKCLKLFSS---PFP-LVICIKSNHEI   94 (123)
Q Consensus        62 ~I~~v~~wvl~rC~gC~k~---~~~-~~fCp~CG~~~   94 (123)
                      +...+..|.- -|..|+++   ... ..-|+.||+++
T Consensus        10 ~~H~L~~~~~-NCl~CGkIiC~~Eg~~~pC~fCg~~l   45 (57)
T PF06221_consen   10 RRHPLFPYAP-NCLNCGKIICEQEGPLGPCPFCGTPL   45 (57)
T ss_pred             ccCCCccccc-cccccChhhcccccCcCcCCCCCCcc
Confidence            3445566777 99999998   344 68999999883


No 97 
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=76.85  E-value=2  Score=28.65  Aligned_cols=23  Identities=17%  Similarity=0.309  Sum_probs=18.4

Q ss_pred             ccccCCccc------ccCccccccCCCCC
Q 033276           72 DKCLKLFSS------PFPLVICIKSNHEI   94 (123)
Q Consensus        72 ~rC~gC~k~------~~~~~fCp~CG~~~   94 (123)
                      -+|++|+++      ......|+.||..+
T Consensus        12 VkCp~C~n~q~vFsha~t~V~C~~Cg~~L   40 (59)
T PRK00415         12 VKCPDCGNEQVVFSHASTVVRCLVCGKTL   40 (59)
T ss_pred             EECCCCCCeEEEEecCCcEEECcccCCCc
Confidence            389999986      24568999999873


No 98 
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=76.84  E-value=1.5  Score=42.85  Aligned_cols=29  Identities=21%  Similarity=0.363  Sum_probs=21.3

Q ss_pred             EEeeccccCCccc---ccCccccccCCCCCeee
Q 033276           68 RYIVDKCLKLFSS---PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        68 ~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~   97 (123)
                      +=.+ ||..|++.   .+-..-||+||+++.|+
T Consensus      1010 rQ~f-RC~kC~~kYRR~PL~G~C~kCGg~lilT 1041 (1095)
T TIGR00354      1010 RQEV-RCTKCNTKYRRIPLVGKCLKCGNNLTLT 1041 (1095)
T ss_pred             ccce-eecccCCccccCCCCCcccccCCeEEEE
Confidence            3467 99999975   23357899999996543


No 99 
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=76.53  E-value=1.4  Score=36.87  Aligned_cols=42  Identities=19%  Similarity=0.297  Sum_probs=27.4

Q ss_pred             EeeccccCCccc----c--cCccccccCCCCCee---eEEEEEeeEEEEEeeC
Q 033276           69 YIVDKCLKLFSS----P--FPLVICIKSNHEIRI---SPVFMLILICLYIQVD  112 (123)
Q Consensus        69 wvl~rC~gC~k~----~--~~~~fCp~CG~~~tl---~rV~~~~~~~~~~~~~  112 (123)
                      |..  |+.|++.    +  .....||+||++..+   .|+..++-..-|...+
T Consensus        26 ~~~--c~~c~~~~~~~~l~~~~~vc~~c~~h~rl~areRi~~L~D~gsF~E~~   76 (285)
T TIGR00515        26 WTK--CPKCGQVLYTKELERNLEVCPKCDHHMRMDARERIESLLDEGSFEEFN   76 (285)
T ss_pred             eeE--CCCCcchhhHHHHHhhCCCCCCCCCcCcCCHHHHHHHceeCCeeEEeC
Confidence            876  9999987    1  346899999998443   3455455444444443


No 100
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=76.37  E-value=2.1  Score=41.91  Aligned_cols=27  Identities=15%  Similarity=0.082  Sum_probs=22.1

Q ss_pred             eeeEEeeccccCCcccccCccccccCCCC
Q 033276           65 QLHRYIVDKCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      ++---.. +|+.|++. ..+..||.||.+
T Consensus       620 ~vev~~R-KCPkCG~y-Tlk~rCP~CG~~  646 (1095)
T TIGR00354       620 EVEIAIR-KCPQCGKE-SFWLKCPVCGEL  646 (1095)
T ss_pred             EEEEEEE-ECCCCCcc-cccccCCCCCCc
Confidence            5666778 99999998 334779999999


No 101
>PRK06450 threonine synthase; Validated
Probab=76.02  E-value=1.7  Score=36.47  Aligned_cols=26  Identities=19%  Similarity=0.175  Sum_probs=19.3

Q ss_pred             eccccCCccc-cc-CccccccCCCCCeee
Q 033276           71 VDKCLKLFSS-PF-PLVICIKSNHEIRIS   97 (123)
Q Consensus        71 l~rC~gC~k~-~~-~~~fCp~CG~~~tl~   97 (123)
                      + +|..|++. +. ....||.||.++.+.
T Consensus         4 ~-~C~~Cg~~~~~~~~~~C~~cg~~l~~~   31 (338)
T PRK06450          4 E-VCMKCGKERESIYEIRCKKCGGPFEIL   31 (338)
T ss_pred             e-EECCcCCcCCCcccccCCcCCCEeEEe
Confidence            6 99999998 33 346799999875443


No 102
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=75.92  E-value=1.7  Score=26.12  Aligned_cols=21  Identities=19%  Similarity=0.189  Sum_probs=13.7

Q ss_pred             cccCCccc----c--cCccccccCCCC
Q 033276           73 KCLKLFSS----P--FPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~----~--~~~~fCp~CG~~   93 (123)
                      +|+.|+..    +  ....+|+.||.-
T Consensus         2 ~Cp~Cg~~~~~~D~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPERGELVCPNCGLV   28 (43)
T ss_dssp             SBTTTSSSEEEEETTTTEEEETTT-BB
T ss_pred             CCcCCcCCceEEcCCCCeEECCCCCCE
Confidence            78888874    3  234589999864


No 103
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=75.49  E-value=1.7  Score=26.08  Aligned_cols=14  Identities=14%  Similarity=0.221  Sum_probs=10.4

Q ss_pred             cccccCCCCCeeeE
Q 033276           85 VICIKSNHEIRISP   98 (123)
Q Consensus        85 ~fCp~CG~~~tl~r   98 (123)
                      ..||.||+++.+++
T Consensus         2 ~~CP~Cg~~lv~r~   15 (39)
T PF01396_consen    2 EKCPKCGGPLVLRR   15 (39)
T ss_pred             cCCCCCCceeEEEE
Confidence            46999998855444


No 104
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=75.14  E-value=1.8  Score=27.86  Aligned_cols=20  Identities=20%  Similarity=0.378  Sum_probs=16.9

Q ss_pred             cccCCcccccCccccccCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~   92 (123)
                      .|+.|+....+...||.||.
T Consensus        28 ~c~~cg~~~~~H~vc~~cG~   47 (56)
T PF01783_consen   28 KCPNCGEPKLPHRVCPSCGY   47 (56)
T ss_dssp             ESSSSSSEESTTSBCTTTBB
T ss_pred             eeccCCCEecccEeeCCCCe
Confidence            79999988666789999984


No 105
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=75.02  E-value=0.64  Score=31.88  Aligned_cols=28  Identities=11%  Similarity=0.183  Sum_probs=17.6

Q ss_pred             eeccccCCccc---c--cCccccccCCCCCeeeEEE
Q 033276           70 IVDKCLKLFSS---P--FPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        70 vl~rC~gC~k~---~--~~~~fCp~CG~~~tl~rV~  100 (123)
                      ++ || .|++.   +  ....-| .||..+-++++.
T Consensus         3 if-rC-~Cgr~lya~e~~kTkkC-~CG~~l~vk~~r   35 (68)
T PF09082_consen    3 IF-RC-DCGRYLYAKEGAKTKKC-VCGKTLKVKERR   35 (68)
T ss_dssp             EE-EE-TTS--EEEETT-SEEEE-TTTEEEE--SSS
T ss_pred             EE-Ee-cCCCEEEecCCcceeEe-cCCCeeeeeeEE
Confidence            56 99 89996   2  335779 999987776655


No 106
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=74.96  E-value=1.8  Score=24.14  Aligned_cols=19  Identities=16%  Similarity=0.223  Sum_probs=12.1

Q ss_pred             ccCCccc--c---cCccccccCCC
Q 033276           74 CLKLFSS--P---FPLVICIKSNH   92 (123)
Q Consensus        74 C~gC~k~--~---~~~~fCp~CG~   92 (123)
                      |..|+..  +   ...--||+||.
T Consensus         1 C~sC~~~i~~r~~~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGRPIAPREQAVPFPCPNCGF   24 (24)
T ss_pred             CccCCCcccCcccCceEeCCCCCC
Confidence            6778665  2   22456999983


No 107
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=74.51  E-value=2.4  Score=26.75  Aligned_cols=23  Identities=9%  Similarity=-0.055  Sum_probs=14.9

Q ss_pred             eeccccCCccc-ccCc-------------------cccccCCCC
Q 033276           70 IVDKCLKLFSS-PFPL-------------------VICIKSNHE   93 (123)
Q Consensus        70 vl~rC~gC~k~-~~~~-------------------~fCp~CG~~   93 (123)
                      ++ +|..|+.+ ++..                   -.||.||.+
T Consensus         1 ky-~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~w~CP~C~a~   43 (47)
T PF00301_consen    1 KY-QCPVCGYVYDPEKGDPENGIPPGTPFEDLPDDWVCPVCGAP   43 (47)
T ss_dssp             EE-EETTTSBEEETTTBBGGGTB-TT--GGGS-TT-B-TTTSSB
T ss_pred             Cc-CCCCCCEEEcCCcCCcccCcCCCCCHHHCCCCCcCcCCCCc
Confidence            36 89999877 3222                   179999976


No 108
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=73.94  E-value=1.7  Score=32.35  Aligned_cols=27  Identities=19%  Similarity=0.137  Sum_probs=19.6

Q ss_pred             cccCCccc-cc-C---ccccccCCCCCeeeEEE
Q 033276           73 KCLKLFSS-PF-P---LVICIKSNHEIRISPVF  100 (123)
Q Consensus        73 rC~gC~k~-~~-~---~~fCp~CG~~~tl~rV~  100 (123)
                      +|+.|+++ +. .   ..=||+||++ -...|+
T Consensus         4 ~CtrCG~vf~~g~~~il~GCp~CG~n-kF~yv~   35 (112)
T COG3364           4 QCTRCGEVFDDGSEEILSGCPKCGCN-KFLYVP   35 (112)
T ss_pred             eecccccccccccHHHHccCccccch-heEecc
Confidence            89999998 32 1   4669999998 454444


No 109
>PRK04023 DNA polymerase II large subunit; Validated
Probab=73.50  E-value=2.1  Score=42.10  Aligned_cols=29  Identities=21%  Similarity=0.252  Sum_probs=21.3

Q ss_pred             EEeeccccCCccc---ccCccccccCCCCCeee
Q 033276           68 RYIVDKCLKLFSS---PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        68 ~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~   97 (123)
                      +=.+ ||..|++.   .+-..-||+||+++.|+
T Consensus      1035 rQ~f-RC~kC~~kYRR~PL~G~C~kCGg~lilT 1066 (1121)
T PRK04023       1035 RQEF-RCTKCGAKYRRPPLSGKCPKCGGNLILT 1066 (1121)
T ss_pred             ccce-eecccCcccccCCCCCcCccCCCeEEEE
Confidence            3467 99999976   23347899999996543


No 110
>COG1933 Archaeal DNA polymerase II, large subunit [DNA replication, recombination, and repair]
Probab=72.95  E-value=1.7  Score=36.37  Aligned_cols=27  Identities=22%  Similarity=0.242  Sum_probs=19.9

Q ss_pred             eEEeeccccCCccc---ccCccccccCCCCC
Q 033276           67 HRYIVDKCLKLFSS---PFPLVICIKSNHEI   94 (123)
Q Consensus        67 ~~wvl~rC~gC~k~---~~~~~fCp~CG~~~   94 (123)
                      .+-.. ||.+|.+.   .+-..-||+||+.+
T Consensus       164 ~rq~~-rc~~c~~k~rr~pl~g~c~kcg~~~  193 (253)
T COG1933         164 TRQEF-RCVKCNTKFRRPPLDGKCPICGGKI  193 (253)
T ss_pred             hhhee-ehHhhhhhhcCCCccccccccCCeE
Confidence            34467 99999976   33347899999963


No 111
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=72.82  E-value=1.9  Score=27.87  Aligned_cols=20  Identities=15%  Similarity=0.243  Sum_probs=14.9

Q ss_pred             cccCCcccccCccccccCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~   92 (123)
                      .|+.|++...+...||.||.
T Consensus        28 ~C~~cG~~~~~H~vc~~cG~   47 (55)
T TIGR01031        28 VCPNCGEFKLPHRVCPSCGY   47 (55)
T ss_pred             ECCCCCCcccCeeECCccCe
Confidence            68888877556677888884


No 112
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=72.69  E-value=2.4  Score=34.03  Aligned_cols=30  Identities=7%  Similarity=0.127  Sum_probs=24.1

Q ss_pred             ccccCCccc---ccCccccccCCCCCeeeEEEEE
Q 033276           72 DKCLKLFSS---PFPLVICIKSNHEIRISPVFML  102 (123)
Q Consensus        72 ~rC~gC~k~---~~~~~fCp~CG~~~tl~rV~~~  102 (123)
                      .+|.-|+..   .....-||+||+. -.||+|.-
T Consensus       150 A~CsrC~~~L~~~~~~l~Cp~Cg~t-EkRKia~~  182 (188)
T COG1096         150 ARCSRCRAPLVKKGNMLKCPNCGNT-EKRKIAKD  182 (188)
T ss_pred             EEccCCCcceEEcCcEEECCCCCCE-Eeeeeccc
Confidence            389999987   3345789999998 89998854


No 113
>PF05991 NYN_YacP:  YacP-like NYN domain;  InterPro: IPR010298 This family consists of several hypothetical bacterial proteins as well as some uncharacterised sequences from Arabidopsis thaliana. The function of this family is unknown.
Probab=72.62  E-value=4.3  Score=30.85  Aligned_cols=43  Identities=14%  Similarity=0.257  Sum_probs=32.6

Q ss_pred             CCCCCCCceeccCC----C-CceeEEecccHHHHHHHHHhCceeeCCC
Q 033276           17 DDECSEQSWMLRSL----S-ESTVACITGDYAMQNVILQMGLRLLAPG   59 (123)
Q Consensus        17 ~~~~~~~~WIt~~~----~-~~~va~vTdDyAmQNVllqlGL~l~sv~   59 (123)
                      .+.++.++||-+-.    . ...+.++|+|.++|+.++..|-..++..
T Consensus        74 ~~~~tAD~~Ie~~v~~~~~~~~~v~VVTSD~~iq~~~~~~GA~~iss~  121 (166)
T PF05991_consen   74 KEGETADDYIERLVRELKNRPRQVTVVTSDREIQRAARGRGAKRISSE  121 (166)
T ss_pred             CCCCCHHHHHHHHHHHhccCCCeEEEEeCCHHHHHHHhhCCCEEEcHH
Confidence            34455567886431    2 4688999999999999999999888763


No 114
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=72.49  E-value=2.1  Score=39.27  Aligned_cols=23  Identities=22%  Similarity=0.174  Sum_probs=17.0

Q ss_pred             eccccCCcccccCccccccCCCC
Q 033276           71 VDKCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      +++|..|+..-.-...||+||++
T Consensus       559 ~~~C~~CGy~g~~~~~CP~CG~~  581 (618)
T PRK14704        559 VDRCKCCSYHGVIGNECPSCGNE  581 (618)
T ss_pred             CeecCCCCCCCCcCccCcCCCCC
Confidence            46899999752223679999976


No 115
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=72.33  E-value=2.3  Score=26.27  Aligned_cols=13  Identities=23%  Similarity=0.422  Sum_probs=9.8

Q ss_pred             ccccCCCCCeeeE
Q 033276           86 ICIKSNHEIRISP   98 (123)
Q Consensus        86 fCp~CG~~~tl~r   98 (123)
                      .||.||++..+++
T Consensus         1 ~CP~Cg~~a~ir~   13 (47)
T PF04606_consen    1 RCPHCGSKARIRT   13 (47)
T ss_pred             CcCCCCCeeEEEE
Confidence            3999999965554


No 116
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=72.32  E-value=2.3  Score=27.83  Aligned_cols=21  Identities=14%  Similarity=0.286  Sum_probs=15.5

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      .|+.|+....+...||.||.=
T Consensus        29 ~C~~CG~~~~~H~vC~~CG~Y   49 (57)
T PRK12286         29 ECPNCGEPKLPHRVCPSCGYY   49 (57)
T ss_pred             ECCCCCCccCCeEECCCCCcC
Confidence            688888775556778888854


No 117
>COG1458 Predicted DNA-binding protein containing PIN domain [General function prediction only]
Probab=72.29  E-value=3.3  Score=34.05  Aligned_cols=29  Identities=21%  Similarity=0.324  Sum_probs=26.2

Q ss_pred             CCceeEEecccHHHHHHHHHhCceeeCCC
Q 033276           31 SESTVACITGDYAMQNVILQMGLRLLAPG   59 (123)
Q Consensus        31 ~~~~va~vTdDyAmQNVllqlGL~l~sv~   59 (123)
                      .++++++++.|..+.--+.+|||+|+...
T Consensus       172 kELdaavVssD~Gir~WAe~LGlrfv~a~  200 (221)
T COG1458         172 KELDAAVVSSDEGIRTWAEKLGLRFVDAF  200 (221)
T ss_pred             HHhCceEEecchhHHHHHHHhCCeeeCHh
Confidence            36789999999999999999999999864


No 118
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=72.27  E-value=2.3  Score=42.57  Aligned_cols=29  Identities=24%  Similarity=0.223  Sum_probs=21.2

Q ss_pred             EEeeccccCCccc---ccCccccccCCCCCeee
Q 033276           68 RYIVDKCLKLFSS---PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        68 ~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~   97 (123)
                      +=.+ ||..|++.   .+-..-||+||+++.|+
T Consensus      1251 rQ~~-RC~kC~~kyRR~PL~G~C~kCGg~iilT 1282 (1337)
T PRK14714       1251 RQEF-RCLKCGTKYRRMPLAGKCRKCGGRIILT 1282 (1337)
T ss_pred             ccce-eecccCcccccCCCCCcccccCCeEEEE
Confidence            3467 99999975   23347899999996443


No 119
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=71.91  E-value=1.8  Score=33.96  Aligned_cols=42  Identities=17%  Similarity=0.322  Sum_probs=29.9

Q ss_pred             hCceeeCCCCCcceee--eEEeeccccCCccc-------ccCc----cccccCCCCC
Q 033276           51 MGLRLLAPGGMQIRQL--HRYIVDKCLKLFSS-------PFPL----VICIKSNHEI   94 (123)
Q Consensus        51 lGL~l~sv~g~~I~~v--~~wvl~rC~gC~k~-------~~~~----~fCp~CG~~~   94 (123)
                      .|+++....+.-++++  .+|-| +|. |+..       +..+    -.|-+||.++
T Consensus        96 ~~l~~~~~h~~~~~~v~~~~~~Y-~C~-C~q~~l~~RRhn~~~~g~~YrC~~C~gkL  150 (156)
T COG3091          96 LGLRFCRTHQFEVQSVRRTTYPY-RCQ-CQQHYLRIRRHNTVRRGEVYRCGKCGGKL  150 (156)
T ss_pred             CCCCCCccchHHHhhccccceeE-Eee-cCCccchhhhcccccccceEEeccCCceE
Confidence            3666666555555554  48999 999 9974       3334    7899999994


No 120
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=71.84  E-value=2.5  Score=26.03  Aligned_cols=9  Identities=11%  Similarity=0.187  Sum_probs=4.3

Q ss_pred             cccccCCCC
Q 033276           85 VICIKSNHE   93 (123)
Q Consensus        85 ~fCp~CG~~   93 (123)
                      ..||.||.|
T Consensus        18 ~~Cp~C~~P   26 (41)
T PF06677_consen   18 EHCPDCGTP   26 (41)
T ss_pred             CccCCCCCe
Confidence            345555544


No 121
>PRK05580 primosome assembly protein PriA; Validated
Probab=71.32  E-value=3.2  Score=38.00  Aligned_cols=24  Identities=21%  Similarity=0.523  Sum_probs=16.2

Q ss_pred             cccCCccc-ccCccccccCCCCCeeeE
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl~r   98 (123)
                      +||-|+.. +.+ ..||.||+. .++.
T Consensus       410 ~Ch~Cg~~~~~~-~~Cp~Cg~~-~l~~  434 (679)
T PRK05580        410 RCHHCGYQEPIP-KACPECGST-DLVP  434 (679)
T ss_pred             ECCCCcCCCCCC-CCCCCCcCC-eeEE
Confidence            57777766 333 579999988 4443


No 122
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=70.54  E-value=2.5  Score=29.09  Aligned_cols=25  Identities=8%  Similarity=0.098  Sum_probs=14.3

Q ss_pred             eeccccCCcccccCccccccCCCCCe
Q 033276           70 IVDKCLKLFSSPFPLVICIKSNHEIR   95 (123)
Q Consensus        70 vl~rC~gC~k~~~~~~fCp~CG~~~t   95 (123)
                      .+ .|.+|.+.-...-+||.||.++.
T Consensus        17 ~~-~C~~C~~~~~~~a~CPdC~~~Le   41 (70)
T PF07191_consen   17 HY-HCEACQKDYKKEAFCPDCGQPLE   41 (70)
T ss_dssp             EE-EETTT--EEEEEEE-TTT-SB-E
T ss_pred             EE-ECccccccceecccCCCcccHHH
Confidence            46 88888876233478999999943


No 123
>PRK07218 replication factor A; Provisional
Probab=70.35  E-value=2.1  Score=37.74  Aligned_cols=50  Identities=12%  Similarity=0.143  Sum_probs=29.8

Q ss_pred             HHHHHHHHHhCceeeCCCC--CcceeeeEEeeccccCCcccccCccccccCCCC
Q 033276           42 YAMQNVILQMGLRLLAPGG--MQIRQLHRYIVDKCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        42 yAmQNVllqlGL~l~sv~g--~~I~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      ..+.+.+..-|..-+.+.|  -.|++-.-... ||+.|.|. ..+..||.||..
T Consensus       267 ~~I~e~~~~~g~~~Vev~G~Iv~i~~gsgli~-rCP~C~r~-v~~~~C~~hG~v  318 (423)
T PRK07218        267 LKIREAVERGGIFDVELVGNIISVRDGSGLIE-RCPECGRV-IQKGQCRSHGAV  318 (423)
T ss_pred             cchhhhhccCCcceEEEEEEEEEeccCCccee-cCcCcccc-ccCCcCCCCCCc
Confidence            3455544433332133434  23445556777 99999998 223689999954


No 124
>COG4640 Predicted membrane protein [Function unknown]
Probab=70.04  E-value=2.3  Score=38.10  Aligned_cols=24  Identities=25%  Similarity=0.239  Sum_probs=18.3

Q ss_pred             cccCCccc-ccCccccccCCCCCee
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRI   96 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl   96 (123)
                      -|+-|++- ...-.+||.||++.+-
T Consensus         3 fC~kcG~qk~Ed~~qC~qCG~~~t~   27 (465)
T COG4640           3 FCPKCGSQKAEDDVQCTQCGHKFTS   27 (465)
T ss_pred             cccccccccccccccccccCCcCCc
Confidence            69999966 4444669999999643


No 125
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=70.03  E-value=2.7  Score=32.03  Aligned_cols=22  Identities=9%  Similarity=0.084  Sum_probs=17.1

Q ss_pred             cccCCccc--ccC--ccccccCCCCC
Q 033276           73 KCLKLFSS--PFP--LVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~--~~~--~~fCp~CG~~~   94 (123)
                      .|+.|++.  ++.  -..||+||...
T Consensus        11 ~Cp~cg~kFYDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300        11 ICPNTGSKFYDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             cCCCcCccccccCCCCccCCCcCCcc
Confidence            79999986  433  37899999873


No 126
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=69.56  E-value=5.2  Score=33.91  Aligned_cols=21  Identities=14%  Similarity=0.295  Sum_probs=18.8

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|.-|... ...+.-||.||+.
T Consensus       212 ~CslC~teW~~~R~~C~~Cg~~  233 (305)
T TIGR01562       212 SCSLCATEWHYVRVKCSHCEES  233 (305)
T ss_pred             EcCCCCCcccccCccCCCCCCC
Confidence            59999988 8889999999986


No 127
>PRK14873 primosome assembly protein PriA; Provisional
Probab=69.13  E-value=3.8  Score=37.91  Aligned_cols=20  Identities=10%  Similarity=0.082  Sum_probs=9.4

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      +||-|+.... -..||.||++
T Consensus       412 ~Ch~CG~~~~-p~~Cp~Cgs~  431 (665)
T PRK14873        412 RCRWCGRAAP-DWRCPRCGSD  431 (665)
T ss_pred             ECCCCcCCCc-CccCCCCcCC
Confidence            4444444311 2356666665


No 128
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=68.75  E-value=2.6  Score=35.98  Aligned_cols=27  Identities=22%  Similarity=0.335  Sum_probs=21.0

Q ss_pred             eEEeeccccCCccc------ccCccccccCCCCCe
Q 033276           67 HRYIVDKCLKLFSS------PFPLVICIKSNHEIR   95 (123)
Q Consensus        67 ~~wvl~rC~gC~k~------~~~~~fCp~CG~~~t   95 (123)
                      --|..  |++|+..      ......||+||+...
T Consensus        26 ~lw~K--Cp~c~~~~y~~eL~~n~~vcp~c~~h~r   58 (294)
T COG0777          26 GLWTK--CPSCGEMLYRKELESNLKVCPKCGHHMR   58 (294)
T ss_pred             CceeE--CCCccceeeHHHHHhhhhcccccCcccc
Confidence            46876  9999986      244788999999843


No 129
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=68.68  E-value=2.2  Score=25.22  Aligned_cols=21  Identities=29%  Similarity=0.388  Sum_probs=15.7

Q ss_pred             cccCCccc---c-------cCccccccCCCC
Q 033276           73 KCLKLFSS---P-------FPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~---~-------~~~~fCp~CG~~   93 (123)
                      +|+.|.+.   +       ..+.-||+||+.
T Consensus         4 ~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~   34 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLPAGGRKVRCPKCGHV   34 (37)
T ss_pred             ECCCCCceEEcCHHHcccCCcEEECCCCCcE
Confidence            79999875   2       226789999986


No 130
>COG0267 RpmG Ribosomal protein L33 [Translation, ribosomal structure and biogenesis]
Probab=68.68  E-value=4  Score=26.38  Aligned_cols=29  Identities=7%  Similarity=0.085  Sum_probs=20.1

Q ss_pred             EEeeccccCCc-cc---------c----cCccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLF-SS---------P----FPLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~-k~---------~----~~~~fCp~CG~~~tl~r   98 (123)
                      .-.+ .|.+|. +.         .    .-+.|||+|+.. |+.|
T Consensus         5 kI~L-~ct~c~g~nY~t~kN~r~~~~rLelkKycp~~~kh-tlhk   47 (50)
T COG0267           5 KIKL-ACTACTSRNYTTTKNKRNKPERLELKKYCPVCRKH-TLHK   47 (50)
T ss_pred             eEEE-EEeccCCeeEEEeeccCCCcceEEEEecCcccccE-EEEe
Confidence            3456 888888 21         1    126899999999 7765


No 131
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=68.57  E-value=6.2  Score=23.75  Aligned_cols=8  Identities=25%  Similarity=0.484  Sum_probs=6.3

Q ss_pred             ccccCCCC
Q 033276           86 ICIKSNHE   93 (123)
Q Consensus        86 fCp~CG~~   93 (123)
                      -||+||++
T Consensus         2 ~Cp~C~~~    9 (40)
T smart00440        2 PCPKCGNR    9 (40)
T ss_pred             cCCCCCCC
Confidence            48888877


No 132
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=68.53  E-value=3  Score=42.22  Aligned_cols=28  Identities=18%  Similarity=0.183  Sum_probs=20.2

Q ss_pred             EEeeccccCCccc---ccCccccccCCCCCeee
Q 033276           68 RYIVDKCLKLFSS---PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        68 ~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~   97 (123)
                      +=.+ || .|++.   .+-..-||+||+++.|+
T Consensus      1540 rQ~~-RC-kC~~kyRR~PL~G~C~kCGg~~ilT 1570 (1627)
T PRK14715       1540 RQEF-RC-KCGAKYRRVPLKGKCPKCGSKLILT 1570 (1627)
T ss_pred             ccce-ee-cCCCccccCCCCCcCcccCCeEEEE
Confidence            3457 99 99975   33357899999996443


No 133
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=68.27  E-value=4.5  Score=37.74  Aligned_cols=58  Identities=19%  Similarity=0.232  Sum_probs=31.7

Q ss_pred             HHHHHHHHh--CceeeCCCCCcceeeeEEeeccccCCccc-cc----CccccccCCCCCeeeEEEEEeeEEEEEe
Q 033276           43 AMQNVILQM--GLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PF----PLVICIKSNHEIRISPVFMLILICLYIQ  110 (123)
Q Consensus        43 AmQNVllql--GL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~----~~~fCp~CG~~~tl~rV~~~~~~~~~~~  110 (123)
                      |+.++.+.+  +|...++.         -.+++|..|+.. ..    ....||+||++ --.++.+.-=++=|+.
T Consensus       620 a~~~lv~~~~~~i~Y~~in---------~~~~~C~~CG~~Ge~~~~~~~~~CP~CG~~-~~~~~~v~~Ri~GYl~  684 (711)
T PRK09263        620 ALEAVWDYSYDRVGYLGTN---------TPIDECYECGFTGEFECTEKGFTCPKCGNH-DPKTVSVTRRTCGYLG  684 (711)
T ss_pred             HHHHHHHHHHHCCCeEEeC---------CCCcccCCCCCCccccCCCCCCcCcCCCCC-CCcceeEEEeeccccC
Confidence            666665553  44444442         234699999975 21    13679999986 2223333333333553


No 134
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=68.08  E-value=1.7  Score=28.96  Aligned_cols=30  Identities=10%  Similarity=0.057  Sum_probs=20.8

Q ss_pred             eEEeeccccCCccc--ccCccccccCCCCCeee
Q 033276           67 HRYIVDKCLKLFSS--PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        67 ~~wvl~rC~gC~k~--~~~~~fCp~CG~~~tl~   97 (123)
                      +.-.+ .|+-|..-  ..-...||+||+.++.|
T Consensus        23 ~ICSf-ECTFC~~C~e~~l~~~CPNCgGelv~R   54 (57)
T PF06906_consen   23 YICSF-ECTFCADCAETMLNGVCPNCGGELVRR   54 (57)
T ss_pred             eEEeE-eCcccHHHHHHHhcCcCcCCCCccccC
Confidence            34456 78888765  33368899999996544


No 135
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=68.00  E-value=5.8  Score=33.78  Aligned_cols=21  Identities=19%  Similarity=0.211  Sum_probs=18.8

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|.-|... ...+.-||.||+.
T Consensus       214 ~CslC~teW~~~R~~C~~Cg~~  235 (309)
T PRK03564        214 HCNLCESEWHVVRVKCSNCEQS  235 (309)
T ss_pred             EcCCCCCcccccCccCCCCCCC
Confidence            59999988 8889999999986


No 136
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=67.98  E-value=1.3  Score=29.33  Aligned_cols=21  Identities=24%  Similarity=0.298  Sum_probs=16.7

Q ss_pred             cccCCccc-ccCcccc-ccCCCC
Q 033276           73 KCLKLFSS-PFPLVIC-IKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fC-p~CG~~   93 (123)
                      -|+-|++. ++++.|| +.|+..
T Consensus         5 HC~~CG~~Ip~~~~fCS~~C~~~   27 (59)
T PF09889_consen    5 HCPVCGKPIPPDESFCSPKCREE   27 (59)
T ss_pred             cCCcCCCcCCcchhhhCHHHHHH
Confidence            48888887 7788899 688765


No 137
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=67.83  E-value=1.7  Score=41.82  Aligned_cols=20  Identities=15%  Similarity=0.150  Sum_probs=0.0

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      +|+.|++. .....||.||++
T Consensus       657 ~Cp~Cg~~-t~~~~Cp~CG~~  676 (900)
T PF03833_consen  657 RCPKCGKE-TFYNRCPECGSH  676 (900)
T ss_dssp             ---------------------
T ss_pred             cCcccCCc-chhhcCcccCCc
Confidence            56666654 112335555555


No 138
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type. The N-terminal region of about 200 amino acids is rich in low-complexity sequence, poorly alignable, and not included n this model.
Probab=67.70  E-value=2.8  Score=41.40  Aligned_cols=22  Identities=23%  Similarity=0.199  Sum_probs=18.1

Q ss_pred             eccccCCccc------------ccCccccccCCCC
Q 033276           71 VDKCLKLFSS------------PFPLVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~------------~~~~~fCp~CG~~   93 (123)
                      | +|+.|+..            |++.+-||+||.+
T Consensus       684 y-~c~~c~~~ef~~~~~~~sg~dlp~k~cp~c~~~  717 (1213)
T TIGR01405       684 Y-LCPNCKYSEFITDGSVGSGFDLPDKDCPKCGAP  717 (1213)
T ss_pred             c-cCcccccccccccccccccccCccccCcccccc
Confidence            7 99999873            3566789999988


No 139
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]
Probab=67.50  E-value=3.3  Score=41.60  Aligned_cols=22  Identities=23%  Similarity=0.212  Sum_probs=18.1

Q ss_pred             eccccCCccc------------ccCccccccCCCC
Q 033276           71 VDKCLKLFSS------------PFPLVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~------------~~~~~fCp~CG~~   93 (123)
                      | +|+.|+..            |.+-+-||+||.|
T Consensus       915 Y-~Cp~Cky~Ef~~d~svgsGfDLpdK~CPkCg~p  948 (1444)
T COG2176         915 Y-LCPECKYSEFIDDGSVGSGFDLPDKDCPKCGTP  948 (1444)
T ss_pred             c-cCCCCceeeeecCCCcCCCCCCCCCCCCcCCCc
Confidence            6 99999864            2556889999999


No 140
>PRK00448 polC DNA polymerase III PolC; Validated
Probab=67.26  E-value=2.9  Score=42.07  Aligned_cols=22  Identities=23%  Similarity=0.238  Sum_probs=17.8

Q ss_pred             eccccCCccc------------ccCccccccCCCC
Q 033276           71 VDKCLKLFSS------------PFPLVICIKSNHE   93 (123)
Q Consensus        71 l~rC~gC~k~------------~~~~~fCp~CG~~   93 (123)
                      | +|+.|+..            |++.+-||+||.+
T Consensus       909 y-~C~~C~~~ef~~~~~~~sG~Dlpdk~Cp~Cg~~  942 (1437)
T PRK00448        909 Y-VCPNCKYSEFFTDGSVGSGFDLPDKDCPKCGTK  942 (1437)
T ss_pred             c-cCcccccccccccccccccccCccccCcccccc
Confidence            6 99999875            2456789999998


No 141
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=66.70  E-value=1.6  Score=28.29  Aligned_cols=14  Identities=7%  Similarity=0.176  Sum_probs=10.0

Q ss_pred             ccCccccccCCCCC
Q 033276           81 PFPLVICIKSNHEI   94 (123)
Q Consensus        81 ~~~~~fCp~CG~~~   94 (123)
                      ...+.||+.||.++
T Consensus        45 ~~~r~FC~~CGs~l   58 (92)
T PF04828_consen   45 GVERYFCPTCGSPL   58 (92)
T ss_dssp             SCEEEEETTT--EE
T ss_pred             cCcCcccCCCCCee
Confidence            56689999999994


No 142
>PRK05978 hypothetical protein; Provisional
Probab=66.55  E-value=2.8  Score=32.25  Aligned_cols=28  Identities=11%  Similarity=0.201  Sum_probs=20.4

Q ss_pred             EEeeccccCCcccc------cCccccccCCCCCee
Q 033276           68 RYIVDKCLKLFSSP------FPLVICIKSNHEIRI   96 (123)
Q Consensus        68 ~wvl~rC~gC~k~~------~~~~fCp~CG~~~tl   96 (123)
                      -+.. ||+.|++-.      .-.+.||.||.+...
T Consensus        31 Gl~g-rCP~CG~G~LF~g~Lkv~~~C~~CG~~~~~   64 (148)
T PRK05978         31 GFRG-RCPACGEGKLFRAFLKPVDHCAACGEDFTH   64 (148)
T ss_pred             HHcC-cCCCCCCCcccccccccCCCccccCCcccc
Confidence            3556 999999751      236889999998433


No 143
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=66.15  E-value=3.4  Score=32.96  Aligned_cols=27  Identities=15%  Similarity=0.142  Sum_probs=22.4

Q ss_pred             cccCCccc-ccCccccccCCCCCeeeEE
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl~rV   99 (123)
                      +|..|+.+ ....-.||.||+--|++..
T Consensus       356 ~c~~cg~~~~~~~~~c~~c~~~~~~~~~  383 (389)
T PRK11788        356 RCRNCGFTARTLYWHCPSCKAWETIKPI  383 (389)
T ss_pred             ECCCCCCCCccceeECcCCCCccCcCCc
Confidence            79999998 6667899999998777654


No 144
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=66.07  E-value=4.2  Score=27.91  Aligned_cols=26  Identities=19%  Similarity=0.379  Sum_probs=19.6

Q ss_pred             EEeeccccCCccc------ccCccccccCCCC
Q 033276           68 RYIVDKCLKLFSS------PFPLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~gC~k~------~~~~~fCp~CG~~   93 (123)
                      +|..-+|++|+..      ..+...|+.||.-
T Consensus        16 ~Fl~VkCpdC~N~q~vFshast~V~C~~CG~~   47 (67)
T COG2051          16 RFLRVKCPDCGNEQVVFSHASTVVTCLICGTT   47 (67)
T ss_pred             eEEEEECCCCCCEEEEeccCceEEEecccccE
Confidence            3444489999986      3557899999975


No 145
>PLN02569 threonine synthase
Probab=65.76  E-value=6.1  Score=35.10  Aligned_cols=54  Identities=13%  Similarity=0.057  Sum_probs=34.8

Q ss_pred             eEEecccHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc-c--cCccccccCCCCC
Q 033276           35 VACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-P--FPLVICIKSNHEI   94 (123)
Q Consensus        35 va~vTdDyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~--~~~~fCp~CG~~~   94 (123)
                      ..-.|.|-++|-++++ +... +.  ..+.-...+.+ +|..|++. +  .....| .||..+
T Consensus        18 ~~~~~~~~~~~~~~~~-~~~~-~~--~~~~~~~~~~l-~C~~Cg~~y~~~~~~~~C-~cgg~l   74 (484)
T PLN02569         18 ATKFTADENIRDEARR-GPPA-PP--DEFSAKYVPFL-ECPLTGEKYSLDEVVYRS-KSGGLL   74 (484)
T ss_pred             ccccCcchhhhhhhhh-cCCC-CC--ccccccccccc-EeCCCCCcCCCccccccC-CCCCeE
Confidence            4568899999999998 2211 11  22222223358 99999987 3  334679 699875


No 146
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=65.26  E-value=6.8  Score=27.95  Aligned_cols=42  Identities=10%  Similarity=0.072  Sum_probs=26.1

Q ss_pred             EeeccccCCccc------ccCccccccCCCCC---eeeEEEEEeeEEEEEe
Q 033276           69 YIVDKCLKLFSS------PFPLVICIKSNHEI---RISPVFMLILICLYIQ  110 (123)
Q Consensus        69 wvl~rC~gC~k~------~~~~~fCp~CG~~~---tl~rV~~~~~~~~~~~  110 (123)
                      |..-+|++|+++      ..+...|..||..+   |=-|...+-|-+.+-|
T Consensus        33 Fm~VkCp~C~n~q~VFShA~t~V~C~~Cg~~L~~PTGGKa~l~~gc~fr~k   83 (85)
T PTZ00083         33 FMDVKCPGCSQITTVFSHAQTVVLCGGCSSQLCQPTGGKAKLTEGCSFRRK   83 (85)
T ss_pred             EEEEECCCCCCeeEEEecCceEEEccccCCEeeccCCCCeEecCCceEEec
Confidence            333489999987      24568999999763   2334444444444433


No 147
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=65.14  E-value=6.3  Score=34.09  Aligned_cols=38  Identities=18%  Similarity=0.281  Sum_probs=16.9

Q ss_pred             cceeeeEEeeccccCCccc-----ccCccccccCCCCCeeeEEEEE
Q 033276           62 QIRQLHRYIVDKCLKLFSS-----PFPLVICIKSNHEIRISPVFML  102 (123)
Q Consensus        62 ~I~~v~~wvl~rC~gC~k~-----~~~~~fCp~CG~~~tl~rV~~~  102 (123)
                      .++-+++|-  +|..|+..     ..|..-|++||+. --.|++|.
T Consensus       278 ~~~a~KRFF--kC~~C~~Rt~sl~r~P~~~C~~Cg~~-~wer~~M~  320 (344)
T PF09332_consen  278 WHDAVKRFF--KCKDCGNRTISLERLPKKHCSNCGSS-KWERTGML  320 (344)
T ss_dssp             EEEEE-EEE--E-T-TS-EEEESSSS--S--TTT-S----EEE---
T ss_pred             EeeeeeeeE--ECCCCCCeeeecccCCCCCCCcCCcC-ceeehhhh
Confidence            445567775  59999973     4677899999998 78888863


No 148
>PF14206 Cys_rich_CPCC:  Cysteine-rich CPCC
Probab=65.11  E-value=3.5  Score=28.68  Aligned_cols=20  Identities=15%  Similarity=-0.111  Sum_probs=15.0

Q ss_pred             cccCCccc----ccC--ccccccCCC
Q 033276           73 KCLKLFSS----PFP--LVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~----~~~--~~fCp~CG~   92 (123)
                      .|+-|+..    ...  .++||+|+=
T Consensus         3 ~CPCCg~~Tl~~~~~~~ydIC~VC~W   28 (78)
T PF14206_consen    3 PCPCCGYYTLEERGEGTYDICPVCFW   28 (78)
T ss_pred             cCCCCCcEEeccCCCcCceECCCCCc
Confidence            79999975    222  779999983


No 149
>PRK04860 hypothetical protein; Provisional
Probab=64.60  E-value=8.8  Score=29.59  Aligned_cols=55  Identities=7%  Similarity=0.144  Sum_probs=33.3

Q ss_pred             cHHHHHHHHH-hCceeeCCCCCccee--eeEEeeccccCCccc-------c-----cCccccccCCCCCeee
Q 033276           41 DYAMQNVILQ-MGLRLLAPGGMQIRQ--LHRYIVDKCLKLFSS-------P-----FPLVICIKSNHEIRIS   97 (123)
Q Consensus        41 DyAmQNVllq-lGL~l~sv~g~~I~~--v~~wvl~rC~gC~k~-------~-----~~~~fCp~CG~~~tl~   97 (123)
                      |-.=|-++.+ +|++........|..  .+.|.| +|. |.+.       .     ...-.|..||.++...
T Consensus        87 g~ewk~lm~~v~g~~~r~~h~~~~~~~~~~~~~Y-~C~-C~~~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860         87 GKEWQWMMESVLGVPARRTHQFEVQSVRGKTFPY-RCK-CQEHQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             CHHHHHHHHHhcCCCCcccCCCcCCccccCEEEE-EcC-CCCeeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            5555677776 476333333223332  457999 997 9542       1     3347899999995443


No 150
>cd01121 Sms Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
Probab=64.46  E-value=4.4  Score=34.71  Aligned_cols=26  Identities=15%  Similarity=0.031  Sum_probs=21.4

Q ss_pred             cccCCccc-ccCccccccCCCCCeeeE
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl~r   98 (123)
                      +|..|+.. +.....||.||.=.|+..
T Consensus         2 ~c~~cg~~~~~~~g~cp~c~~w~~~~e   28 (372)
T cd01121           2 VCSECGYVSPKWLGKCPECGEWNTLVE   28 (372)
T ss_pred             CCCCCCCCCCCccEECcCCCCceeeee
Confidence            89999988 667788999998777766


No 151
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=64.21  E-value=4.3  Score=31.22  Aligned_cols=27  Identities=7%  Similarity=0.085  Sum_probs=22.4

Q ss_pred             cccCCccc--cc--CccccccCCCCCeeeEEE
Q 033276           73 KCLKLFSS--PF--PLVICIKSNHEIRISPVF  100 (123)
Q Consensus        73 rC~gC~k~--~~--~~~fCp~CG~~~tl~rV~  100 (123)
                      +|..|+..  +.  ....||.||+. -.||||
T Consensus       151 ~~~~~g~~~~~~~~~~~~c~~~~~~-e~rkva  181 (189)
T PRK09521        151 MCSRCRTPLVKKGENELKCPNCGNI-ETRKLS  181 (189)
T ss_pred             EccccCCceEECCCCEEECCCCCCE-Eeeccc
Confidence            79999986  32  46899999988 889998


No 152
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=63.96  E-value=3.5  Score=26.72  Aligned_cols=10  Identities=20%  Similarity=0.481  Sum_probs=9.1

Q ss_pred             ccccccCCCC
Q 033276           84 LVICIKSNHE   93 (123)
Q Consensus        84 ~~fCp~CG~~   93 (123)
                      ...||+|||.
T Consensus        13 Y~~Cp~CGN~   22 (49)
T PF12677_consen   13 YCKCPKCGND   22 (49)
T ss_pred             hccCcccCCc
Confidence            5789999999


No 153
>COG4031 Predicted metal-binding protein [General function prediction only]
Probab=63.90  E-value=3.6  Score=33.73  Aligned_cols=19  Identities=16%  Similarity=0.520  Sum_probs=16.5

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      +| -|+.. +.+ .||+.||.+
T Consensus         2 ~C-rCG~~l~~p-~~Cl~Cg~~   21 (227)
T COG4031           2 IC-RCGAELSSP-AFCLNCGRR   21 (227)
T ss_pred             cc-ccCCccccc-chhcccCCc
Confidence            68 89988 666 999999987


No 154
>PRK11823 DNA repair protein RadA; Provisional
Probab=63.82  E-value=4.9  Score=35.01  Aligned_cols=30  Identities=13%  Similarity=0.050  Sum_probs=25.0

Q ss_pred             EEeeccccCCccc-ccCccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLFSS-PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~r   98 (123)
                      +-.| +|..|+.. ....-.||.||.-.|+..
T Consensus         5 ~~~y-~C~~Cg~~~~~~~g~Cp~C~~w~t~~e   35 (446)
T PRK11823          5 KTAY-VCQECGAESPKWLGRCPECGAWNTLVE   35 (446)
T ss_pred             CCeE-ECCcCCCCCcccCeeCcCCCCccceee
Confidence            4568 99999988 767788999998877766


No 155
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=63.62  E-value=4.1  Score=21.67  Aligned_cols=21  Identities=10%  Similarity=0.029  Sum_probs=17.2

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|.+|... ...+..|..||.+
T Consensus         4 ~C~~C~~~N~~~~~~C~~C~~p   25 (26)
T smart00547        4 ECPACTFLNFASRSKCFACGAP   25 (26)
T ss_pred             cCCCCCCcChhhhccccccCCc
Confidence            68999877 5667889999976


No 156
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=63.43  E-value=7.9  Score=28.17  Aligned_cols=35  Identities=14%  Similarity=0.069  Sum_probs=20.9

Q ss_pred             EEeecccc--CCccc---c-cCccccccCCCCC--eeeEEEEE
Q 033276           68 RYIVDKCL--KLFSS---P-FPLVICIKSNHEI--RISPVFML  102 (123)
Q Consensus        68 ~wvl~rC~--gC~k~---~-~~~~fCp~CG~~~--tl~rV~~~  102 (123)
                      .|-|..|+  .|++.   . ...-+|++||...  ...|..+.
T Consensus        15 ~~~Y~aC~~~~C~kKv~~~~~~~y~C~~C~~~~~~~~~ry~l~   57 (146)
T PF08646_consen   15 NWYYPACPNEKCNKKVTENGDGSYRCEKCNKTVENPKYRYRLS   57 (146)
T ss_dssp             TTEEEE-TSTTTS-B-EEETTTEEEETTTTEEESS-EEEEEEE
T ss_pred             CcEECCCCCccCCCEeecCCCcEEECCCCCCcCCCeeEEEEEE
Confidence            46666999  99986   2 2356999999762  34444433


No 157
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=63.27  E-value=2.9  Score=27.50  Aligned_cols=26  Identities=12%  Similarity=-0.026  Sum_probs=20.1

Q ss_pred             cCccccccCCCCCeeeEEEEEeeEEEE
Q 033276           82 FPLVICIKSNHEIRISPVFMLILICLY  108 (123)
Q Consensus        82 ~~~~fCp~CG~~~tl~rV~~~~~~~~~  108 (123)
                      +....||.||+. ..++|....|...|
T Consensus         5 p~~~~CP~C~~~-~~T~v~~~~g~~t~   30 (73)
T PF10601_consen    5 PVRIYCPYCQQQ-VQTRVEYKSGTMTY   30 (73)
T ss_pred             ceeeECCCCCCE-EEEEEEEEeChHHH
Confidence            345889999999 89999877765544


No 158
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=63.26  E-value=3.1  Score=24.20  Aligned_cols=21  Identities=33%  Similarity=0.456  Sum_probs=10.7

Q ss_pred             cccCCccc----ccCccccccCCCC
Q 033276           73 KCLKLFSS----PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~   93 (123)
                      .|+-|...    +.....||.||+.
T Consensus         4 ~Cp~C~se~~y~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTYEDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----EE-SSSEEETTTTEE
T ss_pred             CCCCCCCcceeccCCEEeCCccccc
Confidence            57777754    5556778888765


No 159
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=63.16  E-value=5.6  Score=26.67  Aligned_cols=11  Identities=9%  Similarity=0.220  Sum_probs=9.0

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      ...|++||.++
T Consensus        78 ~~~C~vC~k~l   88 (109)
T PF10367_consen   78 STKCSVCGKPL   88 (109)
T ss_pred             CCCccCcCCcC
Confidence            46699999995


No 160
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=62.77  E-value=4.3  Score=35.49  Aligned_cols=24  Identities=13%  Similarity=0.234  Sum_probs=19.5

Q ss_pred             eeccccCCccc-ccCccccccCCCCC
Q 033276           70 IVDKCLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        70 vl~rC~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      .. .|+.|... +..+..||.||+.+
T Consensus       221 l~-~C~~Cd~l~~~~~a~CpRC~~~L  245 (419)
T PRK15103        221 LR-SCSCCTAILPADQPVCPRCHTKG  245 (419)
T ss_pred             CC-cCCCCCCCCCCCCCCCCCCCCcC
Confidence            44 69999988 55566899999985


No 161
>COG4469 CoiA Competence protein CoiA-like family, contains a predicted nuclease    domain [General function prediction only]
Probab=62.56  E-value=3.5  Score=35.86  Aligned_cols=14  Identities=7%  Similarity=0.304  Sum_probs=10.9

Q ss_pred             ccccccCCCCCeee
Q 033276           84 LVICIKSNHEIRIS   97 (123)
Q Consensus        84 ~~fCp~CG~~~tl~   97 (123)
                      +-|||.||+++.|+
T Consensus        25 ~ffCPaC~~~l~lK   38 (342)
T COG4469          25 RFFCPACGSQLILK   38 (342)
T ss_pred             ccccCCCCCeeeee
Confidence            46999999996444


No 162
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=62.49  E-value=4.3  Score=35.24  Aligned_cols=23  Identities=13%  Similarity=0.391  Sum_probs=18.4

Q ss_pred             cccCCccc--ccCccccccCCCCCe
Q 033276           73 KCLKLFSS--PFPLVICIKSNHEIR   95 (123)
Q Consensus        73 rC~gC~k~--~~~~~fCp~CG~~~t   95 (123)
                      .|+.|...  +..+-.||.||+.+.
T Consensus       217 ~C~~Cd~~~~~~~~a~CpRC~~~L~  241 (403)
T TIGR00155       217 SCSACHTTILPAQEPVCPRCSTPLY  241 (403)
T ss_pred             cCCCCCCccCCCCCcCCcCCCCccc
Confidence            69999986  444667999999853


No 163
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=61.79  E-value=3.9  Score=30.40  Aligned_cols=26  Identities=19%  Similarity=0.278  Sum_probs=18.8

Q ss_pred             EEeeccccCCccc-c----cC------ccccccCCCCC
Q 033276           68 RYIVDKCLKLFSS-P----FP------LVICIKSNHEI   94 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~----~~------~~fCp~CG~~~   94 (123)
                      .-.| .|+.|++. .    +.      .-.||.||.++
T Consensus        97 ~~~Y-~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       97 NAYY-KCPNCQSKYTFLEANQLLDMDGTFTCPRCGEEL  133 (147)
T ss_pred             CcEE-ECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEE
Confidence            4478 99999975 1    11      15799999984


No 164
>PRK04023 DNA polymerase II large subunit; Validated
Probab=61.78  E-value=4.3  Score=39.97  Aligned_cols=20  Identities=15%  Similarity=0.034  Sum_probs=9.1

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      +|+.|++. ....+||+||.+
T Consensus       628 fCpsCG~~-t~~frCP~CG~~  647 (1121)
T PRK04023        628 KCPSCGKE-TFYRRCPFCGTH  647 (1121)
T ss_pred             cCCCCCCc-CCcccCCCCCCC
Confidence            55555554 122345555443


No 165
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=61.41  E-value=9  Score=29.53  Aligned_cols=33  Identities=21%  Similarity=0.232  Sum_probs=23.2

Q ss_pred             eEEeeccccCCccc-c--------------cCccccccCCCCCeeeEEEEE
Q 033276           67 HRYIVDKCLKLFSS-P--------------FPLVICIKSNHEIRISPVFML  102 (123)
Q Consensus        67 ~~wvl~rC~gC~k~-~--------------~~~~fCp~CG~~~tl~rV~~~  102 (123)
                      ++|-| +|. ++.. +              ....-||.||+. .++|.-+.
T Consensus         2 I~y~L-~C~-~gH~FEgWF~ss~~fd~Q~~~glv~CP~Cgs~-~V~K~lmA   49 (148)
T PF06676_consen    2 IVYDL-RCE-NGHEFEGWFRSSAAFDRQQARGLVSCPVCGST-EVSKALMA   49 (148)
T ss_pred             eeEEE-ecC-CCCccceecCCHHHHHHHHHcCCccCCCCCCC-eEeeecCC
Confidence            57888 887 4433 1              246789999999 78776554


No 166
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=61.26  E-value=5.3  Score=31.04  Aligned_cols=57  Identities=7%  Similarity=-0.112  Sum_probs=31.1

Q ss_pred             EEecccHHHHHHHHHhCceeeCCCCCcce-eeeEEeeccccCCccc-c-----cCccccccCCCCC
Q 033276           36 ACITGDYAMQNVILQMGLRLLAPGGMQIR-QLHRYIVDKCLKLFSS-P-----FPLVICIKSNHEI   94 (123)
Q Consensus        36 a~vTdDyAmQNVllqlGL~l~sv~g~~I~-~v~~wvl~rC~gC~k~-~-----~~~~fCp~CG~~~   94 (123)
                      -.+|.+.+.+.+..++---+..+. .++. ....=-| .|+.|++. .     ...-.||.||+.+
T Consensus        83 w~l~~~~i~d~ik~~~~~~~~klk-~~l~~e~~~~~Y-~Cp~C~~rytf~eA~~~~F~Cp~Cg~~L  146 (178)
T PRK06266         83 WKPELEKLPEIIKKKKMEELKKLK-EQLEEEENNMFF-FCPNCHIRFTFDEAMEYGFRCPQCGEML  146 (178)
T ss_pred             EEeCHHHHHHHHHHHHHHHHHHHH-HHhhhccCCCEE-ECCCCCcEEeHHHHhhcCCcCCCCCCCC
Confidence            346777777766666522111111 1111 1112346 89999875 1     2235599999984


No 167
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=61.00  E-value=4.9  Score=29.51  Aligned_cols=17  Identities=6%  Similarity=-0.029  Sum_probs=12.9

Q ss_pred             ccCccccccCCCCCeee
Q 033276           81 PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        81 ~~~~~fCp~CG~~~tl~   97 (123)
                      ...+.|||.||.++.-+
T Consensus        66 ~~~r~FC~~CGs~l~~~   82 (133)
T COG3791          66 SAGRGFCPTCGSPLFWR   82 (133)
T ss_pred             CCCCeecccCCCceEEe
Confidence            34578999999996444


No 168
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=60.72  E-value=2.7  Score=27.30  Aligned_cols=22  Identities=14%  Similarity=0.295  Sum_probs=18.1

Q ss_pred             ccccccCCCCCeeeEEEEEeeEE
Q 033276           84 LVICIKSNHEIRISPVFMLILIC  106 (123)
Q Consensus        84 ~~fCp~CG~~~tl~rV~~~~~~~  106 (123)
                      ..+||.||+. ..++|....|..
T Consensus         3 ~i~Cp~C~~~-~~T~v~~~~g~~   24 (67)
T smart00714        3 QLFCPRCQNN-VTTRVETETGVC   24 (67)
T ss_pred             ceECCCCCCE-EEEEEEEEeChH
Confidence            4689999999 899998777653


No 169
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=60.59  E-value=3.9  Score=24.33  Aligned_cols=8  Identities=13%  Similarity=0.347  Sum_probs=3.5

Q ss_pred             cccccCCC
Q 033276           85 VICIKSNH   92 (123)
Q Consensus        85 ~fCp~CG~   92 (123)
                      +.||.||+
T Consensus        20 d~C~~C~G   27 (41)
T PF13453_consen   20 DVCPSCGG   27 (41)
T ss_pred             EECCCCCe
Confidence            33444443


No 170
>PHA02942 putative transposase; Provisional
Probab=60.11  E-value=12  Score=32.11  Aligned_cols=40  Identities=15%  Similarity=0.076  Sum_probs=21.6

Q ss_pred             HHHHhCceeeCCCCCcceeeeEEeeccccCCccc-c-cC--ccccccCCCC
Q 033276           47 VILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-P-FP--LVICIKSNHE   93 (123)
Q Consensus        47 VllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~-~~--~~fCp~CG~~   93 (123)
                      -+...|+.|+.++-..-.      . .|+.|+.. . ..  .-.||.||..
T Consensus       308 KA~~~G~~Vv~V~p~yTS------q-~Cs~CG~~~~~l~~r~f~C~~CG~~  351 (383)
T PHA02942        308 QAKKHGMIVEFVNPSYSS------V-SCPKCGHKMVEIAHRYFHCPSCGYE  351 (383)
T ss_pred             HHHHhCCEEEEECCCCCC------c-cCCCCCCccCcCCCCEEECCCCCCE
Confidence            444556666655432212      3 68888765 2 11  2357888764


No 171
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair]
Probab=59.70  E-value=4.5  Score=35.20  Aligned_cols=7  Identities=29%  Similarity=0.192  Sum_probs=4.1

Q ss_pred             ccCCccc
Q 033276           74 CLKLFSS   80 (123)
Q Consensus        74 C~gC~k~   80 (123)
                      |++|+..
T Consensus       153 Cp~CG~~  159 (345)
T KOG3084|consen  153 CPGCGSP  159 (345)
T ss_pred             CcccCCC
Confidence            6666654


No 172
>PF14949 ARF7EP_C:  ARF7 effector protein C-terminus
Probab=59.67  E-value=5  Score=29.32  Aligned_cols=15  Identities=20%  Similarity=0.408  Sum_probs=11.3

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      -|+|||-+      ||+||+.
T Consensus        69 ~C~GC~~P------C~~C~S~   83 (103)
T PF14949_consen   69 DCPGCHYP------CPKCGSR   83 (103)
T ss_pred             CCCCcccc------CCCCCCC
Confidence            58888843      8888875


No 173
>COG1328 NrdD Oxygen-sensitive ribonucleoside-triphosphate reductase [Nucleotide transport and metabolism]
Probab=59.37  E-value=6.8  Score=36.85  Aligned_cols=62  Identities=18%  Similarity=0.093  Sum_probs=39.0

Q ss_pred             cccHHHHHHHHH---hCceeeCCCCCcceeeeEEeeccccCCccc-ccCccccccCCCCCeeeEEEEEeeEEEEEeeCC
Q 033276           39 TGDYAMQNVILQ---MGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHEIRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        39 TdDyAmQNVllq---lGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~  113 (123)
                      .+-=|++|+.+.   .++.+.+.. ..|        +.|..|+.. ......||+||++ -   |.+.-=++=|++...
T Consensus       615 ~~~eal~~l~k~~~~~ri~Y~~~n-~~i--------~~C~~cg~~~~~~~~~Cp~CG~~-d---ve~~~Ri~GYl~~~~  680 (700)
T COG1328         615 ADPEALMDLTKYIYKTRIGYWGYT-TPI--------SVCNRCGYSGEGLRTRCPKCGSE-D---VEVFSRITGYLQNPS  680 (700)
T ss_pred             CCHHHHHHHHHHHHhcCcceEecC-CCc--------eeeccCCcccccccccCCCCCCc-c---ceeeeeecccccCcc
Confidence            345678887663   355555553 222        379999987 4322339999988 3   666666666776443


No 174
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=58.66  E-value=7.7  Score=29.03  Aligned_cols=22  Identities=14%  Similarity=0.246  Sum_probs=14.5

Q ss_pred             cccCccccccCCCCCeeeEEEEEe
Q 033276           80 SPFPLVICIKSNHEIRISPVFMLI  103 (123)
Q Consensus        80 ~~~~~~fCp~CG~~~tl~rV~~~~  103 (123)
                      ++.....||+||.+  +.-+.++-
T Consensus        45 ie~G~t~CP~Cg~~--~e~~fvva   66 (115)
T COG1885          45 IEVGSTSCPKCGEP--FESAFVVA   66 (115)
T ss_pred             EecccccCCCCCCc--cceeEEEe
Confidence            35556779999998  34444443


No 175
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=58.45  E-value=5.7  Score=32.68  Aligned_cols=60  Identities=18%  Similarity=0.186  Sum_probs=32.1

Q ss_pred             eEEecccHHHHHHHHHhCce-eeCCCCCcceeeeEEeeccccCCccc-c------cCcc----ccccCCCCCeeeEEEEE
Q 033276           35 VACITGDYAMQNVILQMGLR-LLAPGGMQIRQLHRYIVDKCLKLFSS-P------FPLV----ICIKSNHEIRISPVFML  102 (123)
Q Consensus        35 va~vTdDyAmQNVllqlGL~-l~sv~g~~I~~v~~wvl~rC~gC~k~-~------~~~~----fCp~CG~~~tl~rV~~~  102 (123)
                      ..++|.  -+.|.-.+.|.+ ++.++|.      -+.. +|..|+.. +      ....    -||.||.+ .+|+=-|.
T Consensus        94 ~~iiTQ--NiD~Lhe~AGs~~Vi~lHGs------l~~~-~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~-~lrP~VV~  163 (250)
T COG0846          94 LRIITQ--NIDGLHERAGSKNVIELHGS------LKRV-RCSKCGNQYYDEDVIKFIEDGLIPRCPKCGGP-VLRPDVVW  163 (250)
T ss_pred             eEEEec--ccchHHHHcCCCcEEEeccc------eeee-EeCCCcCccchhhhhhhcccCCCCcCccCCCc-cccCCEEE
Confidence            456663  123445555543 3444542      4556 99999765 2      1112    39999996 34443333


Q ss_pred             ee
Q 033276          103 IL  104 (123)
Q Consensus       103 ~~  104 (123)
                      -|
T Consensus       164 fG  165 (250)
T COG0846         164 FG  165 (250)
T ss_pred             eC
Confidence            33


No 176
>PF08394 Arc_trans_TRASH:  Archaeal TRASH domain;  InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators. It is thought to function as a metal-sensing regulatory module []. 
Probab=58.10  E-value=10  Score=23.10  Aligned_cols=23  Identities=26%  Similarity=0.306  Sum_probs=18.8

Q ss_pred             cccCCCCCeeeEEEEEeeEEEEE
Q 033276           87 CIKSNHEIRISPVFMLILICLYI  109 (123)
Q Consensus        87 Cp~CG~~~tl~rV~~~~~~~~~~  109 (123)
                      |..||++++=....+.+++-+|.
T Consensus         1 Cd~CG~~I~~eP~~~k~~~~~y~   23 (37)
T PF08394_consen    1 CDYCGGEITGEPIVVKIGNKVYY   23 (37)
T ss_pred             CCccCCcccCCEEEEEECCeEEE
Confidence            78899998888888888877764


No 177
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. This enzyme is responsible for two methylations of a characteristic guanine of most tRNA molecules. The activity has been demonstrated for eukaryotic and archaeal proteins, which are active when expressed in E. coli, a species that lacks this enzyme. At least one Eubacterium, Aquifex aeolicus, has an ortholog, as do all completed archaeal genomes.
Probab=57.94  E-value=8.5  Score=33.10  Aligned_cols=26  Identities=19%  Similarity=0.359  Sum_probs=19.7

Q ss_pred             EEeeccccCCccc-c-----cCccccccCCCCC
Q 033276           68 RYIVDKCLKLFSS-P-----FPLVICIKSNHEI   94 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~-----~~~~fCp~CG~~~   94 (123)
                      -|++ .|+.|+.. .     .....||.||.+.
T Consensus       231 g~v~-~C~~c~~~~~~~~~~~~~~~C~~c~~~~  262 (374)
T TIGR00308       231 GYTY-HCSRCLHNKPVNGISQRKGRCKECGGEY  262 (374)
T ss_pred             eeEE-ECCCcccccccccccCCCCCCCCCCCcc
Confidence            5788 99999865 2     2346899999873


No 178
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=57.76  E-value=4.6  Score=35.97  Aligned_cols=29  Identities=14%  Similarity=0.230  Sum_probs=22.7

Q ss_pred             EEeeccccCCccc-cc-CccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLFSS-PF-PLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~~-~~~fCp~CG~~~tl~r   98 (123)
                      .|+.  |+.|... +. .+..||.||+++-.+|
T Consensus       219 ~~~~--C~~C~~~~~~~~~~~CpRC~~~Ly~rr  249 (418)
T COG2995         219 GLRS--CLCCHYILPHDAEPRCPRCGSKLYVRR  249 (418)
T ss_pred             ccee--cccccccCCHhhCCCCCCCCChhhccC
Confidence            5555  9999988 43 5788999999976555


No 179
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=57.73  E-value=6.4  Score=23.86  Aligned_cols=15  Identities=13%  Similarity=0.237  Sum_probs=11.2

Q ss_pred             CccccccCCCCCeee
Q 033276           83 PLVICIKSNHEIRIS   97 (123)
Q Consensus        83 ~~~fCp~CG~~~tl~   97 (123)
                      .+.+|+.||++.+.+
T Consensus         4 g~l~C~~CG~~m~~~   18 (58)
T PF13408_consen    4 GLLRCGHCGSKMTRR   18 (58)
T ss_pred             CcEEcccCCcEeEEE
Confidence            457899999995543


No 180
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=57.66  E-value=6  Score=25.98  Aligned_cols=21  Identities=19%  Similarity=0.415  Sum_probs=13.5

Q ss_pred             cccCCccc------ccCccccccCCCC
Q 033276           73 KCLKLFSS------PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~------~~~~~fCp~CG~~   93 (123)
                      +|++|+++      ......|..||..
T Consensus         9 kCp~C~~~q~vFSha~t~V~C~~Cg~~   35 (55)
T PF01667_consen    9 KCPGCYNIQTVFSHAQTVVKCVVCGTV   35 (55)
T ss_dssp             E-TTT-SEEEEETT-SS-EE-SSSTSE
T ss_pred             ECCCCCCeeEEEecCCeEEEcccCCCE
Confidence            89999986      2456899999986


No 181
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=57.64  E-value=4.6  Score=40.01  Aligned_cols=30  Identities=10%  Similarity=0.020  Sum_probs=21.8

Q ss_pred             ceeeeEEeeccccCCccc-ccCccccccCCCC
Q 033276           63 IRQLHRYIVDKCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        63 I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      ..-+..=+. ||..|+.. .....+||.||++
T Consensus       687 ~vPvY~tIK-rC~dcg~q~~~~~~~cP~Cgs~  717 (1187)
T COG1110         687 YVPVYDTIK-RCRDCGEQFVDSEDKCPRCGSR  717 (1187)
T ss_pred             eEehHHHHH-HHhhcCceeccccccCCCCCCc
Confidence            334444567 99999998 3335699999996


No 182
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=57.28  E-value=7.5  Score=27.86  Aligned_cols=20  Identities=15%  Similarity=0.090  Sum_probs=14.8

Q ss_pred             CccccccCCCCCeeeEEEEEe
Q 033276           83 PLVICIKSNHEIRISPVFMLI  103 (123)
Q Consensus        83 ~~~fCp~CG~~~tl~rV~~~~  103 (123)
                      .+.+||.||.. .++|+++-|
T Consensus        34 ~ky~Cp~Cgk~-~vkR~a~GI   53 (90)
T PF01780_consen   34 AKYTCPFCGKT-SVKRVATGI   53 (90)
T ss_dssp             S-BEESSSSSS-EEEEEETTE
T ss_pred             CCCcCCCCCCc-eeEEeeeEE
Confidence            35789999999 788887533


No 183
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=57.20  E-value=6.6  Score=34.44  Aligned_cols=29  Identities=14%  Similarity=-0.011  Sum_probs=24.2

Q ss_pred             EeeccccCCccc-ccCccccccCCCCCeeeE
Q 033276           69 YIVDKCLKLFSS-PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        69 wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~r   98 (123)
                      -.| +|..|+.. +...-.||.||+=.|+..
T Consensus         6 ~~y-~C~~Cg~~~~~~~g~Cp~C~~w~t~~~   35 (454)
T TIGR00416         6 SKF-VCQHCGADSPKWQGKCPACHAWNTITE   35 (454)
T ss_pred             CeE-ECCcCCCCCccccEECcCCCCccccch
Confidence            468 99999988 767788999998777776


No 184
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=56.81  E-value=6.3  Score=25.45  Aligned_cols=24  Identities=17%  Similarity=0.458  Sum_probs=19.7

Q ss_pred             cccCCccc-ccCccccccCCCCCeee
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl~   97 (123)
                      .|.-|+.. +..-.-|-+||+. .|+
T Consensus        16 ICrkC~ARnp~~A~~CRKCg~~-~LR   40 (48)
T PRK04136         16 ICMRCNARNPWRATKCRKCGYK-NLR   40 (48)
T ss_pred             chhcccCCCCccccccccCCCC-CcC
Confidence            89999987 6666889999987 565


No 185
>PHA00626 hypothetical protein
Probab=56.70  E-value=8.1  Score=25.92  Aligned_cols=8  Identities=25%  Similarity=0.410  Sum_probs=5.4

Q ss_pred             ccccCCCC
Q 033276           86 ICIKSNHE   93 (123)
Q Consensus        86 fCp~CG~~   93 (123)
                      .||.||+.
T Consensus         2 ~CP~CGS~    9 (59)
T PHA00626          2 SCPKCGSG    9 (59)
T ss_pred             CCCCCCCc
Confidence            47777775


No 186
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=56.59  E-value=5.6  Score=34.77  Aligned_cols=24  Identities=8%  Similarity=0.121  Sum_probs=18.0

Q ss_pred             cccCCccc-c------cCccccccCCCCCee
Q 033276           73 KCLKLFSS-P------FPLVICIKSNHEIRI   96 (123)
Q Consensus        73 rC~gC~k~-~------~~~~fCp~CG~~~tl   96 (123)
                      .|+.|... .      ..+-.||.||+++..
T Consensus        12 ~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~   42 (419)
T PRK15103         12 LCPQCDMLVALPRLEHGQKAACPRCGTTLTV   42 (419)
T ss_pred             cCCCCCceeecCCCCCCCeeECCCCCCCCcC
Confidence            79999976 2      125679999999643


No 187
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=56.49  E-value=5.4  Score=32.45  Aligned_cols=21  Identities=10%  Similarity=0.078  Sum_probs=14.0

Q ss_pred             cccCCccc-c--cC--ccccccCCCC
Q 033276           73 KCLKLFSS-P--FP--LVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~--~~--~~fCp~CG~~   93 (123)
                      .|+.|+.. .  ..  +..||.||..
T Consensus       101 fC~~CG~~~~~~~~~~~~~C~~c~~~  126 (256)
T PRK00241        101 FCGYCGHPMHPSKTEWAMLCPHCRER  126 (256)
T ss_pred             cccccCCCCeecCCceeEECCCCCCE
Confidence            58888876 2  22  4568888865


No 188
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=56.35  E-value=8.1  Score=27.82  Aligned_cols=17  Identities=6%  Similarity=0.157  Sum_probs=9.4

Q ss_pred             ccccccCCCCCeeeEEEE
Q 033276           84 LVICIKSNHEIRISPVFM  101 (123)
Q Consensus        84 ~~fCp~CG~~~tl~rV~~  101 (123)
                      +..||.||.+ +++|++.
T Consensus        35 ~~~Cp~C~~~-~VkR~a~   51 (89)
T COG1997          35 KHVCPFCGRT-TVKRIAT   51 (89)
T ss_pred             CCcCCCCCCc-ceeeecc
Confidence            3456666666 5555553


No 189
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=56.32  E-value=7.2  Score=34.32  Aligned_cols=23  Identities=9%  Similarity=0.063  Sum_probs=17.3

Q ss_pred             eeccccCCccc-ccCc-------------------cccccCCCC
Q 033276           70 IVDKCLKLFSS-PFPL-------------------VICIKSNHE   93 (123)
Q Consensus        70 vl~rC~gC~k~-~~~~-------------------~fCp~CG~~   93 (123)
                      ++ +|..|+.+ ++..                   -.||.||.+
T Consensus       425 ~~-~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        425 RM-QCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             eE-EECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCCc
Confidence            46 89999987 5432                   269999976


No 190
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional
Probab=56.05  E-value=9.4  Score=32.79  Aligned_cols=26  Identities=19%  Similarity=0.363  Sum_probs=19.7

Q ss_pred             EEeeccccCCccc---c-cCccccccCCCCC
Q 033276           68 RYIVDKCLKLFSS---P-FPLVICIKSNHEI   94 (123)
Q Consensus        68 ~wvl~rC~gC~k~---~-~~~~fCp~CG~~~   94 (123)
                      -|++ +|+.|+..   . .....||.||++.
T Consensus       242 g~~~-~C~~c~~~~~~~~~~~~~C~~c~~~~  271 (382)
T PRK04338        242 GYVY-YCPKCLYREEVEGLPPEECPVCGGKF  271 (382)
T ss_pred             eeEE-ECCCCCcEEEecCCCCCCCCCCCCcc
Confidence            5788 99999975   1 2346799999873


No 191
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=55.43  E-value=6.6  Score=29.19  Aligned_cols=22  Identities=27%  Similarity=0.209  Sum_probs=17.7

Q ss_pred             cccCCccc----ccCccccccCCCCC
Q 033276           73 KCLKLFSS----PFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~~   94 (123)
                      .|+.|...    +.....||.||++=
T Consensus         4 ~CP~C~seytY~dg~~~iCpeC~~EW   29 (109)
T TIGR00686         4 PCPKCNSEYTYHDGTQLICPSCLYEW   29 (109)
T ss_pred             cCCcCCCcceEecCCeeECccccccc
Confidence            68999865    56678999999983


No 192
>PRK08197 threonine synthase; Validated
Probab=55.25  E-value=9.2  Score=32.42  Aligned_cols=24  Identities=17%  Similarity=0.254  Sum_probs=17.7

Q ss_pred             eeccccCCccc-cc--CccccccCCCCCe
Q 033276           70 IVDKCLKLFSS-PF--PLVICIKSNHEIR   95 (123)
Q Consensus        70 vl~rC~gC~k~-~~--~~~fCp~CG~~~t   95 (123)
                      .+ +|..|++. +.  ....| .||.++.
T Consensus         7 ~~-~C~~Cg~~~~~~~~~~~C-~cg~~l~   33 (394)
T PRK08197          7 HL-ECSKCGETYDADQVHNLC-KCGKPLL   33 (394)
T ss_pred             EE-EECCCCCCCCCCCcceec-CCCCeeE
Confidence            58 99999998 32  23569 8998843


No 193
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional
Probab=54.90  E-value=5.9  Score=38.05  Aligned_cols=23  Identities=17%  Similarity=0.313  Sum_probs=19.2

Q ss_pred             eeccccCCccc----ccCccccccCCCC
Q 033276           70 IVDKCLKLFSS----PFPLVICIKSNHE   93 (123)
Q Consensus        70 vl~rC~gC~k~----~~~~~fCp~CG~~   93 (123)
                      -+ ||--|+++    ..+...||.||.+
T Consensus       821 ~~-~~~~~~~~~~~~~~~~~~~~~~~~~  847 (1006)
T PRK12775        821 QW-RCDDCGKVSEGFAFPYGMCPACGGK  847 (1006)
T ss_pred             ee-ehhhhccccccccCCcCcCcccccc
Confidence            46 89999987    5677899999987


No 194
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=54.75  E-value=6.2  Score=23.40  Aligned_cols=10  Identities=10%  Similarity=0.112  Sum_probs=8.4

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      ..||.||++.
T Consensus         3 ~~Cp~Cg~~~   12 (47)
T PF14690_consen    3 PRCPHCGSPS   12 (47)
T ss_pred             ccCCCcCCCc
Confidence            5799999994


No 195
>COG0384 Predicted epimerase, PhzC/PhzF homolog [General function prediction only]
Probab=54.54  E-value=9.4  Score=32.07  Aligned_cols=49  Identities=14%  Similarity=-0.027  Sum_probs=27.7

Q ss_pred             ccHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCcccccCccccccCCCCCeee
Q 033276           40 GDYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSSPFPLVICIKSNHEIRIS   97 (123)
Q Consensus        40 dDyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~~tl~   97 (123)
                      +|-.||+++.++|+.--.---+.=.. ..|++ |      +.++...=|-|||+ |+=
T Consensus        32 sd~~MQ~IA~e~n~SET~Fv~~~~~~-~~~rl-R------~FTP~~Evpf~GHa-Tlg   80 (291)
T COG0384          32 SDEQMQAIAREFNLSETAFVLPPDDP-ADARL-R------IFTPTTEVPFAGHA-TLG   80 (291)
T ss_pred             CHHHHHHHHHHhCCceeEEEcCCCCc-CceEE-E------EeCCCcccccCCCH-HHH
Confidence            78999999999999643311000011 34555 2      21222334559999 543


No 196
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=54.26  E-value=5.2  Score=29.61  Aligned_cols=20  Identities=15%  Similarity=0.170  Sum_probs=10.6

Q ss_pred             ccCCccc-ccCccccccCCCC
Q 033276           74 CLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        74 C~gC~k~-~~~~~fCp~CG~~   93 (123)
                      |+.|+.. ..++..||.||..
T Consensus         1 CPvCg~~l~vt~l~C~~C~t~   21 (113)
T PF09862_consen    1 CPVCGGELVVTRLKCPSCGTE   21 (113)
T ss_pred             CCCCCCceEEEEEEcCCCCCE
Confidence            5555554 4445555555544


No 197
>PRK12366 replication factor A; Reviewed
Probab=54.11  E-value=16  Score=33.48  Aligned_cols=26  Identities=12%  Similarity=0.006  Sum_probs=18.8

Q ss_pred             eEEeeccccCCccc-c--cCccccccCCCC
Q 033276           67 HRYIVDKCLKLFSS-P--FPLVICIKSNHE   93 (123)
Q Consensus        67 ~~wvl~rC~gC~k~-~--~~~~fCp~CG~~   93 (123)
                      .-|-. +|+.|.|. .  ...-.||+||..
T Consensus       529 ~~~y~-aCp~CnkKv~~~~g~~~C~~c~~~  557 (637)
T PRK12366        529 KIILY-LCPNCRKRVEEVDGEYICEFCGEV  557 (637)
T ss_pred             CEEEe-cccccCeEeEcCCCcEECCCCCCC
Confidence            34555 99999987 2  234579999975


No 198
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=53.60  E-value=10  Score=22.36  Aligned_cols=21  Identities=24%  Similarity=0.268  Sum_probs=15.3

Q ss_pred             cccCCccc---c-------cCccccccCCCC
Q 033276           73 KCLKLFSS---P-------FPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~---~-------~~~~fCp~CG~~   93 (123)
                      +|+.|.+.   +       ..+.-|++||+.
T Consensus         4 ~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~   34 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKIPPKGRKVRCSKCGHV   34 (36)
T ss_pred             ECCCCCCEEeCCHHHCCCCCcEEECCCCCCE
Confidence            78889875   1       125789999975


No 199
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=53.50  E-value=7.9  Score=29.50  Aligned_cols=26  Identities=19%  Similarity=0.262  Sum_probs=18.7

Q ss_pred             cCccccccCCCCCeeeEEEEEeeEEEEEeeCCccceeecc
Q 033276           82 FPLVICIKSNHEIRISPVFMLILICLYIQVDTEMPCLLHY  121 (123)
Q Consensus        82 ~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~~~~~~~~~  121 (123)
                      |.-.-||.||.|+              .+-||++=|-.|-
T Consensus        26 ML~~hCp~Cg~PL--------------F~KdG~v~CPvC~   51 (131)
T COG1645          26 MLAKHCPKCGTPL--------------FRKDGEVFCPVCG   51 (131)
T ss_pred             HHHhhCcccCCcc--------------eeeCCeEECCCCC
Confidence            3446799999994              3478888776553


No 200
>PRK00504 rpmG 50S ribosomal protein L33; Validated
Probab=52.83  E-value=7.9  Score=24.81  Aligned_cols=29  Identities=14%  Similarity=0.229  Sum_probs=20.5

Q ss_pred             EEeeccccCCccc------c--------cCccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLFSS------P--------FPLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~k~------~--------~~~~fCp~CG~~~tl~r   98 (123)
                      .-.+ .|..|...      .        .-+.|||.|+.. |+.+
T Consensus         5 ~i~L-~C~~c~~rnY~t~KNk~~~~~rLelkKycp~c~kh-tlhk   47 (50)
T PRK00504          5 KITL-ACTECKSRNYTTTKNKKNTPERLELKKFCPRCNKH-TLHK   47 (50)
T ss_pred             EEEE-EEcCCCCccEeEcCCCCCCCceEEEECcCCCCCCe-Eeee
Confidence            3457 89998853      0        116899999999 7754


No 201
>PLN00209 ribosomal protein S27; Provisional
Probab=52.77  E-value=11  Score=27.03  Aligned_cols=25  Identities=20%  Similarity=0.405  Sum_probs=19.0

Q ss_pred             EeeccccCCccc------ccCccccccCCCC
Q 033276           69 YIVDKCLKLFSS------PFPLVICIKSNHE   93 (123)
Q Consensus        69 wvl~rC~gC~k~------~~~~~fCp~CG~~   93 (123)
                      |..-+|++|+++      ......|..||..
T Consensus        34 Fm~VkCp~C~n~q~VFShA~t~V~C~~Cg~~   64 (86)
T PLN00209         34 FMDVKCQGCFNITTVFSHSQTVVVCGSCQTV   64 (86)
T ss_pred             EEEEECCCCCCeeEEEecCceEEEccccCCE
Confidence            333489999987      2456899999986


No 202
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=52.31  E-value=8.2  Score=21.39  Aligned_cols=21  Identities=19%  Similarity=0.293  Sum_probs=14.9

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|..|... ......|-.||.+
T Consensus         6 ~C~~C~~~N~~~~~~C~~C~~~   27 (30)
T PF00641_consen    6 KCPSCTFMNPASRSKCVACGAP   27 (30)
T ss_dssp             EETTTTEEEESSSSB-TTT--B
T ss_pred             cCCCCcCCchHHhhhhhCcCCC
Confidence            68999987 6677889999976


No 203
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=51.99  E-value=8.5  Score=26.63  Aligned_cols=23  Identities=22%  Similarity=0.150  Sum_probs=17.4

Q ss_pred             cccCCccc---ccCccccccCCCCCe
Q 033276           73 KCLKLFSS---PFPLVICIKSNHEIR   95 (123)
Q Consensus        73 rC~gC~k~---~~~~~fCp~CG~~~t   95 (123)
                      .|+-|+..   ......||.||+...
T Consensus         2 fC~~Cg~~l~~~~~~~~C~~C~~~~~   27 (104)
T TIGR01384         2 FCPKCGSLMTPKNGVYVCPSCGYEKE   27 (104)
T ss_pred             CCcccCcccccCCCeEECcCCCCccc
Confidence            58999987   235788999997633


No 204
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=51.96  E-value=5  Score=31.43  Aligned_cols=35  Identities=9%  Similarity=-0.064  Sum_probs=22.6

Q ss_pred             EeeccccCCccc-cc-----------CccccccCCCCCeeeEEEEEeeEE
Q 033276           69 YIVDKCLKLFSS-PF-----------PLVICIKSNHEIRISPVFMLILIC  106 (123)
Q Consensus        69 wvl~rC~gC~k~-~~-----------~~~fCp~CG~~~tl~rV~~~~~~~  106 (123)
                      +.. +|..|.+. +.           ....||.||+.  +|.--|..|+.
T Consensus        94 ~~~-~C~~C~~~~~~~~~~~~~~~~~~~p~C~~Cgg~--lrP~VV~FgE~  140 (206)
T cd01410          94 FIE-VCKSCGPEYVRDDVVETRGDKETGRRCHACGGI--LKDTIVDFGER  140 (206)
T ss_pred             Ccc-cCCCCCCccchHHHHHHhhcCCCCCcCCCCcCc--cCCcEEECCCC
Confidence            456 99999976 21           12359999987  55555555553


No 205
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=51.37  E-value=7.6  Score=29.49  Aligned_cols=24  Identities=8%  Similarity=0.173  Sum_probs=17.1

Q ss_pred             eeccccCCccc-c-----cCccccccCCCCC
Q 033276           70 IVDKCLKLFSS-P-----FPLVICIKSNHEI   94 (123)
Q Consensus        70 vl~rC~gC~k~-~-----~~~~fCp~CG~~~   94 (123)
                      -| .|+.|++. .     ...-.||.||+.+
T Consensus       109 ~Y-~Cp~c~~r~tf~eA~~~~F~Cp~Cg~~L  138 (158)
T TIGR00373       109 FF-ICPNMCVRFTFNEAMELNFTCPRCGAML  138 (158)
T ss_pred             eE-ECCCCCcEeeHHHHHHcCCcCCCCCCEe
Confidence            46 89999965 1     2235599999983


No 206
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=50.93  E-value=8.1  Score=26.59  Aligned_cols=16  Identities=13%  Similarity=0.148  Sum_probs=9.7

Q ss_pred             cccCCCCC-eeeEEEEE
Q 033276           87 CIKSNHEI-RISPVFML  102 (123)
Q Consensus        87 Cp~CG~~~-tl~rV~~~  102 (123)
                      ||+||+.- -.+-++.+
T Consensus         7 CpKCgn~~~~ekei~~t   23 (68)
T COG3478           7 CPKCGNTNYEEKEIAAT   23 (68)
T ss_pred             CCCcCCcchhhceeecc
Confidence            99999752 23344444


No 207
>COG5270 PUA domain (predicted RNA-binding domain) [Translation, ribosomal structure and biogenesis]
Probab=50.28  E-value=12  Score=30.38  Aligned_cols=30  Identities=13%  Similarity=-0.025  Sum_probs=22.4

Q ss_pred             eEEeeccccCCcccccCccccccCCCCCeeeE
Q 033276           67 HRYIVDKCLKLFSSPFPLVICIKSNHEIRISP   98 (123)
Q Consensus        67 ~~wvl~rC~gC~k~~~~~~fCp~CG~~~tl~r   98 (123)
                      +-|+| .|..|.=+ .....|+.||+.++.-|
T Consensus        11 k~~iy-WCe~cNlP-l~~~~c~~cg~~~~~l~   40 (202)
T COG5270          11 KFPIY-WCEKCNLP-LLGRRCSVCGSKVEELR   40 (202)
T ss_pred             cccee-ehhhCCCc-cccccccccCCcceEEE
Confidence            57999 99999844 44577999998754433


No 208
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=49.97  E-value=13  Score=24.59  Aligned_cols=21  Identities=19%  Similarity=0.338  Sum_probs=16.1

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      .|..|++...+...|+.||.-
T Consensus        29 ~c~~cG~~~l~Hrvc~~cg~Y   49 (57)
T COG0333          29 VCPNCGEYKLPHRVCLKCGYY   49 (57)
T ss_pred             eccCCCCcccCceEcCCCCCc
Confidence            788888776666788888865


No 209
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=49.73  E-value=12  Score=22.70  Aligned_cols=10  Identities=10%  Similarity=0.285  Sum_probs=7.8

Q ss_pred             ccccccCCCC
Q 033276           84 LVICIKSNHE   93 (123)
Q Consensus        84 ~~fCp~CG~~   93 (123)
                      ...||+||+.
T Consensus        18 g~~CP~Cg~~   27 (46)
T PF12760_consen   18 GFVCPHCGST   27 (46)
T ss_pred             CCCCCCCCCe
Confidence            3569999986


No 210
>PRK14715 DNA polymerase II large subunit; Provisional
Probab=49.58  E-value=14  Score=37.81  Aligned_cols=31  Identities=13%  Similarity=0.161  Sum_probs=23.3

Q ss_pred             eeeEEeeccccCCcccccCccccccCCCCCeee
Q 033276           65 QLHRYIVDKCLKLFSSPFPLVICIKSNHEIRIS   97 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~~~~~~fCp~CG~~~tl~   97 (123)
                      ++.--.. +|+.|++. .....||.||.++-+.
T Consensus       669 ~vei~~~-~Cp~Cg~~-~~~~~Cp~CG~~~~~~  699 (1627)
T PRK14715        669 DIEIAFF-KCPKCGKV-GLYHVCPFCGTRVELK  699 (1627)
T ss_pred             eEEEEee-eCCCCCCc-cccccCcccCCcccCC
Confidence            6667778 99999998 2346699999884333


No 211
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=49.54  E-value=26  Score=20.23  Aligned_cols=13  Identities=23%  Similarity=0.652  Sum_probs=7.8

Q ss_pred             ccCccccccCCCC
Q 033276           81 PFPLVICIKSNHE   93 (123)
Q Consensus        81 ~~~~~fCp~CG~~   93 (123)
                      +.+..+|+.||..
T Consensus        29 ~vp~~~C~~CGE~   41 (46)
T TIGR03831        29 NVPALVCPQCGEE   41 (46)
T ss_pred             CCCccccccCCCE
Confidence            4455666666655


No 212
>PRK13764 ATPase; Provisional
Probab=49.51  E-value=15  Score=33.84  Aligned_cols=30  Identities=17%  Similarity=0.131  Sum_probs=27.1

Q ss_pred             CceeEEecccHHHHHHHHHhCceeeCCCCC
Q 033276           32 ESTVACITGDYAMQNVILQMGLRLLAPGGM   61 (123)
Q Consensus        32 ~~~va~vTdDyAmQNVllqlGL~l~sv~g~   61 (123)
                      +..+.++|.|+.+..+|+..||+++.+..+
T Consensus       101 ~~~~~lvT~D~~l~~~A~~~GI~V~~l~~~  130 (602)
T PRK13764        101 ELGATLVTSDRVQAEVARAKGIDVIYLKPE  130 (602)
T ss_pred             HcCCEEEeCCHHHHHHHHHcCCEEEEeCCC
Confidence            457899999999999999999999998764


No 213
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=49.36  E-value=7.3  Score=25.13  Aligned_cols=11  Identities=18%  Similarity=0.171  Sum_probs=3.9

Q ss_pred             EeeccccCCccc
Q 033276           69 YIVDKCLKLFSS   80 (123)
Q Consensus        69 wvl~rC~gC~k~   80 (123)
                      -+| +|+.|...
T Consensus        20 ~~y-~C~~C~~~   30 (51)
T PF07975_consen   20 SRY-RCPKCKNH   30 (51)
T ss_dssp             EEE---TTTT--
T ss_pred             CeE-ECCCCCCc
Confidence            445 66666553


No 214
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=48.45  E-value=17  Score=27.95  Aligned_cols=27  Identities=22%  Similarity=0.322  Sum_probs=18.0

Q ss_pred             cccccCCCC-CeeeEEEEEeeEEEEEeeCC
Q 033276           85 VICIKSNHE-IRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        85 ~fCp~CG~~-~tl~rV~~~~~~~~~~~~~~  113 (123)
                      .-||.||.. +|+.++.-.+-  .-||-||
T Consensus        29 ~~c~~c~~~f~~~e~~~~~~i--~VIKRDG   56 (154)
T PRK00464         29 RECLACGKRFTTFERVELVPL--LVIKKDG   56 (154)
T ss_pred             eeccccCCcceEeEeccCccc--EEEecCC
Confidence            568888843 46666665552  4688888


No 215
>PRK05638 threonine synthase; Validated
Probab=48.39  E-value=12  Score=32.31  Aligned_cols=26  Identities=19%  Similarity=0.255  Sum_probs=18.2

Q ss_pred             eeccccCCccc-c-cCccccccCCCCCeee
Q 033276           70 IVDKCLKLFSS-P-FPLVICIKSNHEIRIS   97 (123)
Q Consensus        70 vl~rC~gC~k~-~-~~~~fCp~CG~~~tl~   97 (123)
                      ++ +|..|++. + .....| .||+++.+.
T Consensus         1 ~l-~C~~Cg~~~~~~~~~~C-~c~~~l~~~   28 (442)
T PRK05638          1 KM-KCPKCGREYNSYIPPFC-ICGELLEII   28 (442)
T ss_pred             Ce-EeCCCCCCCCCCCceec-CCCCcEEEE
Confidence            36 89999988 3 233679 899875443


No 216
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=48.15  E-value=9.4  Score=22.70  Aligned_cols=21  Identities=19%  Similarity=0.227  Sum_probs=15.7

Q ss_pred             cccCCccc----ccCccccccCCCC
Q 033276           73 KCLKLFSS----PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~   93 (123)
                      +|.-|...    +..+.+|..||+.
T Consensus        10 ~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen   10 PCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             cCCCCCCeEeEccCCEEEhhhCceE
Confidence            58888875    4557888888875


No 217
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=48.07  E-value=9.8  Score=25.16  Aligned_cols=29  Identities=7%  Similarity=0.040  Sum_probs=20.8

Q ss_pred             EEeeccccCCccc--ccCccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLFSS--PFPLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~k~--~~~~~fCp~CG~~~tl~r   98 (123)
                      ...+  |.-|++.  ..-+..|..||.+...+|
T Consensus        14 tH~~--CrRCG~~syH~qK~~CasCGyp~~kkr   44 (55)
T PF01907_consen   14 THTL--CRRCGRRSYHIQKKTCASCGYPAAKKR   44 (55)
T ss_dssp             SEEE---TTTSSEEEETTTTEETTTBTTTSSS-
T ss_pred             cEee--ecccCCeeeecCCCcccccCCCccccc
Confidence            4554  9999987  677899999998854443


No 218
>PF00471 Ribosomal_L33:  Ribosomal protein L33;  InterPro: IPR001705 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L33 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L33 has been shown to be on the surface of 50S subunit. L33 belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, , ], groups:  Eubacterial L33. Algal and plant chloroplast L33. Cyanelle L33.   L33 is a small protein of 49 to 66 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3PIO_1 3PIP_1 3PYT_3 3MS1_3 3F1F_6 3F1H_6 3MRZ_3 3PYO_3 3D5B_6 3D5D_6 ....
Probab=48.04  E-value=10  Score=24.00  Aligned_cols=14  Identities=7%  Similarity=0.247  Sum_probs=11.4

Q ss_pred             ccccccCCCCCeeeE
Q 033276           84 LVICIKSNHEIRISP   98 (123)
Q Consensus        84 ~~fCp~CG~~~tl~r   98 (123)
                      +.|||.|+.. |+.+
T Consensus        32 kKycp~~~kh-tlhk   45 (48)
T PF00471_consen   32 KKYCPRCRKH-TLHK   45 (48)
T ss_dssp             EEEETSSSSE-EEEE
T ss_pred             eccCCCCCCE-ecEE
Confidence            6899999999 6653


No 219
>PRK10220 hypothetical protein; Provisional
Probab=47.73  E-value=11  Score=28.11  Aligned_cols=22  Identities=32%  Similarity=0.437  Sum_probs=17.6

Q ss_pred             cccCCccc----ccCccccccCCCCC
Q 033276           73 KCLKLFSS----PFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~~   94 (123)
                      .|+.|...    +.....||.||++=
T Consensus         5 ~CP~C~seytY~d~~~~vCpeC~hEW   30 (111)
T PRK10220          5 HCPKCNSEYTYEDNGMYICPECAHEW   30 (111)
T ss_pred             cCCCCCCcceEcCCCeEECCcccCcC
Confidence            68888864    56678999999873


No 220
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=47.70  E-value=8.1  Score=30.63  Aligned_cols=14  Identities=7%  Similarity=0.176  Sum_probs=11.2

Q ss_pred             ccCccccccCCCCC
Q 033276           81 PFPLVICIKSNHEI   94 (123)
Q Consensus        81 ~~~~~fCp~CG~~~   94 (123)
                      ...+.|||.||+++
T Consensus        86 ~~~R~FC~~CGS~L   99 (182)
T TIGR02820        86 TIQRHACKGCGTHM   99 (182)
T ss_pred             CEEeecCCCCCCcc
Confidence            34578999999994


No 221
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=47.29  E-value=8  Score=28.15  Aligned_cols=11  Identities=18%  Similarity=0.431  Sum_probs=8.5

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      ..|||.||+-+
T Consensus         2 m~FCp~Cgsll   12 (113)
T COG1594           2 MRFCPKCGSLL   12 (113)
T ss_pred             ccccCCccCee
Confidence            36899999873


No 222
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=47.19  E-value=8.9  Score=28.33  Aligned_cols=12  Identities=8%  Similarity=0.418  Sum_probs=9.4

Q ss_pred             cccccCCCCCee
Q 033276           85 VICIKSNHEIRI   96 (123)
Q Consensus        85 ~fCp~CG~~~tl   96 (123)
                      .|||.|||-+.+
T Consensus         2 ~FCP~Cgn~Liv   13 (105)
T KOG2906|consen    2 LFCPTCGNMLIV   13 (105)
T ss_pred             cccCCCCCEEEE
Confidence            699999997543


No 223
>COG1412 Uncharacterized proteins of PilT N-term./Vapc superfamily [General function prediction only]
Probab=46.82  E-value=23  Score=26.86  Aligned_cols=30  Identities=10%  Similarity=0.194  Sum_probs=26.8

Q ss_pred             eeEEecccHHHHHHHHHhCceeeCCCCCcc
Q 033276           34 TVACITGDYAMQNVILQMGLRLLAPGGMQI   63 (123)
Q Consensus        34 ~va~vTdDyAmQNVllqlGL~l~sv~g~~I   63 (123)
                      .+++.|.|-.+..-|+..|++++.+.|+..
T Consensus        99 ~~iVaTnD~eLk~rlr~~GIPvi~lr~r~~  128 (136)
T COG1412          99 RYIVATNDKELKRRLRENGIPVITLRQRKL  128 (136)
T ss_pred             CEEEEeCCHHHHHHHHHcCCCEEEEeCCeE
Confidence            589999999999999999999999986543


No 224
>PRK06386 replication factor A; Reviewed
Probab=46.42  E-value=12  Score=32.37  Aligned_cols=23  Identities=17%  Similarity=0.206  Sum_probs=18.0

Q ss_pred             EEeeccccCCccc-ccCccccccCCCC
Q 033276           68 RYIVDKCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .-.. |||.|.|. .  ..+||.||..
T Consensus       234 gli~-rCP~C~R~l~--~g~C~~HG~v  257 (358)
T PRK06386        234 RIFT-KCSVCNKIIE--DGVCKDHPDA  257 (358)
T ss_pred             EeEe-cCcCCCeEcc--CCcCCCCCCC
Confidence            3445 99999998 5  3689999954


No 225
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis]
Probab=46.31  E-value=12  Score=33.10  Aligned_cols=25  Identities=16%  Similarity=0.126  Sum_probs=19.3

Q ss_pred             EEeeccccCCccc----ccCccccccCCCC
Q 033276           68 RYIVDKCLKLFSS----PFPLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~gC~k~----~~~~~fCp~CG~~   93 (123)
                      -|++ .|..|+++    ......||.||..
T Consensus       238 g~~~-~c~~cg~~~~~~~~~~~~c~~Cg~~  266 (380)
T COG1867         238 GYIY-HCSRCGEIVGSFREVDEKCPHCGGK  266 (380)
T ss_pred             CcEE-EcccccceecccccccccCCccccc
Confidence            3668 99999744    4557889999975


No 226
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=45.86  E-value=14  Score=23.43  Aligned_cols=21  Identities=19%  Similarity=0.048  Sum_probs=13.0

Q ss_pred             cccCCcc-c---ccCccccccCCCC
Q 033276           73 KCLKLFS-S---PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k-~---~~~~~fCp~CG~~   93 (123)
                      .|+-|+. .   ...+..|++||..
T Consensus        22 fCP~Cg~~~m~~~~~r~~C~~Cgyt   46 (50)
T PRK00432         22 FCPRCGSGFMAEHLDRWHCGKCGYT   46 (50)
T ss_pred             cCcCCCcchheccCCcEECCCcCCE
Confidence            4666666 3   3456667777754


No 227
>PTZ00157 60S ribosomal protein L36a; Provisional
Probab=45.85  E-value=14  Score=26.31  Aligned_cols=17  Identities=18%  Similarity=0.161  Sum_probs=14.6

Q ss_pred             ccccccCCCCCeeeEEEE
Q 033276           84 LVICIKSNHEIRISPVFM  101 (123)
Q Consensus        84 ~~fCp~CG~~~tl~rV~~  101 (123)
                      +-|||.|+.. |..+|+-
T Consensus         9 ~tyC~~C~kH-t~HkV~q   25 (84)
T PTZ00157          9 KTYCKKCGKH-TSHKVSQ   25 (84)
T ss_pred             cccCcCCCCC-ccEEEEE
Confidence            5799999999 8888873


No 228
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=45.73  E-value=11  Score=32.65  Aligned_cols=22  Identities=14%  Similarity=0.202  Sum_probs=16.8

Q ss_pred             cccCCccc---c----cCccccccCCCCC
Q 033276           73 KCLKLFSS---P----FPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~---~----~~~~fCp~CG~~~   94 (123)
                      +|+.|...   +    ..+-.||.||+++
T Consensus        15 ~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L   43 (403)
T TIGR00155        15 LCSQCDMLVALPRIESGQKAACPRCGTTL   43 (403)
T ss_pred             eCCCCCCcccccCCCCCCeeECCCCCCCC
Confidence            79999975   1    2245799999995


No 229
>KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis]
Probab=45.73  E-value=13  Score=26.55  Aligned_cols=25  Identities=20%  Similarity=0.384  Sum_probs=18.4

Q ss_pred             EeeccccCCccc------ccCccccccCCCC
Q 033276           69 YIVDKCLKLFSS------PFPLVICIKSNHE   93 (123)
Q Consensus        69 wvl~rC~gC~k~------~~~~~fCp~CG~~   93 (123)
                      |+.-+|+||+++      -..-..|+.|+.-
T Consensus        32 Fm~VkC~gc~~iT~vfSHaqtvVvc~~c~~i   62 (84)
T KOG1779|consen   32 FMDVKCPGCFKITTVFSHAQTVVVCEGCSTI   62 (84)
T ss_pred             EEEEEcCCceEEEEEeecCceEEEcCCCceE
Confidence            333489999997      2446889999865


No 230
>PRK00595 rpmG 50S ribosomal protein L33; Validated
Probab=45.62  E-value=12  Score=24.02  Aligned_cols=29  Identities=0%  Similarity=-0.266  Sum_probs=20.4

Q ss_pred             EEeeccccCCccc------c--------cCccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLFSS------P--------FPLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~k~------~--------~~~~fCp~CG~~~tl~r   98 (123)
                      .-.+ .|.+|...      .        .-+.|||.|+.. |+.+
T Consensus         8 ~i~L-~ct~c~~~nY~t~Kn~k~~~~rL~lkKycp~~~kh-tlhk   50 (53)
T PRK00595          8 KIKL-ESTEGTGRFYTTTKNKRNTPEKLELKKYDPVLRKH-VLHK   50 (53)
T ss_pred             EEEE-EecCCCCEEEEEccCCCCCCCceEEECcCCCCCCE-EeEE
Confidence            4567 88888743      1        116899999999 6654


No 231
>TIGR02387 rpoC1_cyan DNA-directed RNA polymerase, gamma subunit. The RNA polymerase gamma subunit, encoded by the rpoC1 gene, is found in cyanobacteria and corresponds to the N-terminal region the beta' subunit, encoded by rpoC, in other bacteria. The equivalent subunit in plastids and chloroplasts is designated beta', while the product of the rpoC2 gene is designated beta''.
Probab=45.23  E-value=7.6  Score=36.17  Aligned_cols=30  Identities=13%  Similarity=0.114  Sum_probs=22.2

Q ss_pred             eeEEeeccccCCccc---ccCccccccCCCCCeeeEE
Q 033276           66 LHRYIVDKCLKLFSS---PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        66 v~~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~rV   99 (123)
                      ++.|.-    +|++.   .....||+.||-+.|..||
T Consensus        59 ~k~~eC----~CGkyk~~~~~~~~C~~CgvE~t~s~v   91 (619)
T TIGR02387        59 SKDWEC----HCGKYKRVRHRGIVCERCGVEVTESRV   91 (619)
T ss_pred             CcCcEE----eCCCccccCcCCcCCCCCCCEEchhhh
Confidence            567776    66655   4446899999998887776


No 232
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=44.61  E-value=19  Score=22.50  Aligned_cols=8  Identities=13%  Similarity=0.140  Sum_probs=4.1

Q ss_pred             ccccCCCC
Q 033276           86 ICIKSNHE   93 (123)
Q Consensus        86 fCp~CG~~   93 (123)
                      -||-||++
T Consensus         5 PCPFCG~~   12 (61)
T PF14354_consen    5 PCPFCGSA   12 (61)
T ss_pred             CCCCCCCc
Confidence            35555544


No 233
>PRK08402 replication factor A; Reviewed
Probab=44.54  E-value=33  Score=29.60  Aligned_cols=32  Identities=16%  Similarity=0.165  Sum_probs=21.6

Q ss_pred             EeeccccCCccc-c----cCccccccCC--CCCeeeEEEE
Q 033276           69 YIVDKCLKLFSS-P----FPLVICIKSN--HEIRISPVFM  101 (123)
Q Consensus        69 wvl~rC~gC~k~-~----~~~~fCp~CG--~~~tl~rV~~  101 (123)
                      |.. +|+.|.|. .    ...-.|+.||  .+.-+.++++
T Consensus       211 ~y~-aCp~CnKkv~~~~~~~~~~Ce~~~~v~p~~ryil~~  249 (355)
T PRK08402        211 VYD-ACPECRRKVDYDPATDTWICPEHGEVEPIKITILDF  249 (355)
T ss_pred             eEe-cCCCCCeEEEEecCCCCEeCCCCCCcCcceeEEEEE
Confidence            655 99999987 3    2356899999  5533334443


No 234
>PF09567 RE_MamI:  MamI restriction endonuclease;  InterPro: IPR019067 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This entry includes the MamI restriction endonuclease which recognises and cleaves GATNN^NNATC. ; GO: 0003677 DNA binding, 0009036 Type II site-specific deoxyribonuclease activity, 0009307 DNA restriction-modification system
Probab=44.33  E-value=9.6  Score=32.59  Aligned_cols=27  Identities=15%  Similarity=0.101  Sum_probs=19.8

Q ss_pred             ccccCCccc-ccCccccccCCCCCeeeEE
Q 033276           72 DKCLKLFSS-PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        72 ~rC~gC~k~-~~~~~fCp~CG~~~tl~rV   99 (123)
                      +.|..|+.. ..-...||.||+. -++|.
T Consensus        83 ~~C~~CGa~V~~~e~~Cp~C~St-nI~r~  110 (314)
T PF09567_consen   83 GKCNNCGANVSRLEESCPNCGST-NIKRK  110 (314)
T ss_pred             hhhccccceeeehhhcCCCCCcc-ccccc
Confidence            378999987 4445789999998 55543


No 235
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=44.25  E-value=19  Score=21.73  Aligned_cols=14  Identities=29%  Similarity=0.539  Sum_probs=9.0

Q ss_pred             cccccCCCCCeeeEE
Q 033276           85 VICIKSNHEIRISPV   99 (123)
Q Consensus        85 ~fCp~CG~~~tl~rV   99 (123)
                      ..||+||-. .|..|
T Consensus         2 hlcpkcgvg-vl~pv   15 (36)
T PF09151_consen    2 HLCPKCGVG-VLEPV   15 (36)
T ss_dssp             -B-TTTSSS-BEEEE
T ss_pred             ccCCccCce-EEEEe
Confidence            469999988 55554


No 236
>cd00296 SIR2 SIR2 superfamily of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer. Also included in this superfamily is a group of uncharacterized Sir2-like proteins which lack certain key catalytic
Probab=44.18  E-value=35  Score=25.96  Aligned_cols=51  Identities=20%  Similarity=0.205  Sum_probs=32.4

Q ss_pred             eEEecccHHHHHHHHHhCce---eeCCCCCcceeeeEEeeccccCCccc-c-------cCccccccCCCCC
Q 033276           35 VACITGDYAMQNVILQMGLR---LLAPGGMQIRQLHRYIVDKCLKLFSS-P-------FPLVICIKSNHEI   94 (123)
Q Consensus        35 va~vTdDyAmQNVllqlGL~---l~sv~g~~I~~v~~wvl~rC~gC~k~-~-------~~~~fCp~CG~~~   94 (123)
                      ..++|.-  +-|...+.|.+   ++-++|.-      ... +|..|.+. +       .....||.||+.+
T Consensus        83 ~~iiTqN--iD~L~~~ag~~~~~v~~lHG~~------~~~-~C~~C~~~~~~~~~~~~~~~p~C~~C~~~l  144 (222)
T cd00296          83 KRIITQN--VDGLHERAGSRRNRVIELHGSL------DRV-RCTSCGKEYPRDEVLEREKPPRCPKCGGLL  144 (222)
T ss_pred             ceEEecC--hHHHHHHhCCCcCcEEEecCCC------Ccc-EECCCCCCcchhhhhhccCCCCCCCCCCcc
Confidence            4677753  34566677775   66677631      224 89999865 2       1345699999884


No 237
>PRK08329 threonine synthase; Validated
Probab=44.12  E-value=15  Score=30.67  Aligned_cols=25  Identities=12%  Similarity=0.230  Sum_probs=17.4

Q ss_pred             eccccCCccc-c-cCccccccCCCCCeee
Q 033276           71 VDKCLKLFSS-P-FPLVICIKSNHEIRIS   97 (123)
Q Consensus        71 l~rC~gC~k~-~-~~~~fCp~CG~~~tl~   97 (123)
                      + +|..|++. + .....| .||.++.+.
T Consensus         2 l-~C~~Cg~~~~~~~~~~C-~c~~~l~~~   28 (347)
T PRK08329          2 L-RCTKCGRTYEEKFKLRC-DCGGTLLVE   28 (347)
T ss_pred             c-CcCCCCCCcCCCCceec-CCCCcEEEE
Confidence            6 89999988 3 233579 699874333


No 238
>COG2405 Predicted nucleic acid-binding protein, contains PIN domain [General function prediction only]
Probab=44.10  E-value=18  Score=28.46  Aligned_cols=29  Identities=24%  Similarity=0.330  Sum_probs=24.9

Q ss_pred             Ccee-EEecccHHHHHHHHHhCceeeCCCC
Q 033276           32 ESTV-ACITGDYAMQNVILQMGLRLLAPGG   60 (123)
Q Consensus        32 ~~~v-a~vTdDyAmQNVllqlGL~l~sv~g   60 (123)
                      +.++ -+++||+.=.|+|..|||++.++-|
T Consensus        85 e~~ad~Ll~Ddr~aR~~A~~lgL~V~GtlG  114 (157)
T COG2405          85 ELKADLLLMDDRDARNVAKSLGLKVTGTLG  114 (157)
T ss_pred             HcCCCeeeeccHHHHHHHHHcCCeeeehhH
Confidence            3455 7899999999999999999998755


No 239
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=44.01  E-value=12  Score=24.59  Aligned_cols=19  Identities=5%  Similarity=-0.200  Sum_probs=13.3

Q ss_pred             cccCCcccccCccccccCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~   92 (123)
                      .|..|+....+...|| ||.
T Consensus        29 ~c~~cg~~~~pH~vc~-cG~   47 (60)
T PRK01110         29 VDKTTGEYHLPHHVSP-KGY   47 (60)
T ss_pred             EcCCCCceeccceecC-Ccc
Confidence            6888887745556688 883


No 240
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=43.91  E-value=26  Score=25.18  Aligned_cols=20  Identities=10%  Similarity=0.054  Sum_probs=14.6

Q ss_pred             CccccccCCCCCeeeEEEEEe
Q 033276           83 PLVICIKSNHEIRISPVFMLI  103 (123)
Q Consensus        83 ~~~fCp~CG~~~tl~rV~~~~  103 (123)
                      .+..||.||.. .++|+++-|
T Consensus        34 a~y~CpfCgk~-~vkR~a~GI   53 (91)
T TIGR00280        34 AKYVCPFCGKK-TVKRGSTGI   53 (91)
T ss_pred             cCccCCCCCCC-ceEEEeeEE
Confidence            35778888876 788887544


No 241
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=43.79  E-value=7.7  Score=37.58  Aligned_cols=27  Identities=19%  Similarity=0.342  Sum_probs=0.0

Q ss_pred             eeEEeeccccCCcccccCccccccCCCC
Q 033276           66 LHRYIVDKCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        66 v~~wvl~rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      ..+|.. +|+.|+....+..+||.||..
T Consensus       663 ~~t~~~-~Cp~CG~~T~~~~~Cp~C~~~  689 (900)
T PF03833_consen  663 KETFYN-RCPECGSHTEPVYVCPDCGIE  689 (900)
T ss_dssp             ----------------------------
T ss_pred             Ccchhh-cCcccCCccccceeccccccc
Confidence            346777 888888763334555555555


No 242
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=43.57  E-value=14  Score=23.72  Aligned_cols=26  Identities=31%  Similarity=0.416  Sum_probs=18.6

Q ss_pred             eEEeeccccCCccc----c-----cCccccccCCCC
Q 033276           67 HRYIVDKCLKLFSS----P-----FPLVICIKSNHE   93 (123)
Q Consensus        67 ~~wvl~rC~gC~k~----~-----~~~~fCp~CG~~   93 (123)
                      .++.+ .|..|+..    +     .-.-.||.||.-
T Consensus        19 ~r~aL-IC~~C~~hNGla~~~~~~~i~y~C~~Cg~~   53 (54)
T PF10058_consen   19 NRYAL-ICSKCFSHNGLAPKEEFEEIQYRCPYCGAL   53 (54)
T ss_pred             CceeE-ECcccchhhcccccccCCceEEEcCCCCCc
Confidence            37889 99999975    1     124569999863


No 243
>TIGR01023 rpmG_bact ribosomal protein L33, bacterial type. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents.
Probab=43.46  E-value=14  Score=23.90  Aligned_cols=29  Identities=7%  Similarity=-0.039  Sum_probs=20.5

Q ss_pred             EEeeccccCCccc------c--------cCccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLFSS------P--------FPLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~k~------~--------~~~~fCp~CG~~~tl~r   98 (123)
                      .-.+ .|.+|...      .        .-+.|||.|+.. |+.+
T Consensus         9 ~i~L-~ct~c~~~nY~t~Kn~~~~~~kL~lkKycp~~~kh-tlhk   51 (54)
T TIGR01023         9 LIRL-VCTACTGINYTTTKNRRNKPEKLELRKYCPVCRKH-VLHK   51 (54)
T ss_pred             EEEE-EecCCCCCCEEEcCCCCCCCCceEEECcCCCCCCe-EeEE
Confidence            4567 89999642      1        116899999999 6654


No 244
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=43.39  E-value=7.2  Score=24.32  Aligned_cols=10  Identities=10%  Similarity=0.195  Sum_probs=5.3

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      .-||.||.++
T Consensus        21 ~~CPlC~r~l   30 (54)
T PF04423_consen   21 GCCPLCGRPL   30 (54)
T ss_dssp             EE-TTT--EE
T ss_pred             CcCCCCCCCC
Confidence            3799999874


No 245
>PRK05767 rpl44e 50S ribosomal protein L44e; Validated
Probab=43.32  E-value=16  Score=26.38  Aligned_cols=17  Identities=12%  Similarity=-0.009  Sum_probs=14.6

Q ss_pred             ccccccCCCCCeeeEEEE
Q 033276           84 LVICIKSNHEIRISPVFM  101 (123)
Q Consensus        84 ~~fCp~CG~~~tl~rV~~  101 (123)
                      +-|||.|+.. |..+|+-
T Consensus         8 ~tyCp~CkkH-t~HkV~q   24 (92)
T PRK05767          8 RTYCPYCKTH-TEHEVEK   24 (92)
T ss_pred             cccCcCCCCc-ccEEEEE
Confidence            5799999999 8888873


No 246
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=43.23  E-value=14  Score=26.85  Aligned_cols=29  Identities=17%  Similarity=0.195  Sum_probs=18.6

Q ss_pred             cccccCCCCCeeeEEEEEeeEEEEEeeCCcccee
Q 033276           85 VICIKSNHEIRISPVFMLILICLYIQVDTEMPCL  118 (123)
Q Consensus        85 ~fCp~CG~~~tl~rV~~~~~~~~~~~~~~~~~~~  118 (123)
                      ..||.||.++.|.+     +.-+|=+.-++-|.+
T Consensus         3 ~~CpYCg~~~~l~~-----~~~iYg~~~~~~~~~   31 (102)
T PF11672_consen    3 IICPYCGGPAELVD-----GSEIYGHRYDDGPYL   31 (102)
T ss_pred             cccCCCCCeeEEcc-----cchhcCccCCCCcee
Confidence            57999999976655     344455554455554


No 247
>PF03854 zf-P11:  P-11 zinc finger;  InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The RING-finger is a specialised type of Zn-finger of 40 to 60 residues that binds two atoms of zinc, and is probably involved in mediating protein-protein interactions [, , ]. There are two different variants, the C3HC4-type and a C3H2C3-type, which is clearly related despite the different cysteine/histidine pattern. The latter type is sometimes referred to as 'RING-H2 finger'. The RING domain is a protein interaction domain which has been implicated in a range of diverse biological processes. Several 3D-structures for RING-fingers are known [, ]. The 3D structure of the zinc ligation system is unique to the RING domain and is referred to as the 'cross-brace' motif. The spacing of the cysteines in such a domain is:  C-x(2)-C-x(9 to 39)-C-x(1 to 3)-H-x(2 to 3)-C-x(2)-C-x(4 to 48)-C-x(2)-C  Metal ligand pairs one and three co-ordinate to bind one zinc ion, whilst pairs two and four bind the second. This entry represents RING finger protein Z, a small polypeptide found in some negative-strand RNA viruses including Lassa fever virus, which plays a crucial role in virion assembly and budding. RING finger Z has been shown to interact with several host proteins, including promyelocytic leukemia protein and the eukaryotic translation initiation factor 4E [, ]. It is sufficient in the absence of any other viral proteins to release virus-like particles from the infected cell []. This protein is also responsible for arenavirus superinfection exclusion; expression of this protein in a host cell strongly and specifically inhibits areanavirus transcription and replication []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003723 RNA binding, 0008270 zinc ion binding; PDB: 2KO5_A.
Probab=43.17  E-value=4  Score=26.57  Aligned_cols=22  Identities=14%  Similarity=0.167  Sum_probs=15.1

Q ss_pred             cccCCccc-ccCccccccCCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      -|..|-.. -...++||+||.++
T Consensus        23 LCl~CLt~ml~~s~~C~iC~~~L   45 (50)
T PF03854_consen   23 LCLNCLTLMLSRSDRCPICGKPL   45 (50)
T ss_dssp             EEHHHHHHT-SSSSEETTTTEE-
T ss_pred             HHHHHHHHHhccccCCCcccCcC
Confidence            46777766 33458999999873


No 248
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=43.16  E-value=20  Score=26.23  Aligned_cols=27  Identities=19%  Similarity=0.460  Sum_probs=18.8

Q ss_pred             cCccccccCCCCCeeeEEEEEeeEEEEEeeCC-ccceee
Q 033276           82 FPLVICIKSNHEIRISPVFMLILICLYIQVDT-EMPCLL  119 (123)
Q Consensus        82 ~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~-~~~~~~  119 (123)
                      ..+.+|..||+..           ...++-.| ++|||+
T Consensus        58 ~~~I~C~~C~~~w-----------G~~m~yk~~~LP~L~   85 (123)
T PF11648_consen   58 NGKIHCKNCGQDW-----------GIMMKYKGVELPCLK   85 (123)
T ss_dssp             EEEEEETSTSBEE-----------EEEEEETTEEEEEE-
T ss_pred             CCEEEcCCCChHh-----------hhheEECCccccEEE
Confidence            4468899999982           33555666 899986


No 249
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=43.13  E-value=10  Score=30.14  Aligned_cols=17  Identities=6%  Similarity=0.192  Sum_probs=12.5

Q ss_pred             cCccccccCCCCCeeeEE
Q 033276           82 FPLVICIKSNHEIRISPV   99 (123)
Q Consensus        82 ~~~~fCp~CG~~~tl~rV   99 (123)
                      ..+.|||.||.++ -.+.
T Consensus        91 i~R~FC~~CGS~L-~~~~  107 (191)
T PRK05417         91 IQRHACKECGVHM-YGRI  107 (191)
T ss_pred             eEeeeCCCCCCcc-cccc
Confidence            4578999999994 4443


No 250
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=42.98  E-value=26  Score=25.09  Aligned_cols=20  Identities=10%  Similarity=0.074  Sum_probs=14.8

Q ss_pred             CccccccCCCCCeeeEEEEEe
Q 033276           83 PLVICIKSNHEIRISPVFMLI  103 (123)
Q Consensus        83 ~~~fCp~CG~~~tl~rV~~~~  103 (123)
                      .+..||.||.. .++|+++=|
T Consensus        35 a~y~CpfCgk~-~vkR~a~GI   54 (90)
T PTZ00255         35 AKYFCPFCGKH-AVKRQAVGI   54 (90)
T ss_pred             CCccCCCCCCC-ceeeeeeEE
Confidence            45778888877 788887633


No 251
>PRK02625 rpoC1 DNA-directed RNA polymerase subunit gamma; Provisional
Probab=42.97  E-value=9.7  Score=35.53  Aligned_cols=30  Identities=13%  Similarity=0.114  Sum_probs=21.8

Q ss_pred             eeEEeeccccCCccc---ccCccccccCCCCCeeeEE
Q 033276           66 LHRYIVDKCLKLFSS---PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        66 v~~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~rV   99 (123)
                      ++.|.-    +|++.   .....||+.||-+.|-.||
T Consensus        66 ~k~~eC----~CGkyk~~~~~~~~C~~CgvE~t~s~v   98 (627)
T PRK02625         66 SKDWEC----HCGKYKRVRHRGIVCERCGVEVTESRV   98 (627)
T ss_pred             ccCcEE----eCCCccccCcCCcCCCCCCcEecchhh
Confidence            567776    66655   3446899999998777665


No 252
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The nuclear SIRT1 has been shown to target the p53 tumor suppressor protein for deacetylation to suppress DNA damage, and the cytoplasmic SIRT2 homolog has been shown to target alpha-tubulin for deacetylation for the maintenance of cell integrity.
Probab=42.62  E-value=18  Score=28.86  Aligned_cols=43  Identities=14%  Similarity=0.243  Sum_probs=26.6

Q ss_pred             eeCCCCCcceeeeEEeeccccCCccc-cc----------CccccccCCCCCeeeEEEEEeeEE
Q 033276           55 LLAPGGMQIRQLHRYIVDKCLKLFSS-PF----------PLVICIKSNHEIRISPVFMLILIC  106 (123)
Q Consensus        55 l~sv~g~~I~~v~~wvl~rC~gC~k~-~~----------~~~fCp~CG~~~tl~rV~~~~~~~  106 (123)
                      ++.++|.      -+.. +|..|.+. +.          ..-.||.||+.  ||.--|..|+.
T Consensus       107 V~elHG~------l~~~-~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cgg~--lrP~Vv~FGE~  160 (235)
T cd01408         107 IIEAHGS------FATA-HCIKCKHKYPGDWMREDIFNQEVPKCPRCGGL--VKPDIVFFGES  160 (235)
T ss_pred             EEEeCcC------CCcc-ccccCCCcCCHHHHHHHHhCCCCccCCCCCCC--ccCcEEECCCC
Confidence            5555553      2345 99999986 31          12359999977  55555555553


No 253
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=42.61  E-value=11  Score=25.22  Aligned_cols=8  Identities=38%  Similarity=0.638  Sum_probs=6.9

Q ss_pred             ccccCCCC
Q 033276           86 ICIKSNHE   93 (123)
Q Consensus        86 fCp~CG~~   93 (123)
                      -||+||+.
T Consensus         2 ~C~KCg~~    9 (64)
T PF09855_consen    2 KCPKCGNE    9 (64)
T ss_pred             CCCCCCCc
Confidence            49999987


No 254
>PF02005 TRM:  N2,N2-dimethylguanosine tRNA methyltransferase;  InterPro: IPR002905 This enzyme 2.1.1.32 from EC uses S-adenosyl-L-methionine to methylate tRNA:  S-AdoMet + tRNA = S-adenosyl-L-homocysteine + tRNA containing N2-methylguanine The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs []. The enzyme is found in both eukaryotes and archaea [].; GO: 0003723 RNA binding, 0004809 tRNA (guanine-N2-)-methyltransferase activity, 0008033 tRNA processing; PDB: 2YTZ_B 2DUL_A 2EJU_A 2EJT_A 3AXT_A 3AXS_A.
Probab=42.11  E-value=18  Score=31.17  Aligned_cols=27  Identities=11%  Similarity=0.090  Sum_probs=17.4

Q ss_pred             eEEeeccccCCccc--c----cCccccccCCCCC
Q 033276           67 HRYIVDKCLKLFSS--P----FPLVICIKSNHEI   94 (123)
Q Consensus        67 ~~wvl~rC~gC~k~--~----~~~~fCp~CG~~~   94 (123)
                      .-|++ .|++|...  .    ..+..||.||++.
T Consensus       237 ~G~v~-~C~~C~~~~~~~~~~~~~~~c~~cg~~~  269 (377)
T PF02005_consen  237 LGYVY-YCPSCGYREEVKGLQKLKSKCPECGSKL  269 (377)
T ss_dssp             EEEEE-EETTT--EECCT-GCC--CEETTT-SCC
T ss_pred             eeEEE-ECCCccccccccCccccCCcCCCCCCcc
Confidence            47999 99999953  1    1137899999995


No 255
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=42.09  E-value=25  Score=26.33  Aligned_cols=35  Identities=17%  Similarity=0.144  Sum_probs=21.6

Q ss_pred             EEeeccccCCccc-c----------cCccccccCCCCCeeeEEEEEeeE
Q 033276           68 RYIVDKCLKLFSS-P----------FPLVICIKSNHEIRISPVFMLILI  105 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~----------~~~~fCp~CG~~~tl~rV~~~~~~  105 (123)
                      -+.. +|..|++. +          .....||.||+.  +|.=-|..|+
T Consensus       103 l~~~-~C~~C~~~~~~~~~~~~~~~~~~~~C~~C~~~--lrp~vv~fgE  148 (178)
T PF02146_consen  103 LFRL-RCSKCGKEYDREDIVDSIDEEEPPRCPKCGGL--LRPDVVLFGE  148 (178)
T ss_dssp             EEEE-EETTTSBEEEGHHHHHHHHTTSSCBCTTTSCB--EEEEE--BTS
T ss_pred             hcee-eecCCCccccchhhcccccccccccccccCcc--CCCCeeecCC
Confidence            4566 99999985 1          223579999996  4443333343


No 256
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=41.58  E-value=16  Score=27.70  Aligned_cols=22  Identities=18%  Similarity=-0.014  Sum_probs=17.2

Q ss_pred             cccCCccc----ccCccccccCCCCCe
Q 033276           73 KCLKLFSS----PFPLVICIKSNHEIR   95 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~~t   95 (123)
                      .| +|+++    .+....||-||+...
T Consensus        91 ~C-~CGkl~Ci~g~~~~~CPwCg~~g~  116 (131)
T PF15616_consen   91 VC-GCGKLFCIDGEGEVTCPWCGNEGS  116 (131)
T ss_pred             Ee-cCCCEEEeCCCCCEECCCCCCeee
Confidence            47 89998    455789999999853


No 257
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=41.17  E-value=31  Score=24.69  Aligned_cols=20  Identities=15%  Similarity=0.157  Sum_probs=14.3

Q ss_pred             CccccccCCCCCeeeEEEEEe
Q 033276           83 PLVICIKSNHEIRISPVFMLI  103 (123)
Q Consensus        83 ~~~fCp~CG~~~tl~rV~~~~  103 (123)
                      .+..||.||.. .++|+++=|
T Consensus        35 a~y~CpfCgk~-~vkR~a~GI   54 (90)
T PRK03976         35 AKHVCPVCGRP-KVKRVGTGI   54 (90)
T ss_pred             cCccCCCCCCC-ceEEEEEEE
Confidence            35678888777 788877544


No 258
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=40.88  E-value=22  Score=22.87  Aligned_cols=23  Identities=17%  Similarity=-0.081  Sum_probs=13.2

Q ss_pred             ccccCCCCCeeeEEEEEeeEEEEE
Q 033276           86 ICIKSNHEIRISPVFMLILICLYI  109 (123)
Q Consensus        86 fCp~CG~~~tl~rV~~~~~~~~~~  109 (123)
                      .||.||.++ -.-+-.+.|.--||
T Consensus         2 ~CPyCge~~-~~~iD~s~~~Q~yi   24 (52)
T PF14255_consen    2 QCPYCGEPI-EILIDPSAGDQEYI   24 (52)
T ss_pred             CCCCCCCee-EEEEecCCCCeeEE
Confidence            489999884 33444444443343


No 259
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=40.85  E-value=20  Score=30.08  Aligned_cols=52  Identities=19%  Similarity=0.261  Sum_probs=35.2

Q ss_pred             CCCCcceeeeEEeeccccCCccc-ccC-----------------------ccccccCCCCCeeeEEEEEeeEEEEEeeCC
Q 033276           58 PGGMQIRQLHRYIVDKCLKLFSS-PFP-----------------------LVICIKSNHEIRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        58 v~g~~I~~v~~wvl~rC~gC~k~-~~~-----------------------~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~  113 (123)
                      +.|--|+=.--|-. ||..|... +-.                       ...||-||+++-+|.=   -|+++|+-+-|
T Consensus        30 prglSiRL~TPF~~-RCL~C~~YI~K~~rfNavkE~~~dK~y~~~kiYRf~I~C~~C~n~i~~RTD---PkN~~YV~EsG  105 (272)
T COG5134          30 PRGLSIRLETPFPV-RCLNCENYIQKGTRFNAVKEEIGDKSYYTTKIYRFSIKCHLCSNPIDVRTD---PKNTEYVVESG  105 (272)
T ss_pred             cccceEEeccCcce-eecchhhhhhcccchhHHHHHhcccccceeEEEEEEEEccCCCCceeeecC---CCCceEEEecC
Confidence            34555666667888 99999865 211                       1359999999654433   37888887666


No 260
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]
Probab=40.75  E-value=19  Score=31.73  Aligned_cols=70  Identities=17%  Similarity=0.212  Sum_probs=43.2

Q ss_pred             EEecccHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc-ccC-ccccccCCCCCeeeEEEEEeeEEEEEeeCC
Q 033276           36 ACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFP-LVICIKSNHEIRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        36 a~vTdDyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~-~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~  113 (123)
                      -..|-||++--=+.++++.+..--++.-- --+|.+ .=.-=++. ..+ ..||.+||-+               |+.-|
T Consensus        42 p~e~~tv~~e~~~~~~~~p~f~~~~r~pp-hl~w~~-~V~~~gek~l~p~VHfCd~Cd~P---------------I~IYG  104 (389)
T KOG2932|consen   42 PTETVTVACEDHLVLADLPVFKGIGRVPP-HLTWIK-PVGRRGEKQLGPRVHFCDRCDFP---------------IAIYG  104 (389)
T ss_pred             CcceeeeccchhhhhcCCchhcccccCCC-ceeeee-ecccccccccCcceEeecccCCc---------------ceeee
Confidence            35667888888888888887754333332 246777 22222222 223 6899999999               45556


Q ss_pred             -ccceeecccC
Q 033276          114 -EMPCLLHYHC  123 (123)
Q Consensus       114 -~~~~~~~~~~  123 (123)
                       -||| +|..|
T Consensus       105 RmIPC-kHvFC  114 (389)
T KOG2932|consen  105 RMIPC-KHVFC  114 (389)
T ss_pred             ccccc-chhhh
Confidence             6788 44443


No 261
>KOG2691 consensus RNA polymerase II subunit 9 [Transcription]
Probab=40.60  E-value=25  Score=26.32  Aligned_cols=20  Identities=25%  Similarity=0.391  Sum_probs=15.1

Q ss_pred             CccccccCCCCCeeeEEEEEeeEEEEEeeCC
Q 033276           83 PLVICIKSNHEIRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        83 ~~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~  113 (123)
                      ....||+||+.           +.||.|.-+
T Consensus        72 s~~~C~~C~~~-----------eavffQ~~~   91 (113)
T KOG2691|consen   72 SDKHCPKCGHR-----------EAVFFQAQT   91 (113)
T ss_pred             ccccCCccCCc-----------ceEEEeccc
Confidence            35779999988           567888744


No 262
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=40.48  E-value=16  Score=32.61  Aligned_cols=27  Identities=11%  Similarity=0.180  Sum_probs=19.8

Q ss_pred             EEeeccccCCccc-c------cCccccccCCCCCe
Q 033276           68 RYIVDKCLKLFSS-P------FPLVICIKSNHEIR   95 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~------~~~~fCp~CG~~~t   95 (123)
                      --.. +|+.|.-. +      ...-+||.||+.++
T Consensus        16 ~~~~-~C~eCd~~~~~P~l~~~q~A~CPRC~~~l~   49 (418)
T COG2995          16 GHLI-LCPECDMLVSLPRLDSGQSAYCPRCGHTLT   49 (418)
T ss_pred             ccee-cCCCCCceeccccCCCCCcccCCCCCCccc
Confidence            3456 89999975 2      23679999999854


No 263
>TIGR00201 comF comF family protein. This protein is found in species that do (Bacillus subtilis, Haemophilus influenzae) or do not (E. coli, Borrelia burgdorferi) have described systems for natural transformation with exogenous DNA. It is involved in competence for transformation in Bacillus subtilis.
Probab=40.22  E-value=15  Score=27.95  Aligned_cols=21  Identities=10%  Similarity=0.022  Sum_probs=16.3

Q ss_pred             ccCCccc-ccCccccccCCCCC
Q 033276           74 CLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        74 C~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      |.+|++. .....+|+.|+.++
T Consensus         1 C~~C~~~~~~~~~~C~~C~~~~   22 (190)
T TIGR00201         1 CSLCGRPYQSVHALCRQCGSWR   22 (190)
T ss_pred             CCccccccccccCCchhhCCcc
Confidence            8899987 33457899999874


No 264
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=39.66  E-value=16  Score=24.73  Aligned_cols=21  Identities=10%  Similarity=0.200  Sum_probs=18.1

Q ss_pred             cccCCccc--ccCccccccCCC-C
Q 033276           73 KCLKLFSS--PFPLVICIKSNH-E   93 (123)
Q Consensus        73 rC~gC~k~--~~~~~fCp~CG~-~   93 (123)
                      +|.-|++.  ...+..|..||. +
T Consensus        19 ~CrRCG~~syh~qK~~CasCGygp   42 (62)
T PRK04179         19 RCRRCGRHSYNVRKKYCAACGFGR   42 (62)
T ss_pred             hhcccCcccccccccchhhcCCCc
Confidence            59999987  667899999998 5


No 265
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=39.36  E-value=18  Score=23.91  Aligned_cols=20  Identities=15%  Similarity=0.273  Sum_probs=14.0

Q ss_pred             cccCCccc-ccCccccccCCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      .|.+||-. +.  -=||.||.++
T Consensus        29 I~~~~f~~~rY--ngCPfC~~~~   49 (55)
T PF14447_consen   29 ICDNCFPGERY--NGCPFCGTPF   49 (55)
T ss_pred             eeccccChhhc--cCCCCCCCcc
Confidence            56777755 33  4599999883


No 266
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones]
Probab=39.26  E-value=18  Score=32.61  Aligned_cols=28  Identities=14%  Similarity=-0.024  Sum_probs=21.5

Q ss_pred             EeeccccCCccc-ccCccccccCCCCCeee
Q 033276           69 YIVDKCLKLFSS-PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        69 wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~   97 (123)
                      =.| .|..|+.. +....-||.||.=.|+.
T Consensus         6 t~f-~C~~CG~~s~KW~GkCp~Cg~Wns~v   34 (456)
T COG1066           6 TAF-VCQECGYVSPKWLGKCPACGAWNTLV   34 (456)
T ss_pred             cEE-EcccCCCCCccccccCCCCCCccceE
Confidence            356 99999998 77778899999544443


No 267
>CHL00018 rpoC1 RNA polymerase beta' subunit
Probab=39.04  E-value=10  Score=35.54  Aligned_cols=31  Identities=16%  Similarity=-0.032  Sum_probs=22.1

Q ss_pred             eeEEeeccccCCccc---c---cCccccccCCCCCeeeEEE
Q 033276           66 LHRYIVDKCLKLFSS---P---FPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        66 v~~wvl~rC~gC~k~---~---~~~~fCp~CG~~~tl~rV~  100 (123)
                      ++.|.-    +|++.   .   ....||+.||-+.|..||.
T Consensus        64 ~k~~~C----~CGkyk~~~~~~~~~~~C~~CgVE~t~s~vR  100 (663)
T CHL00018         64 IKSGIC----ACGNYRVIGDEKEDPKFCEQCGVEFTDSRVR  100 (663)
T ss_pred             CcCCEE----eCCCccccCccccCCCccCCcCCEechhhhh
Confidence            566766    66655   3   3457999999998877763


No 268
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=38.36  E-value=7.9  Score=34.18  Aligned_cols=39  Identities=18%  Similarity=0.148  Sum_probs=29.8

Q ss_pred             CCCcceeeeEEeeccccCCccc-ccCccccccCCCCCeeeEEE
Q 033276           59 GGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        59 ~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~~tl~rV~  100 (123)
                      -|.+|++  +-.| ||+.|+.. ..-.--||.|..=-|++++.
T Consensus       345 vge~l~~--~~~Y-RC~~CGF~a~~l~W~CPsC~~W~TikPir  384 (389)
T COG2956         345 VGEQLRR--KPRY-RCQNCGFTAHTLYWHCPSCRAWETIKPIR  384 (389)
T ss_pred             HHHHHhh--cCCc-eecccCCcceeeeeeCCCcccccccCCcc
Confidence            3667776  7788 99999977 55556799999876777654


No 269
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=38.17  E-value=17  Score=28.21  Aligned_cols=21  Identities=14%  Similarity=0.064  Sum_probs=14.3

Q ss_pred             cccCCcccccCccccccCCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      .|+.|+......-+||.||..
T Consensus       311 ~C~~cg~~~~r~~~C~~cg~~  331 (364)
T COG0675         311 TCPCCGHLSGRLFKCPRCGFV  331 (364)
T ss_pred             cccccCCccceeEECCCCCCe
Confidence            788888731223678888874


No 270
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=38.06  E-value=21  Score=24.40  Aligned_cols=13  Identities=15%  Similarity=0.266  Sum_probs=9.5

Q ss_pred             cccccCCCCCeee
Q 033276           85 VICIKSNHEIRIS   97 (123)
Q Consensus        85 ~fCp~CG~~~tl~   97 (123)
                      ..||.||++..++
T Consensus         2 m~CP~Cg~~a~ir   14 (72)
T PRK09678          2 FHCPLCQHAAHAR   14 (72)
T ss_pred             ccCCCCCCccEEE
Confidence            3699999995333


No 271
>PF02639 DUF188:  Uncharacterized BCR, YaiI/YqxD family COG1671;  InterPro: IPR003791 This entry describes proteins of unknown function.
Probab=37.90  E-value=43  Score=24.91  Aligned_cols=29  Identities=28%  Similarity=0.477  Sum_probs=26.2

Q ss_pred             EEecccHHHHHHHHHhCceeeCCCCCcce
Q 033276           36 ACITGDYAMQNVILQMGLRLLAPGGMQIR   64 (123)
Q Consensus        36 a~vTdDyAmQNVllqlGL~l~sv~g~~I~   64 (123)
                      .++|.||.+-..++.-|..++++.|....
T Consensus        54 iVITqDigLA~~~l~Kga~vl~~rG~~yt   82 (130)
T PF02639_consen   54 IVITQDIGLASLLLAKGAYVLNPRGKEYT   82 (130)
T ss_pred             EEEECCHHHHHHHHHCCCEEECCCCCCCC
Confidence            78999999999999999999999987543


No 272
>PF06054 CoiA:  Competence protein CoiA-like family;  InterPro: IPR010330 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. Many of the members of this family are described as transcription factors. CoiA falls within a competence-specific operon in Streptococcus. CoiA is an uncharacterised protein.
Probab=37.30  E-value=18  Score=31.05  Aligned_cols=16  Identities=6%  Similarity=0.100  Sum_probs=11.7

Q ss_pred             cCccccccCCCCCeee
Q 033276           82 FPLVICIKSNHEIRIS   97 (123)
Q Consensus        82 ~~~~fCp~CG~~~tl~   97 (123)
                      ...-+||.||.++.++
T Consensus        28 ~~~~~CP~C~~~v~lk   43 (375)
T PF06054_consen   28 KGKYFCPGCGEPVILK   43 (375)
T ss_pred             CCcEECCCCCCeeEEE
Confidence            3457899999996554


No 273
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis]
Probab=37.24  E-value=6.6  Score=25.56  Aligned_cols=24  Identities=17%  Similarity=0.400  Sum_probs=20.0

Q ss_pred             cccCCccc-ccCccccccCCCCCeee
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl~   97 (123)
                      .|.-|+.. ++.-.-|-+||++ .|+
T Consensus        16 IC~rC~Arnp~~A~kCRkC~~k-~LR   40 (50)
T COG1552          16 ICRRCYARNPPRATKCRKCGYK-NLR   40 (50)
T ss_pred             HHHHhcCCCCcchhHHhhccCC-Ccc
Confidence            79999988 6667889999998 665


No 274
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=37.21  E-value=33  Score=22.42  Aligned_cols=36  Identities=8%  Similarity=-0.014  Sum_probs=20.9

Q ss_pred             eeeCCCCCcceeeeEEeeccccCCcc--c---ccCccccccCCCC
Q 033276           54 RLLAPGGMQIRQLHRYIVDKCLKLFS--S---PFPLVICIKSNHE   93 (123)
Q Consensus        54 ~l~sv~g~~I~~v~~wvl~rC~gC~k--~---~~~~~fCp~CG~~   93 (123)
                      .+..+++.++++   -.. .|+-|+.  .   ...+.-|-+||.-
T Consensus         6 ~yY~v~~~kv~r---k~~-~CPrCG~gvfmA~H~dR~~CGkCgyT   46 (51)
T COG1998           6 KYYEVDDEKVKR---KNR-FCPRCGPGVFMADHKDRWACGKCGYT   46 (51)
T ss_pred             eEEEEcCCcEEE---ccc-cCCCCCCcchhhhcCceeEeccccce
Confidence            344555544333   334 6777773  2   3557778888864


No 275
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=37.14  E-value=14  Score=23.54  Aligned_cols=20  Identities=15%  Similarity=0.109  Sum_probs=13.1

Q ss_pred             ccc--CCccc-----ccCccccccCCC
Q 033276           73 KCL--KLFSS-----PFPLVICIKSNH   92 (123)
Q Consensus        73 rC~--gC~k~-----~~~~~fCp~CG~   92 (123)
                      .|+  .|+.-     ...+..|-+||.
T Consensus        20 ~CP~~~CG~GvFMA~H~dR~~CGKCg~   46 (47)
T PF01599_consen   20 ECPSPRCGAGVFMAEHKDRHYCGKCGY   46 (47)
T ss_dssp             E-TSTTTTSSSEEEE-SSEEEETTTSS
T ss_pred             cCCCcccCCceEeeecCCCccCCCccc
Confidence            787  77652     456888888884


No 276
>CHL00104 rpl33 ribosomal protein L33
Probab=37.10  E-value=19  Score=24.39  Aligned_cols=14  Identities=14%  Similarity=0.161  Sum_probs=11.8

Q ss_pred             ccccccCCCCCeeeE
Q 033276           84 LVICIKSNHEIRISP   98 (123)
Q Consensus        84 ~~fCp~CG~~~tl~r   98 (123)
                      +.|||.|... |+.+
T Consensus        49 kKycp~c~kH-tlhk   62 (66)
T CHL00104         49 KKFCPYCYKH-TIHK   62 (66)
T ss_pred             ECcCCCCCCE-eeEe
Confidence            6899999999 7764


No 277
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=36.68  E-value=20  Score=25.84  Aligned_cols=21  Identities=10%  Similarity=0.259  Sum_probs=13.2

Q ss_pred             cccCCccccc--------CccccccCCCC
Q 033276           73 KCLKLFSSPF--------PLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~~~--------~~~fCp~CG~~   93 (123)
                      .|+-|+....        ....||+||.-
T Consensus        23 ~CP~Cge~~v~v~~~k~~~h~~C~~CG~y   51 (99)
T PRK14892         23 ECPRCGKVSISVKIKKNIAIITCGNCGLY   51 (99)
T ss_pred             ECCCCCCeEeeeecCCCcceEECCCCCCc
Confidence            5777774311        35678888765


No 278
>TIGR02642 phage_xxxx uncharacterized phage protein. This uncharacterized protein is found in prophage regions of Shewanella oneidensis MR-1, Vibrio vulnificus YJ016, Yersinia pseudotuberculosis IP 32953, and Aeromonas hydrophila ATCC7966. It appears to have regions of sequence similarity to phage lambda antitermination protein Q.
Probab=36.40  E-value=81  Score=25.09  Aligned_cols=27  Identities=15%  Similarity=0.063  Sum_probs=18.2

Q ss_pred             eeccccCCccc-c--cCccccccCCCCCeee
Q 033276           70 IVDKCLKLFSS-P--FPLVICIKSNHEIRIS   97 (123)
Q Consensus        70 vl~rC~gC~k~-~--~~~~fCp~CG~~~tl~   97 (123)
                      .. .|+.|.-. .  .+..-||.|++....+
T Consensus        99 ~~-~C~~C~G~G~~i~~~~~C~~C~G~G~v~  128 (186)
T TIGR02642        99 SC-KCPRCRGTGLIQRRQRECDTCAGTGRFR  128 (186)
T ss_pred             CC-cCCCCCCeeEEecCCCCCCCCCCccEEe
Confidence            45 79999865 2  2236799999974433


No 279
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=36.13  E-value=21  Score=25.98  Aligned_cols=25  Identities=16%  Similarity=0.390  Sum_probs=15.0

Q ss_pred             eeEEeeccccCCcccccC--------ccccccCCC
Q 033276           66 LHRYIVDKCLKLFSSPFP--------LVICIKSNH   92 (123)
Q Consensus        66 v~~wvl~rC~gC~k~~~~--------~~fCp~CG~   92 (123)
                      ++.||+  |+.|+.+++.        ..-|..||.
T Consensus        77 I~~yVl--C~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       77 IKEYVL--CPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             HHhcEE--CCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            556776  8888876211        234777775


No 280
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=35.96  E-value=21  Score=26.94  Aligned_cols=27  Identities=19%  Similarity=0.384  Sum_probs=16.7

Q ss_pred             eeEEeeccccCCcccc--------cCccccccCCCCC
Q 033276           66 LHRYIVDKCLKLFSSP--------FPLVICIKSNHEI   94 (123)
Q Consensus        66 v~~wvl~rC~gC~k~~--------~~~~fCp~CG~~~   94 (123)
                      ++.|++  |+.|+.++        ....-|..||...
T Consensus        99 I~~yVl--C~~C~spdT~l~k~~r~~~l~C~ACGa~~  133 (138)
T PRK03988         99 VKEYVI--CPECGSPDTKLIKEGRIWVLKCEACGAET  133 (138)
T ss_pred             HHhcEE--CCCCCCCCcEEEEcCCeEEEEcccCCCCC
Confidence            455666  88888762        1134577787763


No 281
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=35.82  E-value=23  Score=26.66  Aligned_cols=27  Identities=15%  Similarity=0.407  Sum_probs=16.8

Q ss_pred             eeEEeeccccCCccccc-----C---ccccccCCCCC
Q 033276           66 LHRYIVDKCLKLFSSPF-----P---LVICIKSNHEI   94 (123)
Q Consensus        66 v~~wvl~rC~gC~k~~~-----~---~~fCp~CG~~~   94 (123)
                      ++.|++  |+.|+.+++     .   ..-|..||+.-
T Consensus        94 I~~yVl--C~~C~sPdT~l~k~~r~~~l~C~ACGa~~  128 (133)
T TIGR00311        94 VRKYVI--CRECNRPDTRIIKEGRVSLLKCEACGAKA  128 (133)
T ss_pred             HhheEE--CCCCCCCCcEEEEeCCeEEEecccCCCCC
Confidence            556776  888887621     1   23588888763


No 282
>PRK00566 DNA-directed RNA polymerase subunit beta'; Provisional
Probab=35.75  E-value=18  Score=35.95  Aligned_cols=31  Identities=19%  Similarity=0.171  Sum_probs=22.3

Q ss_pred             eeEEeeccccCCccc---ccCccccccCCCCCeeeEEE
Q 033276           66 LHRYIVDKCLKLFSS---PFPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        66 v~~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~rV~  100 (123)
                      ++.|.-    +|++.   .....+|++||-++|..||.
T Consensus        55 ~kd~eC----~Cgkyk~~~~~~~~C~~cgve~~~~~vr   88 (1156)
T PRK00566         55 TKDYEC----LCGKYKRVRYKGIICERCGVEVTRSKVR   88 (1156)
T ss_pred             ccCcEE----eCccccccCcCCcCCCCCCceeeechhh
Confidence            456655    77765   34458999999998887764


No 283
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=35.58  E-value=35  Score=27.73  Aligned_cols=12  Identities=17%  Similarity=0.304  Sum_probs=8.0

Q ss_pred             CccccccCCCCC
Q 033276           83 PLVICIKSNHEI   94 (123)
Q Consensus        83 ~~~fCp~CG~~~   94 (123)
                      ...|||.||+++
T Consensus        98 ~~~fC~~CG~~~  109 (256)
T PRK00241         98 SHRFCGYCGHPM  109 (256)
T ss_pred             cCccccccCCCC
Confidence            356777777774


No 284
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.34  E-value=9.9  Score=26.91  Aligned_cols=25  Identities=16%  Similarity=0.224  Sum_probs=15.3

Q ss_pred             cccCCcccccCccccccCCCCCeeeE
Q 033276           73 KCLKLFSSPFPLVICIKSNHEIRISP   98 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~~tl~r   98 (123)
                      -|..|-.. .-...||.||+++..|.
T Consensus        31 FCadCae~-~l~g~CPnCGGelv~RP   55 (84)
T COG3813          31 FCADCAEN-RLHGLCPNCGGELVARP   55 (84)
T ss_pred             hhHhHHHH-hhcCcCCCCCchhhcCc
Confidence            34455443 22367999999965443


No 285
>PRK07217 replication factor A; Reviewed
Probab=35.31  E-value=22  Score=30.53  Aligned_cols=24  Identities=13%  Similarity=0.174  Sum_probs=18.3

Q ss_pred             EEeeccccC--CcccccCccccccCCCC
Q 033276           68 RYIVDKCLK--LFSSPFPLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~g--C~k~~~~~~fCp~CG~~   93 (123)
                      ..++ ||+.  |.|. ..+..||.||..
T Consensus       186 glI~-rCP~~~C~Rv-l~~g~C~~HG~v  211 (311)
T PRK07217        186 GLIK-RCPEEDCTRV-LQNGRCSEHGKV  211 (311)
T ss_pred             CCee-cCCccccCcc-ccCCCCCCCCCc
Confidence            4556 9999  9998 233689999954


No 286
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=35.23  E-value=34  Score=27.08  Aligned_cols=24  Identities=17%  Similarity=0.121  Sum_probs=16.4

Q ss_pred             eeccccCCccc-c------cCccccccCCCCC
Q 033276           70 IVDKCLKLFSS-P------FPLVICIKSNHEI   94 (123)
Q Consensus        70 vl~rC~gC~k~-~------~~~~fCp~CG~~~   94 (123)
                      .+ +|..|.+. +      ....-||.||+.+
T Consensus       122 ~~-~C~~C~~~~~~~~~~~~~~p~C~~Cgg~l  152 (242)
T PRK00481        122 RA-RCTKCGQTYDLDEYLKPEPPRCPKCGGIL  152 (242)
T ss_pred             ce-eeCCCCCCcChhhhccCCCCCCCCCCCcc
Confidence            35 89999875 2      1223499999873


No 287
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=35.10  E-value=17  Score=29.48  Aligned_cols=23  Identities=13%  Similarity=0.075  Sum_probs=16.2

Q ss_pred             cccCCcccccCccccccCCCCCe
Q 033276           73 KCLKLFSSPFPLVICIKSNHEIR   95 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~~t   95 (123)
                      .|+-|-..+-....||+||....
T Consensus       164 lCtvCe~r~w~g~~CPKCGr~G~  186 (200)
T PF12387_consen  164 LCTVCEGREWKGGNCPKCGRHGK  186 (200)
T ss_pred             EEeeeecCccCCCCCCcccCCCC
Confidence            58888766444566999997643


No 288
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=35.08  E-value=14  Score=30.52  Aligned_cols=28  Identities=18%  Similarity=0.186  Sum_probs=22.6

Q ss_pred             cccCCccc----ccCccccccCCCCCeeeEEE
Q 033276           73 KCLKLFSS----PFPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~~tl~rV~  100 (123)
                      .|.+|...    ....++||+|-.+++..+|-
T Consensus        69 FCWpClyqWl~~~~~~~~cPVCK~~Vs~~~vv  100 (230)
T KOG0823|consen   69 FCWPCLYQWLQTRPNSKECPVCKAEVSIDTVV  100 (230)
T ss_pred             eehHHHHHHHhhcCCCeeCCccccccccceEE
Confidence            69999976    46689999999997776664


No 289
>cd01407 SIR2-fam SIR2 family of proteins includes silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation, where the acetyl group from the lysine epsilon-amino group is transferred to the ADP-ribose moiety of NAD+, producing nicotinamide and the novel metabolite O-acetyl-ADP-ribose. Sir2 proteins, also known as sirtuins, are found in all eukaryotes and many archaea and prokaryotes and have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The most-studied function, gene silencing, involves the inactivation of chromosome domains containing key regulatory genes by packaging them into a specialized chromatin structure that is inaccessible to DNA-binding proteins. The oligomerization state of Sir2 appears to be organism-dependent, sometimes occurring as a monomer and sometimes as a multimer.
Probab=35.01  E-value=32  Score=26.76  Aligned_cols=39  Identities=21%  Similarity=0.260  Sum_probs=24.5

Q ss_pred             HHHhCce-eeCCCCCcceeeeEEeeccccCCccc-cc----------CccccccCCCC
Q 033276           48 ILQMGLR-LLAPGGMQIRQLHRYIVDKCLKLFSS-PF----------PLVICIKSNHE   93 (123)
Q Consensus        48 llqlGL~-l~sv~g~~I~~v~~wvl~rC~gC~k~-~~----------~~~fCp~CG~~   93 (123)
                      -.+.|.+ ++.++|.      -..+ +|..|.+. +.          ....||.||+.
T Consensus        92 ~~~aG~~~v~elHG~------~~~~-~C~~C~~~~~~~~~~~~~~~~~~p~C~~Cg~~  142 (218)
T cd01407          92 HQRAGSPKVIELHGS------LFRV-RCTKCGKEYPRDELQADIDREEVPRCPKCGGL  142 (218)
T ss_pred             HHHcCCCCEEECcCC------cCcc-eeCCCcCCCcHHHHhHhhccCCCCcCCCCCCc
Confidence            4445553 6666663      2335 89999876 21          12469999987


No 290
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=34.58  E-value=12  Score=28.47  Aligned_cols=20  Identities=15%  Similarity=0.100  Sum_probs=16.0

Q ss_pred             cccCCccc--ccCccccccCCC
Q 033276           73 KCLKLFSS--PFPLVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~--~~~~~fCp~CG~   92 (123)
                      .|+.|++.  ......||.|..
T Consensus         5 nC~~CgklF~~~~~~iCp~C~~   26 (137)
T TIGR03826         5 NCPKCGRLFVKTGRDVCPSCYE   26 (137)
T ss_pred             cccccchhhhhcCCccCHHHhH
Confidence            69999998  346688999985


No 291
>cd01411 SIR2H SIR2H: Uncharacterized prokaryotic Sir2 homologs from several gram positive bacterial species and Fusobacteria; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=34.53  E-value=28  Score=27.51  Aligned_cols=23  Identities=9%  Similarity=-0.050  Sum_probs=16.3

Q ss_pred             eeccccCCccc-c----cCccccccCCCC
Q 033276           70 IVDKCLKLFSS-P----FPLVICIKSNHE   93 (123)
Q Consensus        70 vl~rC~gC~k~-~----~~~~fCp~CG~~   93 (123)
                      .. +|..|.+. +    .....||.||+.
T Consensus       118 ~~-~C~~C~~~~~~~~~~~~p~C~~Cgg~  145 (225)
T cd01411         118 RI-YCTVCGKTVDWEEYLKSPYHAKCGGV  145 (225)
T ss_pred             ee-EeCCCCCccchhhcCCCCCCCCCCCE
Confidence            35 89999876 2    112569999976


No 292
>COG3058 FdhE Uncharacterized protein involved in formate dehydrogenase formation [Posttranslational modification, protein turnover, chaperones]
Probab=34.39  E-value=19  Score=31.05  Aligned_cols=12  Identities=8%  Similarity=-0.064  Sum_probs=10.4

Q ss_pred             cCccccccCCCC
Q 033276           82 FPLVICIKSNHE   93 (123)
Q Consensus        82 ~~~~fCp~CG~~   93 (123)
                      ..+.+||+||++
T Consensus       183 e~~~~CPvCGS~  194 (308)
T COG3058         183 ESRQYCPVCGSM  194 (308)
T ss_pred             cccccCCCcCCC
Confidence            567899999988


No 293
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=33.98  E-value=22  Score=30.16  Aligned_cols=21  Identities=24%  Similarity=0.187  Sum_probs=16.3

Q ss_pred             cccCCccc-----ccCccccccCCCC
Q 033276           73 KCLKLFSS-----PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-----~~~~~fCp~CG~~   93 (123)
                      -|..|+..     ...+..||+||+.
T Consensus       113 FCg~CG~~~~~~~~g~~~~C~~cg~~  138 (279)
T COG2816         113 FCGRCGTKTYPREGGWARVCPKCGHE  138 (279)
T ss_pred             CCCCCCCcCccccCceeeeCCCCCCc
Confidence            48899876     2347889999987


No 294
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=33.51  E-value=22  Score=26.34  Aligned_cols=8  Identities=25%  Similarity=0.472  Sum_probs=5.4

Q ss_pred             cccCCccc
Q 033276           73 KCLKLFSS   80 (123)
Q Consensus        73 rC~gC~k~   80 (123)
                      ||..|...
T Consensus        93 RC~~CN~~  100 (147)
T PF01927_consen   93 RCPKCNGP  100 (147)
T ss_pred             ccCCCCcE
Confidence            77777654


No 295
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=33.10  E-value=18  Score=27.40  Aligned_cols=10  Identities=20%  Similarity=0.322  Sum_probs=8.3

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      .-||.||+.-
T Consensus       106 ~~cp~c~s~~  115 (146)
T TIGR02159       106 VQCPRCGSAD  115 (146)
T ss_pred             CcCCCCCCCC
Confidence            6799999883


No 296
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=33.06  E-value=21  Score=24.12  Aligned_cols=21  Identities=10%  Similarity=0.178  Sum_probs=18.4

Q ss_pred             cccCCccc--ccCccccccCCCC
Q 033276           73 KCLKLFSS--PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~--~~~~~fCp~CG~~   93 (123)
                      +|.-|++.  ...+..|..||-+
T Consensus        18 ~CRRCGr~syhv~k~~CaaCGfg   40 (61)
T COG2126          18 RCRRCGRRSYHVRKKYCAACGFG   40 (61)
T ss_pred             hhhhccchheeeccceecccCCC
Confidence            79999987  6678999999977


No 297
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=33.05  E-value=26  Score=27.72  Aligned_cols=28  Identities=18%  Similarity=0.146  Sum_probs=17.6

Q ss_pred             ccccccCCCCCeeeEEEEEeeEEEEEeeCC
Q 033276           84 LVICIKSNHEIRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        84 ~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~  113 (123)
                      ...||+||+..+-++|.  .|-.-.++.|.
T Consensus         5 ~~~CPvC~~~F~~~~vr--s~~~r~~~~d~   32 (214)
T PF09986_consen    5 KITCPVCGKEFKTKKVR--SGKIRVIRRDS   32 (214)
T ss_pred             ceECCCCCCeeeeeEEE--cCCceEeeecC
Confidence            46799999996666554  33333345554


No 298
>cd03361 TOPRIM_TopoIA_RevGyr TopoIA_RevGyr : The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to the ATP-dependent reverse gyrase found in archaea and thermophilic bacteria.   Type IA DNA topoisomerases remove (relax) negative supercoils in the DNA by: cleaving one strand of the DNA duplex, covalently linking to the 5' phosphoryl end of the DNA break and, allowing the other strand of the duplex to pass through the gap. Reverse gyrase is also able to insert positive supercoils in the presence of ATP and negative supercoils in the presence of AMPPNP. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD).  For topoisomerases the conserved glutamate is believed to act as a general base in strand joining and, as a general acid in strand cleavage. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function.
Probab=32.92  E-value=36  Score=25.94  Aligned_cols=25  Identities=16%  Similarity=0.110  Sum_probs=18.7

Q ss_pred             EEeeccccCCccc-ccCccccccCCCC
Q 033276           68 RYIVDKCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        68 ~wvl~rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .+.. +|.+|++. +.....||+||++
T Consensus        75 ~~~~-~c~pc~~lF~~~~~~cp~c~~~  100 (170)
T cd03361          75 DSIK-RCRDCGYQFTEDSDKCPRCGSE  100 (170)
T ss_pred             eEee-ccCCcccccccccccCCcCCCc
Confidence            3345 79999887 5455689999976


No 299
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=32.44  E-value=18  Score=23.46  Aligned_cols=13  Identities=23%  Similarity=0.424  Sum_probs=9.8

Q ss_pred             ccccCCCCCeeeE
Q 033276           86 ICIKSNHEIRISP   98 (123)
Q Consensus        86 fCp~CG~~~tl~r   98 (123)
                      .||.||..+.+..
T Consensus         4 ~CP~CG~~iev~~   16 (54)
T TIGR01206         4 ECPDCGAEIELEN   16 (54)
T ss_pred             CCCCCCCEEecCC
Confidence            5999999876643


No 300
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=32.41  E-value=32  Score=27.58  Aligned_cols=33  Identities=12%  Similarity=0.134  Sum_probs=20.3

Q ss_pred             eeccccCCccc-cc----------CccccccCCCCCeeeEEEEEeeE
Q 033276           70 IVDKCLKLFSS-PF----------PLVICIKSNHEIRISPVFMLILI  105 (123)
Q Consensus        70 vl~rC~gC~k~-~~----------~~~fCp~CG~~~tl~rV~~~~~~  105 (123)
                      .. +|..|.+. +.          ..-.||.||+.  ++.=-|..|+
T Consensus       119 ~~-~C~~C~~~~~~~~~~~~~~~~~~p~Cp~Cgg~--lrP~Vv~FgE  162 (244)
T PRK14138        119 EY-YCVRCGKRYTVEDVIEKLEKSDVPRCDDCSGL--IRPNIVFFGE  162 (244)
T ss_pred             ee-EECCCCCcccHHHHHHHHhcCCCCCCCCCCCe--ECCCEEECCC
Confidence            45 89999876 31          12359999986  4443334444


No 301
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=32.39  E-value=19  Score=27.01  Aligned_cols=10  Identities=40%  Similarity=0.534  Sum_probs=7.2

Q ss_pred             ccccccCCCC
Q 033276           84 LVICIKSNHE   93 (123)
Q Consensus        84 ~~fCp~CG~~   93 (123)
                      +..||+|||+
T Consensus        74 ~~kCpkCghe   83 (116)
T KOG2907|consen   74 KHKCPKCGHE   83 (116)
T ss_pred             hccCcccCCc
Confidence            4568888876


No 302
>PRK08764 ferredoxin; Provisional
Probab=31.99  E-value=55  Score=23.90  Aligned_cols=41  Identities=12%  Similarity=0.201  Sum_probs=25.2

Q ss_pred             cccHHHHHHHHHhCceeeCCCCCc----ceeeeEEeeccccCCcc
Q 033276           39 TGDYAMQNVILQMGLRLLAPGGMQ----IRQLHRYIVDKCLKLFS   79 (123)
Q Consensus        39 TdDyAmQNVllqlGL~l~sv~g~~----I~~v~~wvl~rC~gC~k   79 (123)
                      ..+-.+|+++..||+...+.....    ..++..+..++|.+|++
T Consensus        48 ~G~c~lq~~a~~~gv~~~~~~~~~~~~~~~~~~~~~~~~Ci~C~~   92 (135)
T PRK08764         48 GGDAGARALAQVLGVPARPYDRSRGTHKLPQVAWIVEADCIGCTK   92 (135)
T ss_pred             CCHHHHHHHHHHhCCCccccccccCCCCCCeeEEECcccCcCcch
Confidence            456679999999999866543211    11222222238988886


No 303
>PRK14289 chaperone protein DnaJ; Provisional
Probab=31.76  E-value=69  Score=27.29  Aligned_cols=26  Identities=15%  Similarity=0.078  Sum_probs=17.8

Q ss_pred             eeccccCCccc-ccCccccccCCCCCee
Q 033276           70 IVDKCLKLFSS-PFPLVICIKSNHEIRI   96 (123)
Q Consensus        70 vl~rC~gC~k~-~~~~~fCp~CG~~~tl   96 (123)
                      .. .|+.|.-. .....+|+.|++..++
T Consensus       197 ~~-~C~~C~G~G~~~~~~C~~C~G~g~v  223 (386)
T PRK14289        197 QS-TCPTCNGEGKIIKKKCKKCGGEGIV  223 (386)
T ss_pred             EE-ecCCCCccccccCcCCCCCCCCcEE
Confidence            44 67777766 4456789999987443


No 304
>PF14353 CpXC:  CpXC protein
Probab=31.57  E-value=21  Score=25.45  Aligned_cols=11  Identities=18%  Similarity=0.459  Sum_probs=8.8

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      .-.||.||...
T Consensus        38 ~~~CP~Cg~~~   48 (128)
T PF14353_consen   38 SFTCPSCGHKF   48 (128)
T ss_pred             EEECCCCCCce
Confidence            35699999993


No 305
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=31.48  E-value=22  Score=25.69  Aligned_cols=26  Identities=8%  Similarity=0.054  Sum_probs=20.6

Q ss_pred             eEEeeccccCCccc--ccCccccccCCCCC
Q 033276           67 HRYIVDKCLKLFSS--PFPLVICIKSNHEI   94 (123)
Q Consensus        67 ~~wvl~rC~gC~k~--~~~~~fCp~CG~~~   94 (123)
                      +...+  |.-|++.  ...+..|..||.+.
T Consensus        14 ktHtl--CrRCG~~syH~qK~~CasCGyps   41 (91)
T PTZ00073         14 KTHTL--CRRCGKRSFHVQKKRCASCGYPS   41 (91)
T ss_pred             cCcch--hcccCccccccccccchhcCCch
Confidence            45554  9999987  66788999999873


No 306
>PTZ00408 NAD-dependent deacetylase; Provisional
Probab=31.05  E-value=26  Score=28.31  Aligned_cols=36  Identities=11%  Similarity=0.065  Sum_probs=23.0

Q ss_pred             EeeccccCCccc-ccC------ccccccCCCCCeeeEEEEEeeE
Q 033276           69 YIVDKCLKLFSS-PFP------LVICIKSNHEIRISPVFMLILI  105 (123)
Q Consensus        69 wvl~rC~gC~k~-~~~------~~fCp~CG~~~tl~rV~~~~~~  105 (123)
                      +.. +|..|.+. +..      ...||.||....+|.=-|..|+
T Consensus       116 ~~~-~C~~C~~~~~~~~~~~~~~p~C~~Cg~~g~lrP~vV~FGE  158 (242)
T PTZ00408        116 LKV-RCTATGHVFDWTEDVVHGSSRCKCCGCVGTLRPHIVWFGE  158 (242)
T ss_pred             ceE-EECCCCcccCchhhhhcCCCccccCCCCCCCCCCEEEcCC
Confidence            446 89999976 311      2459999943246665555666


No 307
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=30.97  E-value=27  Score=31.02  Aligned_cols=21  Identities=10%  Similarity=0.153  Sum_probs=12.6

Q ss_pred             cccCCcccccCccccccCCCCCeee
Q 033276           73 KCLKLFSSPFPLVICIKSNHEIRIS   97 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~~~tl~   97 (123)
                      .|..|+.+    ..||.|+.++|.+
T Consensus       215 ~C~~Cg~~----~~C~~C~~~l~~h  235 (505)
T TIGR00595       215 LCRSCGYI----LCCPNCDVSLTYH  235 (505)
T ss_pred             EhhhCcCc----cCCCCCCCceEEe
Confidence            67777765    3366666665443


No 308
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=30.86  E-value=27  Score=27.02  Aligned_cols=34  Identities=9%  Similarity=0.150  Sum_probs=18.3

Q ss_pred             CCCcceeeeEEeeccccCCccc---c-----------cCccccccCCCC
Q 033276           59 GGMQIRQLHRYIVDKCLKLFSS---P-----------FPLVICIKSNHE   93 (123)
Q Consensus        59 ~g~~I~~v~~wvl~rC~gC~k~---~-----------~~~~fCp~CG~~   93 (123)
                      +..|-+....+.+ +|++|++.   +           .....||+|++.
T Consensus         7 d~erf~~c~~l~~-~C~~C~~~~~f~g~~~~~~~~~~~~~~~C~~C~~~   54 (188)
T PF08996_consen    7 DEERFKDCEPLKL-TCPSCGTEFEFPGVFEEDGDDVSPSGLQCPNCSTP   54 (188)
T ss_dssp             -TTTTTT---EEE-E-TTT--EEEE-SSS--SSEEEETTEEEETTT--B
T ss_pred             HHHHhcCCCceEe-ECCCCCCCccccccccCCccccccCcCcCCCCCCc
Confidence            4567778889999 99999986   1           225679999985


No 309
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed
Probab=30.77  E-value=25  Score=31.45  Aligned_cols=21  Identities=14%  Similarity=0.257  Sum_probs=17.6

Q ss_pred             cccCCccc-ccCccccccCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~   93 (123)
                      .|+.|... +...+||+.||.+
T Consensus       594 ~~~~~~~~~~~~~~f~~~~g~~  615 (616)
T PRK07418        594 YCSNCGAKNPSTHRFCPECGTK  615 (616)
T ss_pred             cCCCCCCcCccccccchhhCCC
Confidence            49999984 6667999999987


No 310
>cd03472 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxygenase (RO) family, Biphenyl dioxygenase (BPDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of BPDO and similar proteins including cumene dioxygenase (CumDO), nitrobenzene dioxygenase (NBDO), alkylbenzene dioxygenase (AkbDO) and dibenzofuran 4,4a-dioxygenase (DFDO). ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth. The oxygenase alpha subunit contains an N-terminal Rieske domain with an [2Fe-2S] cluster and a C-terminal catalytic domain with a mononuclear Fe(II) binding site. The Rieske [2Fe-2S] cluster accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron for catalysis. BPDO degrades biphenyls and polychlorinated biphenyls (PCB's) while CumDO degrades cumene (isopropylbenzene), an aromatic hydrocarbon that is i
Probab=30.73  E-value=74  Score=22.99  Aligned_cols=93  Identities=15%  Similarity=0.193  Sum_probs=55.4

Q ss_pred             CceeccCCCCceeEEe-ccc---HHHHHHHHHhCceeeCCC-C--Ccce-eeeEEeeccccCCccc-ccCcccc--ccCC
Q 033276           23 QSWMLRSLSESTVACI-TGD---YAMQNVILQMGLRLLAPG-G--MQIR-QLHRYIVDKCLKLFSS-PFPLVIC--IKSN   91 (123)
Q Consensus        23 ~~WIt~~~~~~~va~v-TdD---yAmQNVllqlGL~l~sv~-g--~~I~-~v~~wvl~rC~gC~k~-~~~~~fC--p~CG   91 (123)
                      +...+.......++++ +.|   ||++|+--|.|..+..-. +  ..|. -...|.+|.--.|-+. .....|.  -.+.
T Consensus        22 g~~~~~~~~~~~i~l~r~~~g~i~A~~n~C~Hrg~~L~~g~~g~~~~i~CP~Hgw~fd~~G~~~~~P~~~~~~~~~~~~~  101 (128)
T cd03472          22 GDYLTTYMGEDPVIVVRQKDGSIRVFLNQCRHRGMRICRSDAGNAKAFTCTYHGWAYDTAGNLVNVPFEKEAFCDGLDKA  101 (128)
T ss_pred             CCEEEEEECCceEEEEECCCCCEEEEhhhCcCCCCeeeccCCCCcCEEECCcCCeEECCCcCEEeccCcccccccCCCHH
Confidence            3344443334445444 445   999999999999876422 1  1232 3457888665666655 2222343  2233


Q ss_pred             CCCeeeEEEEEe-eEEEEEeeCCccc
Q 033276           92 HEIRISPVFMLI-LICLYIQVDTEMP  116 (123)
Q Consensus        92 ~~~tl~rV~~~~-~~~~~~~~~~~~~  116 (123)
                      .. .|+++.|.+ +.-|||.-|.+-|
T Consensus       102 ~~-~l~~~~v~~~~g~vfv~~~~~~~  126 (128)
T cd03472         102 DW-GPLQARVETYKGLIFANWDAEAP  126 (128)
T ss_pred             HC-CCcceeEeEECCEEEEEcCCCCC
Confidence            33 678888775 6678888887654


No 311
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=30.72  E-value=32  Score=25.03  Aligned_cols=16  Identities=19%  Similarity=0.175  Sum_probs=14.1

Q ss_pred             ccccccCCCCCeeeEEE
Q 033276           84 LVICIKSNHEIRISPVF  100 (123)
Q Consensus        84 ~~fCp~CG~~~tl~rV~  100 (123)
                      +-+||.|... |+..|+
T Consensus         8 ~tyCp~Ckkh-T~H~V~   23 (94)
T COG1631           8 RTYCPYCKKH-TIHKVE   23 (94)
T ss_pred             eecCcccccc-eeeeee
Confidence            5789999999 898886


No 312
>PRK14873 primosome assembly protein PriA; Provisional
Probab=30.72  E-value=27  Score=32.39  Aligned_cols=26  Identities=8%  Similarity=0.209  Sum_probs=17.0

Q ss_pred             EEeeccccCCcccccCccccccCCCCCeeeE
Q 033276           68 RYIVDKCLKLFSSPFPLVICIKSNHEIRISP   98 (123)
Q Consensus        68 ~wvl~rC~gC~k~~~~~~fCp~CG~~~tl~r   98 (123)
                      .-.+ .|..|+..    -.||+|+.++|+++
T Consensus       381 ap~l-~C~~Cg~~----~~C~~C~~~L~~h~  406 (665)
T PRK14873        381 VPSL-ACARCRTP----ARCRHCTGPLGLPS  406 (665)
T ss_pred             CCee-EhhhCcCe----eECCCCCCceeEec
Confidence            3456 78888865    44777777766543


No 313
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only]
Probab=30.64  E-value=12  Score=29.88  Aligned_cols=22  Identities=14%  Similarity=0.223  Sum_probs=17.5

Q ss_pred             cccCCccc-ccCccccccCCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      .|.+|++. +....+||.||.++
T Consensus        26 ~C~~C~~~~~~~~~~C~~C~~~l   48 (225)
T COG1040          26 LCSGCQADLPLIGNLCPLCGLPL   48 (225)
T ss_pred             cChhhhhchhHHHhhhHhhhChh
Confidence            79999987 44334999999994


No 314
>PRK12495 hypothetical protein; Provisional
Probab=30.31  E-value=27  Score=28.89  Aligned_cols=21  Identities=10%  Similarity=0.070  Sum_probs=16.0

Q ss_pred             cccCCccc---ccCccccccCCCC
Q 033276           73 KCLKLFSS---PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~---~~~~~fCp~CG~~   93 (123)
                      .|..|+..   -+...|||.|+..
T Consensus        44 hC~~CG~PIpa~pG~~~Cp~CQ~~   67 (226)
T PRK12495         44 HCDECGDPIFRHDGQEFCPTCQQP   67 (226)
T ss_pred             hcccccCcccCCCCeeECCCCCCc
Confidence            78888886   2456889999866


No 315
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=30.12  E-value=21  Score=28.05  Aligned_cols=24  Identities=17%  Similarity=0.173  Sum_probs=17.0

Q ss_pred             EeeccccCCccc-cc---------CccccccCCCC
Q 033276           69 YIVDKCLKLFSS-PF---------PLVICIKSNHE   93 (123)
Q Consensus        69 wvl~rC~gC~k~-~~---------~~~fCp~CG~~   93 (123)
                      +.+ +|..|.+. +.         ....||.||+.
T Consensus       112 ~~~-~C~~C~~~~~~~~~~~~~~~~~p~C~~Cgg~  145 (222)
T cd01413         112 QTA-YCVNCGSKYDLEEVKYAKKHEVPRCPKCGGI  145 (222)
T ss_pred             Ccc-eECCCCCCcchhHHHHhccCCCCcCCCCCCc
Confidence            345 89999886 21         12469999987


No 316
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=29.88  E-value=31  Score=20.57  Aligned_cols=19  Identities=16%  Similarity=0.392  Sum_probs=12.1

Q ss_pred             cccCCcccccCccccccCCC
Q 033276           73 KCLKLFSSPFPLVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~CG~   92 (123)
                      +|..|.+.. ..-+|..||+
T Consensus         1 ~C~~C~~~~-~l~~CL~C~~   19 (50)
T smart00290        1 RCSVCGTIE-NLWLCLTCGQ   19 (50)
T ss_pred             CcccCCCcC-CeEEecCCCC
Confidence            577777652 2567777774


No 317
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=29.82  E-value=49  Score=19.57  Aligned_cols=18  Identities=11%  Similarity=-0.044  Sum_probs=13.1

Q ss_pred             CCcceeeeEEeeccccCCc
Q 033276           60 GMQIRQLHRYIVDKCLKLF   78 (123)
Q Consensus        60 g~~I~~v~~wvl~rC~gC~   78 (123)
                      ...+.+.++.++ +|+.|.
T Consensus        30 ~~~V~e~~~~~y-~C~~C~   47 (47)
T PF13005_consen   30 KPEVTEHVRHKY-ACPCCG   47 (47)
T ss_pred             ceEEEEEEeceE-ECCCCC
Confidence            455667778888 888874


No 318
>PHA02325 hypothetical protein
Probab=29.66  E-value=25  Score=24.35  Aligned_cols=11  Identities=27%  Similarity=0.380  Sum_probs=8.9

Q ss_pred             CccccccCCCC
Q 033276           83 PLVICIKSNHE   93 (123)
Q Consensus        83 ~~~fCp~CG~~   93 (123)
                      ....||+||..
T Consensus         2 ~~k~CPkC~A~   12 (72)
T PHA02325          2 DTKICPKCGAR   12 (72)
T ss_pred             CccccCccCCE
Confidence            45789999976


No 319
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=29.28  E-value=37  Score=28.43  Aligned_cols=25  Identities=16%  Similarity=0.238  Sum_probs=17.4

Q ss_pred             eEEeeccccCCccc--ccCccccccCCCC
Q 033276           67 HRYIVDKCLKLFSS--PFPLVICIKSNHE   93 (123)
Q Consensus        67 ~~wvl~rC~gC~k~--~~~~~fCp~CG~~   93 (123)
                      ..=.| .|+-|..+  ..+ ..||.||.+
T Consensus       252 v~~Gy-vCs~Clsi~C~~p-~~C~~Cgt~  278 (279)
T TIGR00627       252 VSIGF-VCSVCLSVLCQYT-PICKTCKTA  278 (279)
T ss_pred             ccceE-ECCCccCCcCCCC-CCCCCCCCC
Confidence            33447 88888877  444 479999875


No 320
>PRK14906 DNA-directed RNA polymerase subunit beta'/alpha domain fusion protein; Provisional
Probab=29.24  E-value=20  Score=36.59  Aligned_cols=30  Identities=13%  Similarity=0.188  Sum_probs=21.5

Q ss_pred             eeEEeeccccCCccc---ccCccccccCCCCCeeeEE
Q 033276           66 LHRYIVDKCLKLFSS---PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        66 v~~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~rV   99 (123)
                      ++.|.-    +|+|.   .....+|++||-++|..||
T Consensus        57 ~kd~eC----~CGKyk~~~~~g~~C~~CGVEvt~s~v   89 (1460)
T PRK14906         57 TKDWEC----ACGKYKRIRFKGIVCERCGVEVTRAKV   89 (1460)
T ss_pred             ccCcEE----eCccccccCcCCeEcCCCCcEecchHH
Confidence            456665    67765   3345799999999887766


No 321
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]
Probab=29.04  E-value=39  Score=31.25  Aligned_cols=71  Identities=20%  Similarity=0.230  Sum_probs=40.8

Q ss_pred             EEecccHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc--ccCccccccCCCCCeeeEEEEEee---------
Q 033276           36 ACITGDYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS--PFPLVICIKSNHEIRISPVFMLIL---------  104 (123)
Q Consensus        36 a~vTdDyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~--~~~~~fCp~CG~~~tl~rV~~~~~---------  104 (123)
                      |..-.||----=|.|.-     -. .+-..+  =+. +|..|++.  -..+-.| .||+++-+.-+.=++-         
T Consensus       104 a~ye~dfe~i~~leqyh-----ya-s~k~~v--a~w-~c~~cg~~iean~kp~c-~cg~~~~~~ei~gs~pasrf~i~el  173 (593)
T COG2401         104 ATYEEDFEFIAELEQYH-----YA-SQKEKV--ALW-RCEKCGTIIEANTKPEC-KCGSHVHILEIKGSTPASRFLIVEL  173 (593)
T ss_pred             hhHHHHHHHHHHHHHhh-----hc-cccceE--EEE-ecchhchhhhhcCCccc-CCCCceEEEEeecCCcchheeeeeh
Confidence            56667776443344421     11 111233  334 99999997  3446789 9999865554432221         


Q ss_pred             ---------EEEEEeeCCccc
Q 033276          105 ---------ICLYIQVDTEMP  116 (123)
Q Consensus       105 ---------~~~~~~~~~~~~  116 (123)
                               +--|+.+|.-||
T Consensus       174 ~~r~~yep~i~ayvrvdppip  194 (593)
T COG2401         174 VKREEYEPRILAYVRVDPPIP  194 (593)
T ss_pred             hcCCcCCcceEEEEecCCCch
Confidence                     234777777777


No 322
>TIGR00575 dnlj DNA ligase, NAD-dependent. The member of this family from Treponema pallidum differs in having three rather than just one copy of the BRCT (BRCA1 C Terminus) domain (pfam00533) at the C-terminus. It is included in the seed.
Probab=28.56  E-value=96  Score=28.77  Aligned_cols=47  Identities=17%  Similarity=0.321  Sum_probs=27.9

Q ss_pred             HHHHHhCcee-----eCCCCCcceeeeEEeeccccCCcc-c-ccCccccccCCCCC
Q 033276           46 NVILQMGLRL-----LAPGGMQIRQLHRYIVDKCLKLFS-S-PFPLVICIKSNHEI   94 (123)
Q Consensus        46 NVllqlGL~l-----~sv~g~~I~~v~~wvl~rC~gC~k-~-~~~~~fCp~CG~~~   94 (123)
                      +-+.++||++     +.-.|.-|-++..-+. .=..=.. . .++ ..||.||+++
T Consensus       349 ~~i~~~~i~iGD~V~V~raGdVIP~i~~vv~-~~r~~~~~~~~~P-~~CP~C~s~l  402 (652)
T TIGR00575       349 DEIEELDIRIGDTVVVRKAGDVIPKVVRVLL-EKRTGSERPIRFP-THCPSCGSPL  402 (652)
T ss_pred             HHHHHcCCCCCCEEEEEecCCcCceeeeecc-ccCCCCCCCCCCC-CCCCCCCCEe
Confidence            3467788764     2235888888877554 2111111 1 334 5899999994


No 323
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]
Probab=28.44  E-value=30  Score=27.18  Aligned_cols=14  Identities=7%  Similarity=0.384  Sum_probs=12.3

Q ss_pred             ccccccCCCCCeee
Q 033276           84 LVICIKSNHEIRIS   97 (123)
Q Consensus        84 ~~fCp~CG~~~tl~   97 (123)
                      ..||..||++.+||
T Consensus        89 ~r~CARCGGrv~lr  102 (169)
T KOG3799|consen   89 TRFCARCGGRVSLR  102 (169)
T ss_pred             hhHHHhcCCeeeec
Confidence            58999999998877


No 324
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=28.29  E-value=31  Score=28.21  Aligned_cols=11  Identities=18%  Similarity=0.313  Sum_probs=8.9

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      .+-||.||+++
T Consensus       244 g~pCprCG~~I  254 (272)
T PRK14810        244 GEPCLNCKTPI  254 (272)
T ss_pred             CCcCCCCCCee
Confidence            46799999884


No 325
>PTZ00410 NAD-dependent SIR2; Provisional
Probab=27.87  E-value=63  Score=28.00  Aligned_cols=35  Identities=9%  Similarity=0.199  Sum_probs=21.4

Q ss_pred             EeeccccCCccc-cc----------CccccccCCCCCeeeEEEEEeeEE
Q 033276           69 YIVDKCLKLFSS-PF----------PLVICIKSNHEIRISPVFMLILIC  106 (123)
Q Consensus        69 wvl~rC~gC~k~-~~----------~~~fCp~CG~~~tl~rV~~~~~~~  106 (123)
                      +.. +|..|.+. +.          ....||.||+.  +|.=-|..|+.
T Consensus       146 ~~~-~C~~C~~~~~~~~~~~~~~~~~vP~C~~CgG~--lRPdVVlFGE~  191 (349)
T PTZ00410        146 SAA-SCIECHTPYDIEQAYLEARSGKVPHCSTCGGI--VKPDVVFFGEN  191 (349)
T ss_pred             Cee-EeCCCCCCcchhHHHHHhhcCCCCCCCCCCCc--cCCcEEecCCc
Confidence            345 89999975 31          12359999986  44444445554


No 326
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=27.73  E-value=42  Score=22.05  Aligned_cols=20  Identities=10%  Similarity=0.057  Sum_probs=13.2

Q ss_pred             ccCCccc--ccCccccccCCCC
Q 033276           74 CLKLFSS--PFPLVICIKSNHE   93 (123)
Q Consensus        74 C~gC~k~--~~~~~fCp~CG~~   93 (123)
                      |+-|.+.  ....-.||.||-+
T Consensus         2 Cpv~~~~~~~~v~~~Cp~cGip   23 (55)
T PF13824_consen    2 CPVCKKDLPAHVNFECPDCGIP   23 (55)
T ss_pred             CCCCccccccccCCcCCCCCCc
Confidence            6667663  1234569999987


No 327
>COG3529 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=27.60  E-value=17  Score=24.76  Aligned_cols=21  Identities=24%  Similarity=0.496  Sum_probs=17.1

Q ss_pred             cccCCccc---------ccCccccccCCCC
Q 033276           73 KCLKLFSS---------PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~---------~~~~~fCp~CG~~   93 (123)
                      .|++|...         ..+...|-+||+.
T Consensus        12 ~CP~C~~~Dtl~mW~En~ve~vECV~CG~~   41 (66)
T COG3529          12 VCPACQAQDTLAMWRENNVEIVECVKCGHH   41 (66)
T ss_pred             CCcccchhhHHHHHHhcCCceEehhhcchH
Confidence            79999975         2457899999987


No 328
>PF07131 DUF1382:  Protein of unknown function (DUF1382);  InterPro: IPR009814 This entry is represented by Bacteriophage lambda, Xis. This entry overlaps with IPR009750, both representing lambda Xis. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several hypothetical Escherichia coli and Bacteriophage lambda-like proteins of around 60 residues in length. The function of this family is unknown.
Probab=27.54  E-value=49  Score=22.34  Aligned_cols=17  Identities=18%  Similarity=0.464  Sum_probs=14.5

Q ss_pred             HHHHHHHHhCceeeCCC
Q 033276           43 AMQNVILQMGLRLLAPG   59 (123)
Q Consensus        43 AmQNVllqlGL~l~sv~   59 (123)
                      -|-|.|.|.||+|+++.
T Consensus        14 E~A~~La~~GIRFVpiP   30 (61)
T PF07131_consen   14 EMAHSLAHIGIRFVPIP   30 (61)
T ss_pred             HHHHHHHHcCceeeccc
Confidence            46789999999999863


No 329
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=27.40  E-value=11  Score=26.61  Aligned_cols=21  Identities=10%  Similarity=0.205  Sum_probs=11.6

Q ss_pred             cccCCccc--ccCccccccCCCC
Q 033276           73 KCLKLFSS--PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~--~~~~~fCp~CG~~   93 (123)
                      .|..|+..  .+..+-||.|+++
T Consensus        38 vCr~CyEYErkeg~q~CpqCkt~   60 (80)
T PF14569_consen   38 VCRPCYEYERKEGNQVCPQCKTR   60 (80)
T ss_dssp             --HHHHHHHHHTS-SB-TTT--B
T ss_pred             cchhHHHHHhhcCcccccccCCC
Confidence            56677765  5677999999977


No 330
>PRK12267 methionyl-tRNA synthetase; Reviewed
Probab=27.26  E-value=94  Score=28.19  Aligned_cols=57  Identities=12%  Similarity=0.142  Sum_probs=32.1

Q ss_pred             HHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc-ccC----ccccccCCCCCeeeEEEEEeeEEEEEee
Q 033276           43 AMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFP----LVICIKSNHEIRISPVFMLILICLYIQV  111 (123)
Q Consensus        43 AmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~----~~fCp~CG~~~tl~rV~~~~~~~~~~~~  111 (123)
                      .+|.+..+|=    . .| .|. .+.+...+|..|.+. +..    ...||.||+++..+..     ...|++.
T Consensus       104 ~v~~~~~~L~----~-kG-~IY-~~~~~~~yc~~~~~~l~~~~l~~~~~c~~cg~~~e~~~~-----~~~f~~l  165 (648)
T PRK12267        104 VVQKIFEKLY----E-QG-DIY-KGEYEGWYCVSCETFFTESQLVDGGKCPDCGREVELVKE-----ESYFFRM  165 (648)
T ss_pred             HHHHHHHHHH----H-CC-CEE-EeeEEEeecCCCCccCChHHhccCCcCCCCCCcCeEEec-----ceEEEEc
Confidence            4566666551    0 22 233 334444389999987 321    1579999999543332     3556553


No 331
>PRK03922 hypothetical protein; Provisional
Probab=27.21  E-value=47  Score=24.90  Aligned_cols=14  Identities=29%  Similarity=0.418  Sum_probs=11.2

Q ss_pred             cccCccccccCCCC
Q 033276           80 SPFPLVICIKSNHE   93 (123)
Q Consensus        80 ~~~~~~fCp~CG~~   93 (123)
                      ++.....||.||.+
T Consensus        45 ievG~~~cP~cge~   58 (113)
T PRK03922         45 VEVGLTICPKCGEP   58 (113)
T ss_pred             EecCcccCCCCCCc
Confidence            45666889999998


No 332
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning]
Probab=27.17  E-value=80  Score=27.21  Aligned_cols=45  Identities=18%  Similarity=0.239  Sum_probs=27.6

Q ss_pred             eEEecc--cHHHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc-ccCccccccCCCCC
Q 033276           35 VACITG--DYAMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        35 va~vTd--DyAmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      ++++|+  +.|+|-|.+.+++  .     +-.+++-...        + +|.+-.||+||+.+
T Consensus       185 AviVTTPQ~vAl~Dv~K~i~f--c-----~K~~I~ilGv--------VENMs~f~Cp~C~~~~  232 (300)
T KOG3022|consen  185 AVIVTTPQEVALQDVRKEIDF--C-----RKAGIPILGV--------VENMSGFVCPKCGHST  232 (300)
T ss_pred             eEEEeCchhhhhHHHHhhhhh--h-----hhcCCceEEE--------EeccccccCCCCCCcc
Confidence            567775  7888888877542  1     1111222222        3 67788899999884


No 333
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=27.11  E-value=56  Score=25.69  Aligned_cols=39  Identities=13%  Similarity=0.117  Sum_probs=26.7

Q ss_pred             cccCCccc-----c----------cCccccccCCCC-CeeeEEEEEeeEEEEEeeCC
Q 033276           73 KCLKLFSS-----P----------FPLVICIKSNHE-IRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        73 rC~gC~k~-----~----------~~~~fCp~CG~~-~tl~rV~~~~~~~~~~~~~~  113 (123)
                      +|+-|+..     |          --+..|+.||.. +|..|+...+.  +-||-||
T Consensus         2 ~CPfC~~~~tkViDSR~~edg~aIRRRReC~~C~~RFTTfE~~El~~~--~VvKkdg   56 (156)
T COG1327           2 KCPFCGHEDTKVIDSRPAEEGNAIRRRRECLECGERFTTFERAELRPL--IVVKKDG   56 (156)
T ss_pred             CCCCCCCCCCeeeecccccccchhhhhhcccccccccchhheeeeccc--eEECcCC
Confidence            79999865     1          015789999976 46677765543  3578777


No 334
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.11  E-value=38  Score=25.10  Aligned_cols=20  Identities=20%  Similarity=0.318  Sum_probs=15.4

Q ss_pred             cccCCccc--ccCccccccCCCC
Q 033276           73 KCLKLFSS--PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~--~~~~~fCp~CG~~   93 (123)
                      .|+-|+..  ..+ ..||+||-.
T Consensus         3 ~CPrC~skvC~LP-~~CpiCgLt   24 (112)
T TIGR00622         3 FCPQCRAKVCELP-VECPICGLT   24 (112)
T ss_pred             cCCCCCCCccCCC-CcCCcCCCE
Confidence            78899865  555 679999855


No 335
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=26.91  E-value=37  Score=26.83  Aligned_cols=21  Identities=10%  Similarity=0.222  Sum_probs=9.8

Q ss_pred             CCCCcceeeeEEeeccccCCcc
Q 033276           58 PGGMQIRQLHRYIVDKCLKLFS   79 (123)
Q Consensus        58 v~g~~I~~v~~wvl~rC~gC~k   79 (123)
                      +++..+++-+.|.+ +|.+|+.
T Consensus       107 pdT~l~k~~~~~~l-~C~aCGa  127 (201)
T PRK12336        107 PDTRLVKEDRVLML-RCDACGA  127 (201)
T ss_pred             CCcEEEEcCCeEEE-EcccCCC
Confidence            34444444444555 5555554


No 336
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=26.89  E-value=29  Score=20.90  Aligned_cols=10  Identities=10%  Similarity=-0.021  Sum_probs=8.1

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      .-||.||++-
T Consensus         4 ~pCP~CGG~D   13 (37)
T smart00778        4 GPCPNCGGSD   13 (37)
T ss_pred             cCCCCCCCcc
Confidence            4599999984


No 337
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=26.60  E-value=14  Score=32.74  Aligned_cols=34  Identities=18%  Similarity=0.274  Sum_probs=22.0

Q ss_pred             eeeEEeeccccCCccc----c--cCccccccCCCCCeeeEE
Q 033276           65 QLHRYIVDKCLKLFSS----P--FPLVICIKSNHEIRISPV   99 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~----~--~~~~fCp~CG~~~tl~rV   99 (123)
                      ++-+|-+..|..|++.    +  ..+--||+||+. ..+-|
T Consensus       240 ~LGKY~~TAC~rC~t~y~le~A~~~~wrCpkCGg~-ikKGV  279 (403)
T COG1379         240 RLGKYHLTACSRCYTRYSLEEAKSLRWRCPKCGGK-IKKGV  279 (403)
T ss_pred             cccchhHHHHHHhhhccCcchhhhhcccCcccccc-hhhhH
Confidence            3444544489999965    1  224679999997 44433


No 338
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=26.58  E-value=44  Score=25.29  Aligned_cols=31  Identities=13%  Similarity=0.151  Sum_probs=22.2

Q ss_pred             CcceeeeEEeeccccCCcccccCccccccCCCCC
Q 033276           61 MQIRQLHRYIVDKCLKLFSSPFPLVICIKSNHEI   94 (123)
Q Consensus        61 ~~I~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~~   94 (123)
                      ..+..+..|   .|.-|..--...++||.||.-+
T Consensus        90 ~pv~~~~~W---~Cv~C~~~Y~GeK~C~~C~tGi  120 (128)
T PF11682_consen   90 DPVPRKTDW---HCVMCGNHYHGEKYCPKCGTGI  120 (128)
T ss_pred             CCCCcCceE---EEecCCCccCcCEecCCCCCcc
Confidence            334455566   7899998734468999999874


No 339
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=26.24  E-value=47  Score=18.22  Aligned_cols=10  Identities=20%  Similarity=0.222  Sum_probs=5.1

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      +-||.||+.+
T Consensus         2 ~~C~rC~~~~   11 (30)
T PF06827_consen    2 EKCPRCWNYI   11 (30)
T ss_dssp             SB-TTT--BB
T ss_pred             CcCccCCCcc
Confidence            4599999984


No 340
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=26.20  E-value=35  Score=27.71  Aligned_cols=20  Identities=10%  Similarity=0.188  Sum_probs=13.9

Q ss_pred             ccccCCCCCeeeEEEEEeeEEE
Q 033276           86 ICIKSNHEIRISPVFMLILICL  107 (123)
Q Consensus        86 fCp~CG~~~tl~rV~~~~~~~~  107 (123)
                      .||.||+.  ||.=-|..|+.+
T Consensus       171 ~C~~Cgg~--lrP~VV~FGE~l  190 (260)
T cd01409         171 ECERCGGV--LKPDVVFFGENV  190 (260)
T ss_pred             CCCCCCCE--ECCCEEECCCCC
Confidence            59999965  666666666643


No 341
>PF00609 DAGK_acc:  Diacylglycerol kinase accessory domain;  InterPro: IPR000756 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Diacylglycerol (DAG) is a second messenger that acts as a protein kinase C activator. The DAG kinase domain is assumed to be an accessory domain. Upon cell stimulation, DAG kinase converts DAG into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity. It catalyses the reaction: ATP + 1,2-diacylglycerol = ADP + 1,2-diacylglycerol 3-phosphate. The enzyme is stimulated by calcium and phosphatidylserine and phosphorylated by protein kinase C. This domain is always associated with IPR001206 from INTERPRO.; GO: 0004143 diacylglycerol kinase activity, 0007205 activation of protein kinase C activity by G-protein coupled receptor protein signaling pathway
Probab=26.15  E-value=56  Score=24.30  Aligned_cols=9  Identities=44%  Similarity=0.379  Sum_probs=7.9

Q ss_pred             EEEEeeCCc
Q 033276          106 CLYIQVDTE  114 (123)
Q Consensus       106 ~~~~~~~~~  114 (123)
                      .+|+|+|||
T Consensus       152 ~~~~QvDGE  160 (161)
T PF00609_consen  152 KVPFQVDGE  160 (161)
T ss_pred             ceeEEeCCC
Confidence            569999998


No 342
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=26.10  E-value=50  Score=24.32  Aligned_cols=14  Identities=29%  Similarity=0.306  Sum_probs=10.3

Q ss_pred             cccCccccccCCCC
Q 033276           80 SPFPLVICIKSNHE   93 (123)
Q Consensus        80 ~~~~~~fCp~CG~~   93 (123)
                      ++.....||.||.+
T Consensus        43 IevG~~~cP~Cge~   56 (102)
T PF04475_consen   43 IEVGDTICPKCGEE   56 (102)
T ss_pred             EecCcccCCCCCCc
Confidence            34556779999988


No 343
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=25.86  E-value=45  Score=20.75  Aligned_cols=11  Identities=9%  Similarity=-0.161  Sum_probs=8.7

Q ss_pred             cccccCCCCCe
Q 033276           85 VICIKSNHEIR   95 (123)
Q Consensus        85 ~fCp~CG~~~t   95 (123)
                      +-||.||++..
T Consensus         2 kPCPfCGg~~~   12 (53)
T TIGR03655         2 KPCPFCGGADV   12 (53)
T ss_pred             CCCCCCCCcce
Confidence            45999999854


No 344
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=25.57  E-value=32  Score=28.97  Aligned_cols=15  Identities=13%  Similarity=0.284  Sum_probs=5.4

Q ss_pred             ccccccCCCCCeeeEE
Q 033276           84 LVICIKSNHEIRISPV   99 (123)
Q Consensus        84 ~~fCp~CG~~~tl~rV   99 (123)
                      -.+||.||+. .|.+.
T Consensus        31 n~yCP~Cg~~-~L~~f   45 (254)
T PF06044_consen   31 NMYCPNCGSK-PLSKF   45 (254)
T ss_dssp             H---TTT--S-S-EE-
T ss_pred             CCcCCCCCCh-hHhhc
Confidence            3678888888 55543


No 345
>PRK10445 endonuclease VIII; Provisional
Probab=25.57  E-value=41  Score=27.33  Aligned_cols=11  Identities=18%  Similarity=0.147  Sum_probs=8.4

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      .+-||.||.++
T Consensus       235 g~~Cp~Cg~~I  245 (263)
T PRK10445        235 GEACERCGGII  245 (263)
T ss_pred             CCCCCCCCCEe
Confidence            46699999884


No 346
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=25.57  E-value=30  Score=22.56  Aligned_cols=25  Identities=8%  Similarity=0.095  Sum_probs=16.9

Q ss_pred             cccCCccc--cc-----CccccccCCCCCeee
Q 033276           73 KCLKLFSS--PF-----PLVICIKSNHEIRIS   97 (123)
Q Consensus        73 rC~gC~k~--~~-----~~~fCp~CG~~~tl~   97 (123)
                      ||..|.+.  ..     -..-||.||.-..++
T Consensus         6 RC~~CnklLa~~g~~~~leIKCpRC~tiN~~~   37 (51)
T PF10122_consen    6 RCGHCNKLLAKAGEVIELEIKCPRCKTINHVR   37 (51)
T ss_pred             eccchhHHHhhhcCccEEEEECCCCCccceEe
Confidence            89999987  21     134699999654333


No 347
>cd07973 Spt4 Transcription elongation factor Spt4. Spt4 is a transcription elongation factor. Three transcription-elongation factors Spt4, Spt5, and Spt6, are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles.   Spt4 functions entirely in the context of the Spt4-Spt5 heterodimer and it has been found only as a complex to Spt5 in Yeast and Human. Spt4 is a small protein that has zinc finger at the N-terminus.   Spt5 is a large protein that has several interesting structural features of an acidic N-terminus, a single NGN domain, five or six KOW domains, and a set of simple C-termianl repeats. Spt4 binds to Spt5 NGN domain. Unlike Spt5, Spt4 is not essential for viability in yeast, however Spt4 is critical for normal function of the Spt4-Spt5 compl
Probab=25.54  E-value=36  Score=24.48  Aligned_cols=19  Identities=21%  Similarity=0.221  Sum_probs=14.1

Q ss_pred             cccCCccc-c---cCccccccCC
Q 033276           73 KCLKLFSS-P---FPLVICIKSN   91 (123)
Q Consensus        73 rC~gC~k~-~---~~~~fCp~CG   91 (123)
                      .|..|..+ .   ....-||+||
T Consensus         5 AC~~C~~I~~~~qf~~~gCpnC~   27 (98)
T cd07973           5 ACLLCSLIKTEDQFERDGCPNCE   27 (98)
T ss_pred             hhccCCcccccccccCCCCCCCc
Confidence            69999987 2   2345799995


No 348
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=25.51  E-value=7  Score=30.71  Aligned_cols=34  Identities=18%  Similarity=0.167  Sum_probs=19.3

Q ss_pred             CCCcceeeeEEe----eccccCCcccccCccccccCCCCC
Q 033276           59 GGMQIRQLHRYI----VDKCLKLFSSPFPLVICIKSNHEI   94 (123)
Q Consensus        59 ~g~~I~~v~~wv----l~rC~gC~k~~~~~~fCp~CG~~~   94 (123)
                      +|..|..-..|-    .+.|..|++.  ...-||.|++++
T Consensus        12 NGH~~t~~~~~~p~~~~~fC~kCG~~--tI~~Cp~C~~~I   49 (158)
T PF10083_consen   12 NGHVITDSYDKNPELREKFCSKCGAK--TITSCPNCSTPI   49 (158)
T ss_pred             CccccccccccCchHHHHHHHHhhHH--HHHHCcCCCCCC
Confidence            455554433332    2357788865  224588888884


No 349
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms. Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. This model identifies both archaeal (aRF1) and eukaryotic (eRF1) of the protein. Also known as translation termination factor 1.
Probab=25.50  E-value=48  Score=28.87  Aligned_cols=27  Identities=22%  Similarity=0.176  Sum_probs=19.6

Q ss_pred             eEEeeccccCCccc-c--------cCccccccCCCCC
Q 033276           67 HRYIVDKCLKLFSS-P--------FPLVICIKSNHEI   94 (123)
Q Consensus        67 ~~wvl~rC~gC~k~-~--------~~~~fCp~CG~~~   94 (123)
                      .++.+ ||..|+.. .        ....+||.||.++
T Consensus       317 ~r~~~-rc~~c~~~~~~~~~~~~~~~~~~~~~~~~~~  352 (403)
T TIGR03676       317 IRVTF-KCPNCGYEEEKTVKPEEGDKSEACPKCGSEL  352 (403)
T ss_pred             eeEEE-EcCCCCcceeeecccccccccccCcccCccc
Confidence            35788 99999875 1        1125799999884


No 350
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=25.43  E-value=23  Score=22.24  Aligned_cols=15  Identities=20%  Similarity=0.390  Sum_probs=11.2

Q ss_pred             ccCccccccCCCCCe
Q 033276           81 PFPLVICIKSNHEIR   95 (123)
Q Consensus        81 ~~~~~fCp~CG~~~t   95 (123)
                      +.+...||.||-+.+
T Consensus         5 ~lp~K~C~~C~rpf~   19 (42)
T PF10013_consen    5 NLPSKICPVCGRPFT   19 (42)
T ss_pred             cCCCCcCcccCCcch
Confidence            455688999998854


No 351
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=25.13  E-value=69  Score=23.70  Aligned_cols=13  Identities=31%  Similarity=0.715  Sum_probs=9.7

Q ss_pred             ccccccCCCCCeee
Q 033276           84 LVICIKSNHEIRIS   97 (123)
Q Consensus        84 ~~fCp~CG~~~tl~   97 (123)
                      +-.||.||+. ++.
T Consensus        22 ~FtCp~Cghe-~vs   34 (104)
T COG4888          22 TFTCPRCGHE-KVS   34 (104)
T ss_pred             eEecCccCCe-eee
Confidence            4569999998 443


No 352
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=25.11  E-value=73  Score=24.71  Aligned_cols=39  Identities=13%  Similarity=0.083  Sum_probs=25.2

Q ss_pred             cccCCccc-----c-----c-----CccccccCCCC-CeeeEEEEEeeEEEEEeeCC
Q 033276           73 KCLKLFSS-----P-----F-----PLVICIKSNHE-IRISPVFMLILICLYIQVDT  113 (123)
Q Consensus        73 rC~gC~k~-----~-----~-----~~~fCp~CG~~-~tl~rV~~~~~~~~~~~~~~  113 (123)
                      +||-|+..     +     .     -+..|+.||.. +|..|+.....  .-||.||
T Consensus         2 ~CP~C~~~dtkViDSR~~~dg~~IRRRReC~~C~~RFTTyErve~~~l--~ViKkdG   56 (147)
T TIGR00244         2 HCPFCQHHNTRVLDSRLVEDGQSIRRRRECLECHERFTTFERAELLPP--TVIKQDG   56 (147)
T ss_pred             CCCCCCCCCCEeeeccccCCCCeeeecccCCccCCccceeeecccccc--EEEcCCC
Confidence            78999874     1     1     15789999976 45666654332  2578887


No 353
>PRK14289 chaperone protein DnaJ; Provisional
Probab=25.10  E-value=1.2e+02  Score=25.89  Aligned_cols=31  Identities=6%  Similarity=0.006  Sum_probs=19.7

Q ss_pred             eeeeEEeeccccCCccc----ccCccccccCCCCC
Q 033276           64 RQLHRYIVDKCLKLFSS----PFPLVICIKSNHEI   94 (123)
Q Consensus        64 ~~v~~wvl~rC~gC~k~----~~~~~fCp~CG~~~   94 (123)
                      ++++-.....|..|.-.    ......||.|+...
T Consensus       147 ~~i~~~r~~~C~~C~G~G~~~~~~~~~C~~C~G~G  181 (386)
T PRK14289        147 KKFKVKKYVPCSHCHGTGAEGNNGSETCPTCKGSG  181 (386)
T ss_pred             EEEEEEeecccCCCCCCCCCCCCCCCcCCCCcCeE
Confidence            33333333368888654    34468899999884


No 354
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=24.91  E-value=53  Score=25.61  Aligned_cols=45  Identities=9%  Similarity=0.029  Sum_probs=32.5

Q ss_pred             HHHHhCceeeCCCCCcceeeeEEeeccccCCccc--ccCccccccCCCC
Q 033276           47 VILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS--PFPLVICIKSNHE   93 (123)
Q Consensus        47 VllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~--~~~~~fCp~CG~~   93 (123)
                      |+++.|..--.. |.-.+.-..=+| .|-+|.+.  ....+|...||=|
T Consensus        32 v~RekgTE~p~t-Gey~~~~e~GvY-~C~~C~~pLykS~tKfdsgcGWP   78 (146)
T KOG0856|consen   32 VLREKGTERPGT-GEYTKHFEEGVY-VCAGCGTPLYKSTTKFDSGCGWP   78 (146)
T ss_pred             hhHhhcccCCCC-cccccccCCceE-EEeecCCccccccccccCCCCCc
Confidence            677887643322 444444566789 99999998  6777999999965


No 355
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E. coli CobB; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. CobB is a bacterial sirtuin that deacetylates acetyl-CoA synthetase at an active site lysine to stimulate its enzymatic activity.
Probab=24.75  E-value=62  Score=25.11  Aligned_cols=24  Identities=21%  Similarity=0.180  Sum_probs=17.0

Q ss_pred             EeeccccCCccc-cc-------CccccccCCCC
Q 033276           69 YIVDKCLKLFSS-PF-------PLVICIKSNHE   93 (123)
Q Consensus        69 wvl~rC~gC~k~-~~-------~~~fCp~CG~~   93 (123)
                      ..+ +|..|.+. ..       ....||.||+.
T Consensus       108 ~~~-~C~~C~~~~~~~~~~~~~~~p~C~~Cgg~  139 (224)
T cd01412         108 FRV-RCSSCGYVGENNEEIPEEELPRCPKCGGL  139 (224)
T ss_pred             Ccc-ccCCCCCCCCcchhhhccCCCCCCCCCCc
Confidence            346 89999986 21       12469999987


No 356
>PRK13795 hypothetical protein; Provisional
Probab=24.75  E-value=79  Score=29.03  Aligned_cols=32  Identities=19%  Similarity=-0.003  Sum_probs=23.3

Q ss_pred             eeEEeeccccCCcccccCccccccCCCCCeeeEEEE
Q 033276           66 LHRYIVDKCLKLFSSPFPLVICIKSNHEIRISPVFM  101 (123)
Q Consensus        66 v~~wvl~rC~gC~k~~~~~~fCp~CG~~~tl~rV~~  101 (123)
                      -+.|++ .|..|.-+ .-...|..||++ + ++|.+
T Consensus         8 ~~~~~~-wc~~cn~p-~~~~~c~~c~~~-~-~~~~~   39 (636)
T PRK13795          8 GKDHIY-WCEKCNVP-LLGKKCGICGKE-G-FKVRL   39 (636)
T ss_pred             cceeEE-EcccCCCe-eccccccccCCC-c-eEeec
Confidence            457899 99999865 222459999999 4 66654


No 357
>KOG3475 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=24.29  E-value=25  Score=25.40  Aligned_cols=32  Identities=9%  Similarity=0.079  Sum_probs=22.9

Q ss_pred             eeeeEEeeccccCCccc--ccCccccccCCCCCeee
Q 033276           64 RQLHRYIVDKCLKLFSS--PFPLVICIKSNHEIRIS   97 (123)
Q Consensus        64 ~~v~~wvl~rC~gC~k~--~~~~~fCp~CG~~~tl~   97 (123)
                      ++-+...+  |.-|++.  ..-+.-|..||.|.-.+
T Consensus        11 r~nkshtl--C~RCG~~syH~QKstC~~CGYpaak~   44 (92)
T KOG3475|consen   11 RHNKSHTL--CRRCGRRSYHIQKSTCSSCGYPAAKK   44 (92)
T ss_pred             ccccchHH--HHHhCchhhhhhcccccccCCcchhc
Confidence            34445555  9999987  56678899999994433


No 358
>PRK04011 peptide chain release factor 1; Provisional
Probab=24.28  E-value=53  Score=28.61  Aligned_cols=26  Identities=27%  Similarity=0.379  Sum_probs=19.8

Q ss_pred             EEeeccccCCccc---------ccCccccccCCCCC
Q 033276           68 RYIVDKCLKLFSS---------PFPLVICIKSNHEI   94 (123)
Q Consensus        68 ~wvl~rC~gC~k~---------~~~~~fCp~CG~~~   94 (123)
                      ++.+ +|+.|+..         ......||.||.++
T Consensus       326 r~~~-~c~~c~~~~~~~~~~~~~~~~~~c~~~~~~~  360 (411)
T PRK04011        326 RVTY-KCPNCGYEEEKTVKRREELPEKTCPKCGSEL  360 (411)
T ss_pred             eEEE-EcCCCCcceeeecccccccccccCcccCccc
Confidence            5788 99999875         12356899999883


No 359
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=24.25  E-value=40  Score=20.62  Aligned_cols=10  Identities=10%  Similarity=-0.084  Sum_probs=5.6

Q ss_pred             cccccCCCCC
Q 033276           85 VICIKSNHEI   94 (123)
Q Consensus        85 ~fCp~CG~~~   94 (123)
                      .-||.||.+.
T Consensus         4 ~pCP~CGG~D   13 (40)
T PF08273_consen    4 GPCPICGGKD   13 (40)
T ss_dssp             E--TTTT-TT
T ss_pred             CCCCCCcCcc
Confidence            4599999984


No 360
>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases. Valine amino-acyl tRNA synthetase (ValRS) catalytic core domain. This enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.  ValRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
Probab=24.16  E-value=1.9e+02  Score=24.45  Aligned_cols=45  Identities=22%  Similarity=0.321  Sum_probs=29.4

Q ss_pred             cceeeeEEeeccccCCcccccCccccccCCCCCeeeEEEEEeeEEEEEeeC
Q 033276           62 QIRQLHRYIVDKCLKLFSSPFPLVICIKSNHEIRISPVFMLILICLYIQVD  112 (123)
Q Consensus        62 ~I~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~~  112 (123)
                      .|-+-..-++ .|+.|.+.-...+.|..||+++.     ...-...|++..
T Consensus       132 ~iy~~~~~~~-yc~~~~t~l~~~evc~~cg~~~~-----~~~~~qwf~~l~  176 (382)
T cd00817         132 LIYRDNRLVN-WCPKLRTAISDIEVCSRSGDVIE-----PLLKPQWFVKVK  176 (382)
T ss_pred             CEEeeeeEEe-ecCCcCCCCCcchhcccCCCeEE-----EEecCeeEEehH
Confidence            3555566778 99999988223466999998832     233455666643


No 361
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.15  E-value=46  Score=27.12  Aligned_cols=12  Identities=17%  Similarity=0.196  Sum_probs=9.1

Q ss_pred             ccccccCCCCCe
Q 033276           84 LVICIKSNHEIR   95 (123)
Q Consensus        84 ~~fCp~CG~~~t   95 (123)
                      .+-||.||.++.
T Consensus       245 g~pC~~Cg~~I~  256 (272)
T TIGR00577       245 GEPCRRCGTPIE  256 (272)
T ss_pred             CCCCCCCCCeeE
Confidence            467999998843


No 362
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=24.14  E-value=54  Score=29.56  Aligned_cols=29  Identities=24%  Similarity=0.393  Sum_probs=21.5

Q ss_pred             eeEEeeccccCCccc-cc---------------CccccccCCCCCe
Q 033276           66 LHRYIVDKCLKLFSS-PF---------------PLVICIKSNHEIR   95 (123)
Q Consensus        66 v~~wvl~rC~gC~k~-~~---------------~~~fCp~CG~~~t   95 (123)
                      .++|-. .|+.|+.. .+               .+..||.||..+.
T Consensus       196 qr~~~v-pCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~Cg~~i~  240 (557)
T PF05876_consen  196 QRRYYV-PCPHCGEEQVLEWENLKWDKGEAPETARYVCPHCGCEIE  240 (557)
T ss_pred             ceEEEc-cCCCCCCCccccccceeecCCCCccceEEECCCCcCCCC
Confidence            458988 99999975 11               2457999998754


No 363
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=24.05  E-value=41  Score=30.11  Aligned_cols=32  Identities=22%  Similarity=0.236  Sum_probs=20.8

Q ss_pred             cceeeeEEee--ccccCCccc-ccC---ccccccCCCC
Q 033276           62 QIRQLHRYIV--DKCLKLFSS-PFP---LVICIKSNHE   93 (123)
Q Consensus        62 ~I~~v~~wvl--~rC~gC~k~-~~~---~~fCp~CG~~   93 (123)
                      +|.++-+|..  .+|+-|++. ...   .--||+||..
T Consensus       339 ~v~~l~~~~~~~p~Cp~Cg~~m~S~G~~g~rC~kCg~~  376 (421)
T COG1571         339 QVLKLARYERVNPVCPRCGGRMKSAGRNGFRCKKCGTR  376 (421)
T ss_pred             EEEEeeeeEEcCCCCCccCCchhhcCCCCccccccccc
Confidence            4444444543  379999987 221   3569999976


No 364
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=23.98  E-value=43  Score=20.24  Aligned_cols=21  Identities=19%  Similarity=0.137  Sum_probs=8.8

Q ss_pred             cccC--Cccc---c--cCc--cccccCCCC
Q 033276           73 KCLK--LFSS---P--FPL--VICIKSNHE   93 (123)
Q Consensus        73 rC~g--C~k~---~--~~~--~fCp~CG~~   93 (123)
                      .|+.  |...   +  ...  ..|+.||..
T Consensus        20 ~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~   49 (64)
T PF01485_consen   20 WCPNPDCEYIIEKDDGCNSPIVTCPSCGTE   49 (64)
T ss_dssp             --TTSST---ECS-SSTTS--CCTTSCCSE
T ss_pred             CCCCCCCcccEEecCCCCCCeeECCCCCCc
Confidence            5766  7765   1  112  567777765


No 365
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional
Probab=23.97  E-value=36  Score=28.02  Aligned_cols=33  Identities=12%  Similarity=0.190  Sum_probs=19.4

Q ss_pred             EeeccccCCccc-ccC--------------ccccccCCCCCeeeEEEEEeeE
Q 033276           69 YIVDKCLKLFSS-PFP--------------LVICIKSNHEIRISPVFMLILI  105 (123)
Q Consensus        69 wvl~rC~gC~k~-~~~--------------~~fCp~CG~~~tl~rV~~~~~~  105 (123)
                      +.. +|..|++. +..              ...|| ||+.  +|.=-|..|+
T Consensus       136 ~~~-~C~~C~~~~~~~~~~~~~~~~~~~~~~P~C~-Cgg~--lrP~VV~FGE  183 (271)
T PTZ00409        136 FEA-RCCTCRKTIQLNKIMLQKTSHFMHQLPPECP-CGGI--FKPNVILFGE  183 (271)
T ss_pred             Ccc-eeCCCCCCcccCHHHHhhhhhhccCCCCCCC-CCCc--ccCcEEEeCC
Confidence            456 99999865 210              13599 9976  4443334444


No 366
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=23.91  E-value=42  Score=27.43  Aligned_cols=12  Identities=17%  Similarity=0.202  Sum_probs=9.3

Q ss_pred             ccccccCCCCCe
Q 033276           84 LVICIKSNHEIR   95 (123)
Q Consensus        84 ~~fCp~CG~~~t   95 (123)
                      .+-||.||.++.
T Consensus       235 g~pC~~Cg~~I~  246 (269)
T PRK14811        235 GQPCPRCGTPIE  246 (269)
T ss_pred             cCCCCcCCCeeE
Confidence            467999998843


No 367
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=23.80  E-value=39  Score=18.26  Aligned_cols=10  Identities=30%  Similarity=0.464  Sum_probs=7.9

Q ss_pred             ccccccCCCC
Q 033276           84 LVICIKSNHE   93 (123)
Q Consensus        84 ~~fCp~CG~~   93 (123)
                      ..-||.||..
T Consensus         2 l~~C~~CgR~   11 (25)
T PF13913_consen    2 LVPCPICGRK   11 (25)
T ss_pred             CCcCCCCCCE
Confidence            3569999976


No 368
>PF03850 Tfb4:  Transcription factor Tfb4;  InterPro: IPR004600 Members of this family are part of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. The core-TFIIH basal transcription factor complex has six subunits, this is the p34 subunit.; GO: 0006281 DNA repair, 0006355 regulation of transcription, DNA-dependent, 0000439 core TFIIH complex
Probab=23.60  E-value=40  Score=27.95  Aligned_cols=25  Identities=16%  Similarity=-0.029  Sum_probs=16.7

Q ss_pred             eeEEeeccccCCccc---ccCccccccCC
Q 033276           66 LHRYIVDKCLKLFSS---PFPLVICIKSN   91 (123)
Q Consensus        66 v~~wvl~rC~gC~k~---~~~~~fCp~CG   91 (123)
                      +..-.+ .|.-|..+   .+....||.||
T Consensus       249 ~vd~g~-vCsvCLsIfc~~p~~~~C~tC~  276 (276)
T PF03850_consen  249 VVDIGY-VCSVCLSIFCEFPDGGICPTCG  276 (276)
T ss_pred             ccccee-EchhhhhhhhCCCCCCCCCCCC
Confidence            334467 88888887   33345799987


No 369
>PF09334 tRNA-synt_1g:  tRNA synthetases class I (M);  InterPro: IPR015413 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. This domain is found in methionyl and leucyl tRNA synthetases. ; GO: 0000166 nucleotide binding, 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding, 0006418 tRNA aminoacylation for protein translation, 0005737 cytoplasm; PDB: 2D5B_A 1A8H_A 1WOY_A 2D54_A 4DLP_A 2CT8_B 2CSX_A 1MED_A 1PFU_A 1PFW_A ....
Probab=23.40  E-value=45  Score=28.61  Aligned_cols=31  Identities=16%  Similarity=0.113  Sum_probs=16.5

Q ss_pred             HHHHHHHHhCceeeCCCCCcceeeeEEeeccccCCccc
Q 033276           43 AMQNVILQMGLRLLAPGGMQIRQLHRYIVDKCLKLFSS   80 (123)
Q Consensus        43 AmQNVllqlGL~l~sv~g~~I~~v~~wvl~rC~gC~k~   80 (123)
                      ..|.+.++|-    . .| .|.+ +.|..-.|..|.+.
T Consensus        99 ~v~~i~~~L~----~-~G-~I~~-~~~~~~Yc~~~e~f  129 (391)
T PF09334_consen   99 FVQEIFKRLY----D-NG-YIYK-REYEGWYCPSCERF  129 (391)
T ss_dssp             HHHHHHHHHH----H-TT-SEEE-EEEEEEEETTTTEE
T ss_pred             HHHHHHHHHH----h-cC-ceee-cccceeEecCcCcc
Confidence            3566666642    1 23 2333 34443388888876


No 370
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=23.25  E-value=44  Score=27.19  Aligned_cols=11  Identities=18%  Similarity=0.202  Sum_probs=8.9

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      .+-||.||.++
T Consensus       245 g~pC~~Cg~~I  255 (274)
T PRK01103        245 GEPCRRCGTPI  255 (274)
T ss_pred             CCCCCCCCCee
Confidence            46799999884


No 371
>PRK05333 NAD-dependent deacetylase; Provisional
Probab=23.16  E-value=76  Score=25.93  Aligned_cols=8  Identities=13%  Similarity=0.173  Sum_probs=7.1

Q ss_pred             ccccCCCC
Q 033276           86 ICIKSNHE   93 (123)
Q Consensus        86 fCp~CG~~   93 (123)
                      .||.||+.
T Consensus       181 ~C~~Cgg~  188 (285)
T PRK05333        181 ACPACGGI  188 (285)
T ss_pred             CCCCCCCc
Confidence            59999987


No 372
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=23.04  E-value=33  Score=26.92  Aligned_cols=21  Identities=14%  Similarity=0.274  Sum_probs=14.3

Q ss_pred             cccCCccc-c----------cCccccccCCCC
Q 033276           73 KCLKLFSS-P----------FPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~-~----------~~~~fCp~CG~~   93 (123)
                      +|-.|+.. +          .....||+||+.
T Consensus         2 iCIeCg~~v~~Ly~~Ys~~~irLt~C~~C~~v   33 (208)
T PF04161_consen    2 ICIECGHPVKSLYRQYSPGNIRLTKCPNCGKV   33 (208)
T ss_pred             EeccCCCcchhhhhccCCCcEEEeeccccCCc
Confidence            68888865 2          123679999875


No 373
>PRK00124 hypothetical protein; Validated
Probab=23.04  E-value=1.2e+02  Score=23.41  Aligned_cols=40  Identities=23%  Similarity=0.339  Sum_probs=30.6

Q ss_pred             CceeccCCCCceeEEecccHHHHHHHHHhCceeeCCCCCcc
Q 033276           23 QSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQI   63 (123)
Q Consensus        23 ~~WIt~~~~~~~va~vTdDyAmQNVllqlGL~l~sv~g~~I   63 (123)
                      +.||-.... ..-.++|.||.+--.++.-|..++++.|+..
T Consensus        58 D~~Iv~~~~-~gDiVIT~Di~LAa~~l~Kga~vl~prG~~y   97 (151)
T PRK00124         58 DNEIVQLAE-KGDIVITQDYGLAALALEKGAIVLNPRGYIY   97 (151)
T ss_pred             HHHHHHhCC-CCCEEEeCCHHHHHHHHHCCCEEECCCCcCC
Confidence            455543322 2248899999999999999999999998654


No 374
>PF01020 Ribosomal_L40e:  Ribosomal L40e family;  InterPro: IPR001975 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the L40 ribosomal protein from both archaea and eukaryotes. Bovine ribosomal protein L40 has been identified as a secondary RNA binding protein []. L40 is fused to a ubiquitin protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZS_p 3IZR_p 2AYJ_A 4A1B_K 4A19_K 4A18_K 4A1D_K.
Probab=23.00  E-value=79  Score=20.71  Aligned_cols=25  Identities=24%  Similarity=0.440  Sum_probs=14.6

Q ss_pred             cccCCccc-ccCcccccc--CCCCCeee
Q 033276           73 KCLKLFSS-PFPLVICIK--SNHEIRIS   97 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~--CG~~~tl~   97 (123)
                      .|..|+.. ++.-..|-+  ||+...|+
T Consensus        19 ICrkCyarl~~~A~nCRKkkCGhsn~LR   46 (52)
T PF01020_consen   19 ICRKCYARLPPRATNCRKKKCGHSNNLR   46 (52)
T ss_dssp             EETTT--EE-TTSSS-TSSSCTS-S-EE
T ss_pred             ecccccCcCCCCccceecccCCCCcccC
Confidence            89999987 666678988  99653454


No 375
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=22.97  E-value=35  Score=21.59  Aligned_cols=11  Identities=18%  Similarity=0.443  Sum_probs=8.6

Q ss_pred             ccccCCCCCee
Q 033276           86 ICIKSNHEIRI   96 (123)
Q Consensus        86 fCp~CG~~~tl   96 (123)
                      .|++||+++.+
T Consensus         1 ~C~iCg~kigl   11 (51)
T PF14471_consen    1 KCAICGKKIGL   11 (51)
T ss_pred             CCCcccccccc
Confidence            39999999644


No 376
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=22.90  E-value=40  Score=24.63  Aligned_cols=21  Identities=24%  Similarity=0.262  Sum_probs=15.5

Q ss_pred             cccCCccc--c--cC-ccccccCCCC
Q 033276           73 KCLKLFSS--P--FP-LVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~--~--~~-~~fCp~CG~~   93 (123)
                      +|..|+..  +  .. -.-||+|-+.
T Consensus        60 ~CkkCGfef~~~~ik~pSRCP~CKSE   85 (97)
T COG3357          60 RCKKCGFEFRDDKIKKPSRCPKCKSE   85 (97)
T ss_pred             hhcccCccccccccCCcccCCcchhh
Confidence            89999977  2  11 2469999988


No 377
>smart00532 LIGANc Ligase N family.
Probab=22.71  E-value=47  Score=29.43  Aligned_cols=47  Identities=15%  Similarity=0.271  Sum_probs=27.9

Q ss_pred             HHHHHHhCcee-----eCCCCCcceeeeEEeeccccCCcc--c-ccCccccccCCCCC
Q 033276           45 QNVILQMGLRL-----LAPGGMQIRQLHRYIVDKCLKLFS--S-PFPLVICIKSNHEI   94 (123)
Q Consensus        45 QNVllqlGL~l-----~sv~g~~I~~v~~wvl~rC~gC~k--~-~~~~~fCp~CG~~~   94 (123)
                      ++-+.++||++     +.-.|.-|-++-.-+. . .--..  . .++ .+||.||+++
T Consensus       355 ~~~i~~~~i~iGd~V~V~raGdVIP~I~~vv~-~-~r~~~~~~~~~P-~~CP~C~s~l  409 (441)
T smart00532      355 EDEIEEKDIRIGDTVVVRKAGDVIPKVVGVVK-E-KRPGDEREIEMP-THCPSCGSEL  409 (441)
T ss_pred             HHHHHHcCCCCCCEEEEEECCCcCcceeeccc-c-cCCCCCccCcCC-CCCCCCCCEe
Confidence            34467788864     2335888888766443 1 11111  1 234 7899999994


No 378
>COG1138 CcmF Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]
Probab=22.70  E-value=40  Score=31.75  Aligned_cols=18  Identities=22%  Similarity=0.344  Sum_probs=15.0

Q ss_pred             eEEecccHHHHHHHHHhC
Q 033276           35 VACITGDYAMQNVILQMG   52 (123)
Q Consensus        35 va~vTdDyAmQNVllqlG   52 (123)
                      -+.+|+||++|||+.+=.
T Consensus        59 ~afv~~DFSv~yVa~nS~   76 (648)
T COG1138          59 YAFVVSDFSVQYVAQNSN   76 (648)
T ss_pred             HHHHhccHHHHHHHHhcc
Confidence            367899999999999843


No 379
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=22.65  E-value=40  Score=22.33  Aligned_cols=22  Identities=23%  Similarity=0.250  Sum_probs=14.2

Q ss_pred             eeccccCCccc-cc------CccccccCCC
Q 033276           70 IVDKCLKLFSS-PF------PLVICIKSNH   92 (123)
Q Consensus        70 vl~rC~gC~k~-~~------~~~fCp~CG~   92 (123)
                      .. .|..|.+. +.      ...+||+|+.
T Consensus        41 ~v-~Cg~C~~~~~~~~~~c~~~~~C~~C~~   69 (71)
T PF05495_consen   41 RV-ICGKCRTEQPIDEYSCGADYFCPICGL   69 (71)
T ss_dssp             EE-EETTT--EEES-SBTT--SEEETTTTE
T ss_pred             Ce-ECCCCCCccChhhhhcCCCccCcCcCC
Confidence            45 79999987 32      2469999985


No 380
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=22.62  E-value=39  Score=23.72  Aligned_cols=17  Identities=18%  Similarity=0.254  Sum_probs=7.2

Q ss_pred             cccCCcccccCccccccC
Q 033276           73 KCLKLFSSPFPLVICIKS   90 (123)
Q Consensus        73 rC~gC~k~~~~~~fCp~C   90 (123)
                      +|.-|+.+ .+.+.|..|
T Consensus        82 ~C~~CG~p-ss~~iC~~C   98 (104)
T TIGR00269        82 RCERCGEP-TSGRICKAC   98 (104)
T ss_pred             cCCcCcCc-CCccccHhh
Confidence            45555543 222344444


No 381
>PRK14276 chaperone protein DnaJ; Provisional
Probab=22.53  E-value=1.2e+02  Score=25.81  Aligned_cols=35  Identities=17%  Similarity=0.091  Sum_probs=20.7

Q ss_pred             cccCCccc----ccCccccccCCCCCeeeEEEEEeeEEEE
Q 033276           73 KCLKLFSS----PFPLVICIKSNHEIRISPVFMLILICLY  108 (123)
Q Consensus        73 rC~gC~k~----~~~~~fCp~CG~~~tl~rV~~~~~~~~~  108 (123)
                      .|..|.-.    ......|+.|+... ...+...++...+
T Consensus       148 ~C~~C~G~G~~~~~~~~~C~~C~G~G-~~~~~~~~~~G~~  186 (380)
T PRK14276        148 TCHTCNGSGAKPGTSPVTCGKCHGSG-VITVDTQTPLGMM  186 (380)
T ss_pred             cCCCCcCcccCCCCCCccCCCCCCee-EEEEEEecCCceE
Confidence            58877654    23346799999884 3344444444433


No 382
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=22.49  E-value=5.6  Score=23.90  Aligned_cols=28  Identities=11%  Similarity=0.007  Sum_probs=14.1

Q ss_pred             eeeeEEeeccccCCcccccCccccccCCCC
Q 033276           64 RQLHRYIVDKCLKLFSSPFPLVICIKSNHE   93 (123)
Q Consensus        64 ~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~   93 (123)
                      .+++.-+. .|.-|+... ....|++|-++
T Consensus        11 ~~~~~~i~-~C~~C~nls-e~~~C~IC~d~   38 (41)
T PF02132_consen   11 KEAKENIK-FCSICGNLS-EEDPCEICSDP   38 (41)
T ss_dssp             HHHHHH-E-E-SSS--EE-SSSS-HHHH-T
T ss_pred             HHHHHcCC-ccCCCCCcC-CCCcCcCCCCC
Confidence            34445566 899999882 13579999776


No 383
>PRK07225 DNA-directed RNA polymerase subunit B'; Validated
Probab=22.45  E-value=56  Score=30.21  Aligned_cols=28  Identities=25%  Similarity=0.123  Sum_probs=18.4

Q ss_pred             cccCCccc-c----cCccccccCCCCCeeeEEE
Q 033276           73 KCLKLFSS-P----FPLVICIKSNHEIRISPVF  100 (123)
Q Consensus        73 rC~gC~k~-~----~~~~fCp~CG~~~tl~rV~  100 (123)
                      .|..|+.. .    ....+|+.|++...+.+|.
T Consensus       546 vC~~CG~~~~~~~~~~~~~C~~C~~~~~i~~v~  578 (605)
T PRK07225        546 VCAKCGMIAIYDKKRNRKYCPICGEETDIYPVE  578 (605)
T ss_pred             eecCcCcceehhcccCceeecccCCCCceeecc
Confidence            78889886 1    2345699998754555554


No 384
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=22.40  E-value=63  Score=19.10  Aligned_cols=20  Identities=20%  Similarity=0.182  Sum_probs=12.0

Q ss_pred             cccCCccc--ccCccccccCCC
Q 033276           73 KCLKLFSS--PFPLVICIKSNH   92 (123)
Q Consensus        73 rC~gC~k~--~~~~~fCp~CG~   92 (123)
                      +|.-|++.  .....+|..|+.
T Consensus         1 ~C~vC~~~~~~~~~i~C~~C~~   22 (51)
T PF00628_consen    1 YCPVCGQSDDDGDMIQCDSCNR   22 (51)
T ss_dssp             EBTTTTSSCTTSSEEEBSTTSC
T ss_pred             eCcCCCCcCCCCCeEEcCCCCh
Confidence            36666665  344567777764


No 385
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=22.28  E-value=48  Score=27.17  Aligned_cols=11  Identities=27%  Similarity=0.223  Sum_probs=8.8

Q ss_pred             ccccccCCCCC
Q 033276           84 LVICIKSNHEI   94 (123)
Q Consensus        84 ~~fCp~CG~~~   94 (123)
                      .+-||.||.++
T Consensus       254 g~pC~~Cg~~I  264 (282)
T PRK13945        254 GKPCRKCGTPI  264 (282)
T ss_pred             cCCCCcCCCee
Confidence            46799999884


No 386
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=22.19  E-value=45  Score=21.95  Aligned_cols=39  Identities=18%  Similarity=0.251  Sum_probs=22.6

Q ss_pred             CccccccCCCCCeeeEEEEEeeEEEEEee-CCccceeecccC
Q 033276           83 PLVICIKSNHEIRISPVFMLILICLYIQV-DTEMPCLLHYHC  123 (123)
Q Consensus        83 ~~~fCp~CG~~~tl~rV~~~~~~~~~~~~-~~~~~~~~~~~~  123 (123)
                      .+--|..|+.+  +.+=.+.+|.-+.-.. ++.+|.-.|..|
T Consensus         6 ~Ra~Ck~C~~~--I~kg~lRiG~~~~~~~~~~~~~~W~H~~C   45 (82)
T PF00645_consen    6 GRAKCKGCKKK--IAKGELRIGKIVPSPEGDGDIPKWYHWDC   45 (82)
T ss_dssp             STEBETTTSCB--E-TTSEEEEEEEEETTSSCEEEEEEEHHH
T ss_pred             CCccCcccCCc--CCCCCEEEEEEecccccCCCCCceECccc
Confidence            45557777754  3344445555544433 368888888766


No 387
>PF02348 CTP_transf_3:  Cytidylyltransferase;  InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2.7.7.43 from EC) (CMP-NeuAc synthetase) catalyzes the reaction of CTP and NeuAc to form CMP-NeuAc, which is the nucleotide sugar donor used by sialyltransferases []. The outer membrane lipooligosaccharides of some microorganisms contain terminal sialic acid attached to N-acetyllactosamine and so this modification may be important in pathogenesis.; GO: 0009103 lipopolysaccharide biosynthetic process; PDB: 3K8D_C 1VH1_B 3K8E_C 1QWJ_A 3EWI_A 1VIC_B 3DUV_A 1VH3_C 3TQD_A 2Y6P_C ....
Probab=22.03  E-value=1.3e+02  Score=22.34  Aligned_cols=28  Identities=14%  Similarity=0.348  Sum_probs=22.2

Q ss_pred             ceeEEecccHHHHHHHHHhCceeeCCCC
Q 033276           33 STVACITGDYAMQNVILQMGLRLLAPGG   60 (123)
Q Consensus        33 ~~va~vTdDyAmQNVllqlGL~l~sv~g   60 (123)
                      .++++-|||-.+.+++.+.|.++.-..+
T Consensus        41 d~IvVaTd~~~i~~~~~~~g~~v~~~~~   68 (217)
T PF02348_consen   41 DEIVVATDDEEIDDIAEEYGAKVIFRRG   68 (217)
T ss_dssp             SEEEEEESSHHHHHHHHHTTSEEEE--T
T ss_pred             CeEEEeCCCHHHHHHHHHcCCeeEEcCh
Confidence            4689999999999999999977764433


No 388
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=21.80  E-value=42  Score=23.13  Aligned_cols=11  Identities=9%  Similarity=0.313  Sum_probs=8.9

Q ss_pred             cccccCCCCCe
Q 033276           85 VICIKSNHEIR   95 (123)
Q Consensus        85 ~fCp~CG~~~t   95 (123)
                      +||..||-|++
T Consensus         1 k~CQSCGMPl~   11 (81)
T PF12674_consen    1 KFCQSCGMPLS   11 (81)
T ss_pred             CcCCcCcCccC
Confidence            48999999954


No 389
>PF11062 DUF2863:  Protein of unknown function (DUF2863);  InterPro: IPR021292  This bacterial family of proteins have no known function. 
Probab=21.79  E-value=40  Score=30.01  Aligned_cols=20  Identities=25%  Similarity=0.519  Sum_probs=15.4

Q ss_pred             cCccccccCCCCCeeeEEEEEeeEEEEEeeCCc
Q 033276           82 FPLVICIKSNHEIRISPVFMLILICLYIQVDTE  114 (123)
Q Consensus        82 ~~~~fCp~CG~~~tl~rV~~~~~~~~~~~~~~~  114 (123)
                      .+-+||..||.|+             |=..+||
T Consensus       362 f~~E~CdDCGaPl-------------ypd~~GE  381 (398)
T PF11062_consen  362 FPPEFCDDCGAPL-------------YPDPEGE  381 (398)
T ss_pred             CCchhcccCCCCC-------------CCCCCcc
Confidence            3458999999995             7777774


No 390
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=21.41  E-value=18  Score=21.75  Aligned_cols=22  Identities=14%  Similarity=0.037  Sum_probs=15.3

Q ss_pred             cccCCccc-ccCccccccCCCCC
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEI   94 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~   94 (123)
                      .|..|... -.....||.|..++
T Consensus        25 ~C~~C~~~~~~~~~~CP~Cr~~i   47 (50)
T PF13920_consen   25 FCEECAERLLKRKKKCPICRQPI   47 (50)
T ss_dssp             EEHHHHHHHHHTTSBBTTTTBB-
T ss_pred             HHHHHhHHhcccCCCCCcCChhh
Confidence            57777765 33567899998883


No 391
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=21.09  E-value=1.1e+02  Score=20.34  Aligned_cols=31  Identities=16%  Similarity=0.170  Sum_probs=13.7

Q ss_pred             eeeeEEeeccccCCccc-c----cCccccccCCCCCee
Q 033276           64 RQLHRYIVDKCLKLFSS-P----FPLVICIKSNHEIRI   96 (123)
Q Consensus        64 ~~v~~wvl~rC~gC~k~-~----~~~~fCp~CG~~~tl   96 (123)
                      +..+.|++  |-.|.+. .    .-..-|+.||+=.|.
T Consensus        25 ~~~~v~Il--CNDC~~~s~v~fH~lg~KC~~C~SYNT~   60 (61)
T PF14599_consen   25 RNKKVWIL--CNDCNAKSEVPFHFLGHKCSHCGSYNTR   60 (61)
T ss_dssp             ---EEEEE--ESSS--EEEEE--TT----TTTS---EE
T ss_pred             hCCEEEEE--CCCCCCccceeeeHhhhcCCCCCCcccC
Confidence            34457777  9999986 2    234669999975443


No 392
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=20.95  E-value=32  Score=23.31  Aligned_cols=29  Identities=14%  Similarity=0.115  Sum_probs=21.5

Q ss_pred             eeeEEeeccccCCccc----ccCccccccCCCCC
Q 033276           65 QLHRYIVDKCLKLFSS----PFPLVICIKSNHEI   94 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~----~~~~~fCp~CG~~~   94 (123)
                      +-..-+| .|--|+..    ...-..|..||+.+
T Consensus        15 r~~~miY-iCgdC~~en~lk~~D~irCReCG~RI   47 (62)
T KOG3507|consen   15 RTATMIY-ICGDCGQENTLKRGDVIRCRECGYRI   47 (62)
T ss_pred             CcccEEE-EeccccccccccCCCcEehhhcchHH
Confidence            4456788 99999976    23446799999884


No 393
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics]
Probab=20.74  E-value=48  Score=27.59  Aligned_cols=28  Identities=14%  Similarity=0.046  Sum_probs=19.1

Q ss_pred             eeeeEEeeccccCCc----cc-----ccCccccccCCC
Q 033276           64 RQLHRYIVDKCLKLF----SS-----PFPLVICIKSNH   92 (123)
Q Consensus        64 ~~v~~wvl~rC~gC~----k~-----~~~~~fCp~CG~   92 (123)
                      +.+--|.. ||-.|+    ..     -..+..||+||.
T Consensus       188 h~LvIqg~-rCg~c~i~~h~~c~qty~q~~~~cphc~d  224 (235)
T KOG4718|consen  188 HCLVIQGI-RCGSCNIQYHRGCIQTYLQRRDICPHCGD  224 (235)
T ss_pred             HHHhheee-ccCcccchhhhHHHHHHhcccCcCCchhc
Confidence            34556788 999993    22     133789999984


No 394
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=20.72  E-value=54  Score=27.56  Aligned_cols=17  Identities=12%  Similarity=0.157  Sum_probs=10.9

Q ss_pred             ceeeeEEeeccccCCccc
Q 033276           63 IRQLHRYIVDKCLKLFSS   80 (123)
Q Consensus        63 I~~v~~wvl~rC~gC~k~   80 (123)
                      ||-.-=|-. +|.+|+..
T Consensus        33 VRf~~Pf~i-~C~~C~~~   49 (324)
T PF04502_consen   33 VRFMMPFNI-WCNTCGEY   49 (324)
T ss_pred             EEEcCCccC-cCCCCccc
Confidence            344445667 88888764


No 395
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=20.69  E-value=53  Score=22.26  Aligned_cols=21  Identities=19%  Similarity=0.303  Sum_probs=15.5

Q ss_pred             cccCCccc---------ccCccccccCCCC
Q 033276           73 KCLKLFSS---------PFPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~---------~~~~~fCp~CG~~   93 (123)
                      .|+.|...         +.....|-.||+.
T Consensus        10 ~CP~C~~~D~i~~~~e~~ve~vECV~CGy~   39 (71)
T PF09526_consen   10 VCPKCQAMDTIMMWRENGVEYVECVECGYT   39 (71)
T ss_pred             cCCCCcCccEEEEEEeCCceEEEecCCCCe
Confidence            78888875         1346789999976


No 396
>PRK00076 recR recombination protein RecR; Reviewed
Probab=20.68  E-value=41  Score=26.94  Aligned_cols=38  Identities=11%  Similarity=0.044  Sum_probs=26.0

Q ss_pred             ceeeeEEeeccccCCcccccCccccccCCCCCeeeEEEEE
Q 033276           63 IRQLHRYIVDKCLKLFSSPFPLVICIKSNHEIRISPVFML  102 (123)
Q Consensus        63 I~~v~~wvl~rC~gC~k~~~~~~fCp~CG~~~tl~rV~~~  102 (123)
                      |..+++-+. .|.-|+.... ...|+.|-++.+=+.+=|+
T Consensus        46 i~~~~~~i~-~C~~C~~lse-~~~C~IC~d~~Rd~~~icV   83 (196)
T PRK00076         46 LEEAKEKIK-HCSVCGNLTE-QDPCEICSDPRRDQSLICV   83 (196)
T ss_pred             HHHHHHcCC-cCCCCCCcCC-CCcCCCCCCCCCCCCEEEE
Confidence            455667777 9999998822 2669999999433443333


No 397
>TIGR02386 rpoC_TIGR DNA-directed RNA polymerase, beta' subunit, predominant form. Bacteria have a single DNA-directed RNA polymerase, with required subunits that include alpha, beta, and beta-prime. This model describes the predominant architecture of the beta-prime subunit in most bacteria. This model excludes from among the bacterial mostly sequences from the cyanobacteria, where RpoC is replaced by two tandem genes homologous to it but also encoding an additional domain.
Probab=20.61  E-value=50  Score=33.02  Aligned_cols=31  Identities=16%  Similarity=0.154  Sum_probs=22.0

Q ss_pred             eeeEEeeccccCCccc---ccCccccccCCCCCeeeEE
Q 033276           65 QLHRYIVDKCLKLFSS---PFPLVICIKSNHEIRISPV   99 (123)
Q Consensus        65 ~v~~wvl~rC~gC~k~---~~~~~fCp~CG~~~tl~rV   99 (123)
                      -++.|.-    +|+|.   .....+|+.||-+.|..||
T Consensus        46 p~k~~ec----~Cgkyk~~~~~~~~C~~Cgve~t~~~v   79 (1140)
T TIGR02386        46 PTKDWEC----YCGKYKKIRYKGVVCERCGVEVTESKV   79 (1140)
T ss_pred             CccCcee----ccccccccCcCCcCCCCCCCCcccchh
Confidence            3566766    67765   3345799999999887764


No 398
>COG1671 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.37  E-value=1.4e+02  Score=23.35  Aligned_cols=42  Identities=21%  Similarity=0.460  Sum_probs=31.4

Q ss_pred             CCCCceeccCCCCceeEEecccHHHHHHHHHhCceeeCCCCCc
Q 033276           20 CSEQSWMLRSLSESTVACITGDYAMQNVILQMGLRLLAPGGMQ   62 (123)
Q Consensus        20 ~~~~~WIt~~~~~~~va~vTdDyAmQNVllqlGL~l~sv~g~~   62 (123)
                      |.-+.||-.- ....-.++|.|+.+--.++..|..++++.|+.
T Consensus        54 DaaD~~Iv~~-a~~gDlVVT~Di~LA~~ll~kg~~v~~prGr~   95 (150)
T COG1671          54 DAADDWIVNL-AEKGDLVVTADIPLASLLLDKGAAVLNPRGRL   95 (150)
T ss_pred             chHHHHHHHh-CCCCCEEEECchHHHHHHHhcCCEEECCCCcc
Confidence            3345566422 12334889999999999999999999999864


No 399
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=20.25  E-value=53  Score=27.23  Aligned_cols=21  Identities=14%  Similarity=0.169  Sum_probs=14.8

Q ss_pred             cccCCccc----c--cCccccccCCCC
Q 033276           73 KCLKLFSS----P--FPLVICIKSNHE   93 (123)
Q Consensus        73 rC~gC~k~----~--~~~~fCp~CG~~   93 (123)
                      +|+.|+..    +  ....+|..||.=
T Consensus        13 ~Cp~Cg~~~iv~d~~~Ge~vC~~CG~V   39 (310)
T PRK00423         13 VCPECGSDKLIYDYERGEIVCADCGLV   39 (310)
T ss_pred             cCcCCCCCCeeEECCCCeEeecccCCc
Confidence            78888863    2  345788888863


No 400
>PRK14290 chaperone protein DnaJ; Provisional
Probab=20.06  E-value=1.5e+02  Score=25.04  Aligned_cols=24  Identities=17%  Similarity=0.228  Sum_probs=17.2

Q ss_pred             cccCCccc-ccCccccccCCCCCee
Q 033276           73 KCLKLFSS-PFPLVICIKSNHEIRI   96 (123)
Q Consensus        73 rC~gC~k~-~~~~~fCp~CG~~~tl   96 (123)
                      .|..|.-. ...+..|+.|.+..++
T Consensus       193 ~C~~C~G~G~~~~~~C~~C~G~g~v  217 (365)
T PRK14290        193 TCRTCGGRGRIPEEKCPRCNGTGTV  217 (365)
T ss_pred             eCCCCCCceeEccCCCCCCCCceeE
Confidence            78888766 4556779999877443


Done!