Query         033297
Match_columns 122
No_of_seqs    102 out of 189
Neff          5.1 
Searched_HMMs 46136
Date          Fri Mar 29 12:11:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033297.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033297hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02290 SRP14:  Signal recogni 100.0 2.5E-41 5.4E-46  236.0   8.3   90    4-93      1-93  (93)
  2 KOG1761 Signal recognition par 100.0 8.8E-39 1.9E-43  230.5   9.9  105    2-106     1-108 (116)
  3 PF03791 KNOX2:  KNOX2 domain ;  73.4     2.9 6.4E-05   26.5   2.0   18   71-88      7-24  (52)
  4 KOG3465 Signal recognition par  58.2      15 0.00032   25.7   3.2   29    1-31      1-30  (86)
  5 PF02786 CPSase_L_D2:  Carbamoy  44.1      35 0.00076   26.5   3.8   34   52-85     38-73  (211)
  6 PF08482 HrpB_C:  ATP-dependent  39.1      18 0.00039   26.9   1.4   17   72-88    102-119 (133)
  7 KOG1572 Predicted protein tyro  36.9      13 0.00028   30.5   0.3   22   50-71    146-167 (249)
  8 PF03418 Peptidase_A25:  Germin  30.3      50  0.0011   28.5   2.8   29   66-94    312-341 (354)
  9 KOG3442 Uncharacterized conser  30.0      57  0.0012   24.4   2.7   30    3-32     70-101 (132)
 10 PF12108 SF3a60_bindingd:  Spli  24.5      69  0.0015   17.8   1.8   17   69-85      3-19  (28)
 11 COG5453 Uncharacterized conser  23.6      60  0.0013   23.0   1.8   13   49-61     24-37  (96)
 12 PF14775 NYD-SP28_assoc:  Sperm  22.7      68  0.0015   20.5   1.8   18   74-91     20-37  (60)
 13 PF08293 MRP-S33:  Mitochondria  22.1      39 0.00085   23.0   0.6   11  108-118    77-87  (87)
 14 PRK01683 trans-aconitate 2-met  21.2      86  0.0019   24.1   2.4   28    7-34    221-251 (258)
 15 smart00555 GIT Helical motif i  20.4      97  0.0021   17.4   1.9   17    3-19      7-23  (31)

No 1  
>PF02290 SRP14:  Signal recognition particle 14kD protein;  InterPro: IPR003210  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the 14 kDa SRP14 component. Both SRP9 and SRP14 have the same (beta)-alpha-beta(3)-alpha fold. The heterodimer has pseudo two-fold symmetry and is saddle-like, consisting of a curved six-stranded beta-sheet that has four helices packed on the convex side and an exposed concave surface lined with positively charged residues. The SRP9/SRP14 heterodimer is essential for SRP RNA binding, mediating the pausing of synthesis of ribosome associated nascent polypeptides that have been engaged by the targeting domain of SRP [].; GO: 0008312 7S RNA binding, 0030942 endoplasmic reticulum signal peptide binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0005786 signal recognition particle, endoplasmic reticulum targeting; PDB: 1914_A 1RY1_D 1E8O_B 2W9J_B.
Probab=100.00  E-value=2.5e-41  Score=236.04  Aligned_cols=90  Identities=50%  Similarity=0.753  Sum_probs=68.0

Q ss_pred             CCchHHHHHHHHHHhhcCCCc-eEEEEEecCCCCCcccccccC-CCCCCCceeeEEEEeCCCc-eEEEEeccccHHHHHH
Q 033297            4 LQPDPFLNELTSMFERNRDKG-SVWVTFKRSSMKSKSQKNKMA-TAGEPVEYRCLIRATDGKQ-KISTTVGAKDHQRFQA   80 (122)
Q Consensus         4 L~ndeFL~~L~~Lf~~~~~~g-SV~lT~KR~~~~~~~~~~~~~-~~~~~~ey~~LiRAt~Gk~-KiSTvV~~~~l~~F~~   80 (122)
                      ||||+||++|++||+.++++| |||||||||++.+.+.+.... ...++.||+||||||||++ ||||+|+++||++||+
T Consensus         1 L~ndeFL~~L~~lf~~~~~k~gSV~lT~KR~~~~~k~~~~~~~~~~~~~~~~~~LiRAt~Gkk~KiSTvV~~~~l~~F~~   80 (93)
T PF02290_consen    1 LSNDEFLSELTKLFEKSKEKGGSVYLTQKRLDGKTKPKPKKQKPSSSEDKEYPCLIRATNGKKIKISTVVDPDDLDKFWQ   80 (93)
T ss_dssp             E-HHHHHHHHHHHHHHCSSSSS-EEEEEEEEEE-------------------EEEEEEESSSS-EEEEEEETTCHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHcccCCceEEEEEeecCCCCCCCCccccCCCCCCCCceEEEEEecCCCCeEEEEECHHHHHHHHH
Confidence            799999999999999999876 999999999887655444332 3345679999999999998 9999999999999999


Q ss_pred             HHHHHHHhhcccc
Q 033297           81 SYATLLKAHMAAL   93 (122)
Q Consensus        81 ~Y~~vlK~~M~~L   93 (122)
                      +|++|||+||+||
T Consensus        81 ~Y~~v~K~~M~~L   93 (93)
T PF02290_consen   81 SYANVLKAGMDGL   93 (93)
T ss_dssp             HHHHHHHHHCCTS
T ss_pred             HHHHHHHhhCcCC
Confidence            9999999999998


No 2  
>KOG1761 consensus Signal recognition particle, subunit Srp14 [Intracellular trafficking, secretion, and vesicular transport]
Probab=100.00  E-value=8.8e-39  Score=230.48  Aligned_cols=105  Identities=51%  Similarity=0.796  Sum_probs=96.8

Q ss_pred             CCCCchHHHHHHHHHHhhcCCCc--eEEEEEecCCCCCcccccccCCCC-CCCceeeEEEEeCCCceEEEEeccccHHHH
Q 033297            2 GLLQPDPFLNELTSMFERNRDKG--SVWVTFKRSSMKSKSQKNKMATAG-EPVEYRCLIRATDGKQKISTTVGAKDHQRF   78 (122)
Q Consensus         2 vlL~ndeFL~~L~~Lf~~~~~~g--SV~lT~KR~~~~~~~~~~~~~~~~-~~~ey~~LiRAt~Gk~KiSTvV~~~~l~~F   78 (122)
                      ++|++++||++|+.||+.++..|  |||||+|||++.+++.+.....+. ++.+|+|||||++|++||||||.++|+++|
T Consensus         1 ~~~~~~~Fl~~lt~~~q~~k~~g~~sv~it~k~~dgrtk~~p~kgs~~g~e~~e~~cLiRa~~G~kKiSTVV~akev~~F   80 (116)
T KOG1761|consen    1 MLLESEQFLTELTRLFQKSKIKGASSVYITLKRYDGRTKPVPKKGSVEGFEPSEYRCLIRATDGKKKISTVVKAKEVNKF   80 (116)
T ss_pred             CCccchHHHHHHHHHHHhhhhcCCcceEEEEeccCCCcccccccCCcCCCCCccceEEEEeccCCceEEEEEeHHHHHHH
Confidence            57899999999999999999888  999999999999998888777665 788999999999999999999999999999


Q ss_pred             HHHHHHHHHhhccccccccccccccCCc
Q 033297           79 QASYATLLKAHMAALKKRERKDKKKGVD  106 (122)
Q Consensus        79 ~~~Y~~vlK~~M~~LkKrdKkk~K~k~~  106 (122)
                      |++|++||+++|+||+||+|++.++++.
T Consensus        81 ~~~YS~vlk~~M~~LkKr~kk~~kkk~~  108 (116)
T KOG1761|consen   81 QQSYSAVLKAQMDGLKKRKKKKSKKKTK  108 (116)
T ss_pred             HHHHHHHHHHHhhhhhhcccccccccce
Confidence            9999999999999999999988765443


No 3  
>PF03791 KNOX2:  KNOX2 domain ;  InterPro: IPR005541 The MEINOX region is comprised of two domains, KNOX1 and KNOX2. KNOX1 plays a role in suppressing target gene expression. KNOX2, essential for function, is thought to be necessary for homo-dimerization [].; GO: 0003677 DNA binding, 0005634 nucleus
Probab=73.41  E-value=2.9  Score=26.51  Aligned_cols=18  Identities=17%  Similarity=0.425  Sum_probs=15.0

Q ss_pred             ccccHHHHHHHHHHHHHh
Q 033297           71 GAKDHQRFQASYATLLKA   88 (122)
Q Consensus        71 ~~~~l~~F~~~Y~~vlK~   88 (122)
                      .-.+||.|..+|..+|..
T Consensus         7 ~dpELDqFMeaYc~~L~k   24 (52)
T PF03791_consen    7 ADPELDQFMEAYCDMLVK   24 (52)
T ss_pred             CCccHHHHHHHHHHHHHH
Confidence            345899999999999864


No 4  
>KOG3465 consensus Signal recognition particle, subunit Srp9 [Intracellular trafficking, secretion, and vesicular transport]
Probab=58.20  E-value=15  Score=25.66  Aligned_cols=29  Identities=28%  Similarity=0.423  Sum_probs=24.6

Q ss_pred             CCCCCc-hHHHHHHHHHHhhcCCCceEEEEEe
Q 033297            1 MGLLQP-DPFLNELTSMFERNRDKGSVWVTFK   31 (122)
Q Consensus         1 MvlL~n-deFL~~L~~Lf~~~~~~gSV~lT~K   31 (122)
                      ||.+.+ |||+..-..||..+.+  +..++||
T Consensus         1 Mvy~qtwdEF~~ase~L~~A~P~--~~RlvmK   30 (86)
T KOG3465|consen    1 MVYLQTWDEFFTASESLYLANPE--KTRLVMK   30 (86)
T ss_pred             CceeeeHHHHHHHHHHHHhcCcc--ceEEEEE
Confidence            777776 9999999999998765  5788888


No 5  
>PF02786 CPSase_L_D2:  Carbamoyl-phosphate synthase L chain, ATP binding domain;  InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates [, ]. CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate []. The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC). Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain []. CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites []. The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain. Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein []. The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP []. There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia []. CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains [].  This entry represents the ATP-binding domain found in the large subunit of carbamoyl phosphate synthase, as well as in related proteins.; GO: 0003824 catalytic activity, 0005524 ATP binding, 0008152 metabolic process; PDB: 3U9S_A 3U9T_A 2C00_B 2VQD_A 1W96_B 1W93_A 1M6V_C 1CS0_C 1C30_E 1C3O_G ....
Probab=44.15  E-value=35  Score=26.55  Aligned_cols=34  Identities=15%  Similarity=0.198  Sum_probs=20.8

Q ss_pred             ceeeEEEEeCCC--ceEEEEeccccHHHHHHHHHHH
Q 033297           52 EYRCLIRATDGK--QKISTTVGAKDHQRFQASYATL   85 (122)
Q Consensus        52 ey~~LiRAt~Gk--~KiSTvV~~~~l~~F~~~Y~~v   85 (122)
                      .||||||++.|-  +-+--+=+.++|....+.-...
T Consensus        38 GyPVliKas~ggGG~gm~iv~~~~eL~~~~~~~~~~   73 (211)
T PF02786_consen   38 GYPVLIKASAGGGGRGMRIVHNEEELEEAFERAQRE   73 (211)
T ss_dssp             -SSEEEEETTSSTTTSEEEESSHHHHHHHHHHHHHH
T ss_pred             CCceEEeecccccccccccccchhhhhhhhhhcccc
Confidence            599999999863  3444444556666665544333


No 6  
>PF08482 HrpB_C:  ATP-dependent helicase C-terminal;  InterPro: IPR013689 This domain is found near the C terminus of bacterial ATP-dependent helicases such as HrpB. 
Probab=39.10  E-value=18  Score=26.93  Aligned_cols=17  Identities=29%  Similarity=0.425  Sum_probs=14.3

Q ss_pred             cccHHHHHH-HHHHHHHh
Q 033297           72 AKDHQRFQA-SYATLLKA   88 (122)
Q Consensus        72 ~~~l~~F~~-~Y~~vlK~   88 (122)
                      ..||..||+ .|.+|-|-
T Consensus       102 T~DL~~FW~~sY~~VrKe  119 (133)
T PF08482_consen  102 TQDLASFWQGSYPEVRKE  119 (133)
T ss_pred             eCCHHHHhcccHHHHHHH
Confidence            489999999 89988763


No 7  
>KOG1572 consensus Predicted protein tyrosine phosphatase [Defense mechanisms]
Probab=36.92  E-value=13  Score=30.52  Aligned_cols=22  Identities=32%  Similarity=0.527  Sum_probs=19.1

Q ss_pred             CCceeeEEEEeCCCceEEEEec
Q 033297           50 PVEYRCLIRATDGKQKISTTVG   71 (122)
Q Consensus        50 ~~ey~~LiRAt~Gk~KiSTvV~   71 (122)
                      ...|||||+.+.|+..+.|+|-
T Consensus       146 ~~N~P~Lihc~rGkhRtg~lVg  167 (249)
T KOG1572|consen  146 KRNYPILIHCKRGKHRTGCLVG  167 (249)
T ss_pred             ccCCceEEecCCCCcchhhhHH
Confidence            4579999999999999988883


No 8  
>PF03418 Peptidase_A25:  Germination protease This family belongs to family A25 of the peptidase classification.;  InterPro: IPR005080 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. Metalloproteases are the most diverse of the four main types of protease, with more than 30 families identified to date []. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as abXHEbbHbc, where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family A25 (gpr protease family, clan AE). These are tetrameric proteases that makes the rate-limiting first cut in the small, acid-soluble spore proteins (SASP) of Bacillus subtilis and related species during spore germination. The enzyme lacks clear homology to other known proteases. It processes its own amino end before becoming active to cleave SASPs. ; GO: 0008233 peptidase activity, 0006508 proteolysis, 0009847 spore germination; PDB: 1C8B_A.
Probab=30.28  E-value=50  Score=28.46  Aligned_cols=29  Identities=17%  Similarity=0.208  Sum_probs=25.6

Q ss_pred             EEEEeccccHHHHHHHHHHHHHhhcc-ccc
Q 033297           66 ISTTVGAKDHQRFQASYATLLKAHMA-ALK   94 (122)
Q Consensus        66 iSTvV~~~~l~~F~~~Y~~vlK~~M~-~Lk   94 (122)
                      -+-+|+|+|+|.|..+++.++=.|++ +|-
T Consensus       312 ~~L~VTPKEID~~Ie~~a~iIA~GiN~ALh  341 (354)
T PF03418_consen  312 GNLMVTPKEIDELIEDLAKIIANGINMALH  341 (354)
T ss_dssp             TTEEEEETTHHHHHHHHHHHHHHHHGGGGS
T ss_pred             CCceECcHhHHHHHHHHHHHHHHHHHHHhC
Confidence            46799999999999999999999988 454


No 9  
>KOG3442 consensus Uncharacterized conserved protein [Function unknown]
Probab=29.98  E-value=57  Score=24.43  Aligned_cols=30  Identities=23%  Similarity=0.338  Sum_probs=24.4

Q ss_pred             CCCchHHHHHHHHHHhhcCC--CceEEEEEec
Q 033297            3 LLQPDPFLNELTSMFERNRD--KGSVWVTFKR   32 (122)
Q Consensus         3 lL~ndeFL~~L~~Lf~~~~~--~gSV~lT~KR   32 (122)
                      .|+.|+-...-..||+-+..  .||.||--|=
T Consensus        70 ~ln~eei~k~yehLFevNdkskGGSFYLQSKV  101 (132)
T KOG3442|consen   70 PLNREEIEKRYEHLFEVNDKSKGGSFYLQSKV  101 (132)
T ss_pred             CCCHHHHHHHHHHHHhccCcccCcceeehHHH
Confidence            46678899999999999863  4799998774


No 10 
>PF12108 SF3a60_bindingd:  Splicing factor SF3a60 binding domain;  InterPro: IPR021966  This domain is found in eukaryotes. This domain is about 30 amino acids in length. This domain has a single completely conserved residue Y that may be functionally important. SF3a60 makes up the SF3a complex with SF3a66 and SF3a120. This domain is the binding site of SF3a60 for SF3a120. The SF3a complex is part of the spliceosome, a protein complex involved in splicing mRNA after transcription. ; PDB: 2DT7_A.
Probab=24.54  E-value=69  Score=17.78  Aligned_cols=17  Identities=12%  Similarity=0.260  Sum_probs=11.2

Q ss_pred             EeccccHHHHHHHHHHH
Q 033297           69 TVGAKDHQRFQASYATL   85 (122)
Q Consensus        69 vV~~~~l~~F~~~Y~~v   85 (122)
                      +-.+++...|+.++.+|
T Consensus         3 is~~d~f~eFY~rlk~I   19 (28)
T PF12108_consen    3 ISGGDPFSEFYERLKEI   19 (28)
T ss_dssp             --S--HHHHHHHHHHHH
T ss_pred             CCCCChHHHHHHHHHHH
Confidence            44678999999998876


No 11 
>COG5453 Uncharacterized conserved protein [Function unknown]
Probab=23.58  E-value=60  Score=23.03  Aligned_cols=13  Identities=54%  Similarity=0.641  Sum_probs=9.5

Q ss_pred             CCCce-eeEEEEeC
Q 033297           49 EPVEY-RCLIRATD   61 (122)
Q Consensus        49 ~~~ey-~~LiRAt~   61 (122)
                      ++.|| .|||+||-
T Consensus        24 ~~~ehkdflI~atP   37 (96)
T COG5453          24 EPIEHKDFLIYATP   37 (96)
T ss_pred             CcccccCeEEEeee
Confidence            44566 79999984


No 12 
>PF14775 NYD-SP28_assoc:  Sperm tail C-terminal domain
Probab=22.72  E-value=68  Score=20.50  Aligned_cols=18  Identities=22%  Similarity=0.333  Sum_probs=14.4

Q ss_pred             cHHHHHHHHHHHHHhhcc
Q 033297           74 DHQRFQASYATLLKAHMA   91 (122)
Q Consensus        74 ~l~~F~~~Y~~vlK~~M~   91 (122)
                      .|+.|+..|..||.--..
T Consensus        20 ~L~~~l~rY~~vL~~R~~   37 (60)
T PF14775_consen   20 ALENFLKRYNKVLLDRAA   37 (60)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            688999999999875443


No 13 
>PF08293 MRP-S33:  Mitochondrial ribosomal subunit S27;  InterPro: IPR013219 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry represents a mitochondrial ribosomal subunit annotated as S27 in yeast and S33 in humans [, ]. It is a small 106 residue protein. The evolutionary history of the mitoribosomal proteome that is encoded by a diverse subset of eukaryotic genomes, reveals an ancestral ribosome of alpha-proteobacterial descent that more than doubled its protein content in most eukaryotic lineages. Several new MRPs have originated via duplication of existing MRPs as well as by recruitment from outside of the mitoribosomal proteome [].
Probab=22.09  E-value=39  Score=22.98  Aligned_cols=11  Identities=36%  Similarity=0.743  Sum_probs=8.0

Q ss_pred             CCCCCCCCCCC
Q 033297          108 DRKDGAGSTKK  118 (122)
Q Consensus       108 ~~~~~~~~~~~  118 (122)
                      .+.+|+|+|||
T Consensus        77 rk~RGKg~PKK   87 (87)
T PF08293_consen   77 RKRRGKGPPKK   87 (87)
T ss_pred             HHhCCCCCCCC
Confidence            45678888876


No 14 
>PRK01683 trans-aconitate 2-methyltransferase; Provisional
Probab=21.17  E-value=86  Score=24.05  Aligned_cols=28  Identities=21%  Similarity=0.354  Sum_probs=22.0

Q ss_pred             hHHHHHHHHHHhhc---CCCceEEEEEecCC
Q 033297            7 DPFLNELTSMFERN---RDKGSVWVTFKRSS   34 (122)
Q Consensus         7 deFL~~L~~Lf~~~---~~~gSV~lT~KR~~   34 (122)
                      ++|+.++.+.|...   ...|++++++.|+.
T Consensus       221 ~~f~~~~~~~~~~~~~~~~~g~~~~~~~~~~  251 (258)
T PRK01683        221 AAFLAAYLARIAEAYPLQADGKVLLAFPRLF  251 (258)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCcEEcccceEE
Confidence            78999999988765   35788999887753


No 15 
>smart00555 GIT Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins. Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins, and in yeast Spa2p and Sph1p (CPP; unpublished results). In p95-APP1 the N-terminal GIT motif might be involved in binding PIX.
Probab=20.43  E-value=97  Score=17.38  Aligned_cols=17  Identities=24%  Similarity=0.335  Sum_probs=14.9

Q ss_pred             CCCchHHHHHHHHHHhh
Q 033297            3 LLQPDPFLNELTSMFER   19 (122)
Q Consensus         3 lL~ndeFL~~L~~Lf~~   19 (122)
                      .|++.+|..-++.+|..
T Consensus         7 ~L~~~~F~~L~~Dv~~E   23 (31)
T smart00555        7 RLSDEQFQKLLTDLNDE   23 (31)
T ss_pred             hcCHHHHHHHHHHHHHH
Confidence            58899999999999875


Done!