Query         033302
Match_columns 122
No_of_seqs    125 out of 157
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 12:15:22 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033302.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033302hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03221 rapid alkalinization  100.0 3.3E-36 7.2E-41  227.4   7.4   86   37-122    36-137 (137)
  2 PLN03222 rapid alkalinization  100.0 4.9E-35 1.1E-39  217.0   5.3   76   40-122    35-119 (119)
  3 PF05498 RALF:  Rapid ALkaliniz  99.9 5.8E-24 1.3E-28  143.2   3.9   56   67-122     2-66  (66)
  4 PF07172 GRP:  Glycine rich pro  89.2    0.43 9.3E-06   34.1   2.9   24    1-25      1-24  (95)
  5 PF12273 RCR:  Chitin synthesis  73.0     2.7 5.9E-05   30.5   2.0   17    5-21      1-17  (130)
  6 PF05279 Asp-B-Hydro_N:  Aspart  53.8      11 0.00023   31.4   2.3   11    4-14     10-20  (243)
  7 PF12662 cEGF:  Complement Clr-  35.9      30 0.00065   19.3   1.6   22   97-118     1-23  (24)
  8 PF08358 Flexi_CP_N:  Carlaviru  20.1      55  0.0012   21.4   0.9   10  104-113    38-47  (52)
  9 PF10731 Anophelin:  Thrombin i  15.9 1.5E+02  0.0034   20.4   2.4   15    4-18      3-17  (65)
 10 PF13127 DUF3955:  Protein of u  15.8 2.4E+02  0.0053   18.6   3.3   35    1-37      1-35  (63)

No 1  
>PLN03221 rapid alkalinization factor 23; Provisional
Probab=100.00  E-value=3.3e-36  Score=227.39  Aligned_cols=86  Identities=70%  Similarity=1.217  Sum_probs=75.1

Q ss_pred             ccccccccCCCcccchhhhhcccC--CCCc---hhhh--hhhhccccccchhhh---------cccCCCCCCCCCCCCcC
Q 033302           37 HQLGFIPVKSECRGSIAECMSVEG--DDGD---QELD--LEFAMDGEINRRILA---------MRRNSVPCSRRGASYYN  100 (122)
Q Consensus        37 ~~~~~~~~~~~C~Gsv~EC~~~~~--~~~d---~~~e--eE~~m~Se~~RR~La---------L~rd~vPC~~rG~sYyn  100 (122)
                      ++++|.++...|+|+++||++..+  +|+|   +++|  +|++||||++||+|+         |++|+|||+++|+||||
T Consensus        36 ~~~~~~~~~~~C~GsiaEC~~~~~~~~d~e~~~g~~~~~~e~~MdSE~sRR~L~~~rYISYgALrrd~vPCsrrG~SYyn  115 (137)
T PLN03221         36 FAGDFPPFETECRGTIAECSVSAALGDDGDLFYGGGEMGAEFEMDSEINRRILATRRYISYGALRRNTIPCSRRGASYYN  115 (137)
T ss_pred             ccccccCCCCcccCCHHHHhhhhccccccccccccchhhhhhhcccHHHHHHHhcCCccCHHHhccCCCCCCCCCCCccc
Confidence            344677777889999999996543  6777   4444  499999999999995         99999999999999999


Q ss_pred             CCCCCCCCCCCCCCcccccccC
Q 033302          101 CRAGGQANPYSRGCSAITRCRR  122 (122)
Q Consensus       101 C~p~~~aNPY~RGCs~itRCrr  122 (122)
                      |++++|+|||+|||++||||||
T Consensus       116 C~~~~pANPY~RGCs~ITRCrR  137 (137)
T PLN03221        116 CRRGAQANPYSRGCSAITRCRR  137 (137)
T ss_pred             cCCCCCCCCCCCCcccccccCC
Confidence            9999999999999999999997


No 2  
>PLN03222 rapid alkalinization factor 23-like protein; Provisional
Probab=100.00  E-value=4.9e-35  Score=217.02  Aligned_cols=76  Identities=74%  Similarity=1.322  Sum_probs=69.3

Q ss_pred             cccccCCCcccchhhhhcccCCCCchhhhhhhhccccccchhhh---------cccCCCCCCCCCCCCcCCCCCCCCCCC
Q 033302           40 GFIPVKSECRGSIAECMSVEGDDGDQELDLEFAMDGEINRRILA---------MRRNSVPCSRRGASYYNCRAGGQANPY  110 (122)
Q Consensus        40 ~~~~~~~~C~Gsv~EC~~~~~~~~d~~~eeE~~m~Se~~RR~La---------L~rd~vPC~~rG~sYynC~p~~~aNPY  110 (122)
                      +|.+....|+|+++||++.       ++|+||+|+||++||+|+         |++|+|||+++|+|||||++++|+|||
T Consensus        35 ~~~~~~~~C~Gsi~EC~~~-------~~e~e~~mdSe~sRR~L~~~rYISYgALrrd~vPCsrrG~SYynC~~~~~ANPY  107 (119)
T PLN03222         35 DFMPIDSKCNGTIAECSLS-------TAEEEFEMDSEINRRILATTKYISYGALRRNTVPCSRRGASYYNCRRGAQANPY  107 (119)
T ss_pred             cccCCCCcCCCCHHHhhcc-------cccchhccccHHHHHHHhhcCeecHHHhcCCCCCCCCCCCCccccCCCCCCCCC
Confidence            6677777899999999973       235799999999999995         999999999999999999999999999


Q ss_pred             CCCCcccccccC
Q 033302          111 SRGCSAITRCRR  122 (122)
Q Consensus       111 ~RGCs~itRCrr  122 (122)
                      +|||++||||||
T Consensus       108 ~RGCs~ITrCrR  119 (119)
T PLN03222        108 SRGCSAITRCRR  119 (119)
T ss_pred             CCCchhhccccC
Confidence            999999999997


No 3  
>PF05498 RALF:  Rapid ALkalinization Factor (RALF) ;  InterPro: IPR008801 RALF, a 5 kDa ubiquitous polypeptide in plants, arrests root growth and development.
Probab=99.89  E-value=5.8e-24  Score=143.24  Aligned_cols=56  Identities=64%  Similarity=1.136  Sum_probs=52.9

Q ss_pred             hhhhhhccccccchhhh---------cccCCCCCCCCCCCCcCCCCCCCCCCCCCCCcccccccC
Q 033302           67 LDLEFAMDGEINRRILA---------MRRNSVPCSRRGASYYNCRAGGQANPYSRGCSAITRCRR  122 (122)
Q Consensus        67 ~eeE~~m~Se~~RR~La---------L~rd~vPC~~rG~sYynC~p~~~aNPY~RGCs~itRCrr  122 (122)
                      +|+|++|+|+++||+|+         |++|++||+++|.+||||.+++|+|||+|||++||||||
T Consensus         2 ee~~~~~~s~~~~R~~a~~~yIsYgaL~~~~~pc~~~g~~~~~c~~~~paNpY~RGC~~~~rCrr   66 (66)
T PF05498_consen    2 EEEEVVMESEASRRILAARRYISYGALRRDRVPCSPRGCSYYNCCPRQPANPYSRGCSKITRCRR   66 (66)
T ss_pred             hhHHhhhhhHHHHHHHhcCCeecchhccCCCCCCCcccCCCcccCCCCCCCCCCCCCCccccCCC
Confidence            36789999999999995         999999999999999999988999999999999999997


No 4  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=89.16  E-value=0.43  Score=34.13  Aligned_cols=24  Identities=29%  Similarity=0.200  Sum_probs=11.1

Q ss_pred             CCcchhHHHHHHHHHHHHHHHHHhc
Q 033302            1 MRASKFSAFSLLLAAIILAVHVASS   25 (122)
Q Consensus         1 m~~~~~~~~~~~~~~~~l~~~~~~~   25 (122)
                      |. +|...|+.+++|++|||...++
T Consensus         1 Ma-SK~~llL~l~LA~lLlisSeva   24 (95)
T PF07172_consen    1 MA-SKAFLLLGLLLAALLLISSEVA   24 (95)
T ss_pred             Cc-hhHHHHHHHHHHHHHHHHhhhh
Confidence            66 4443444444444555544333


No 5  
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=73.04  E-value=2.7  Score=30.47  Aligned_cols=17  Identities=24%  Similarity=0.653  Sum_probs=8.3

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 033302            5 KFSAFSLLLAAIILAVH   21 (122)
Q Consensus         5 ~~~~~~~~~~~~~l~~~   21 (122)
                      ||++|++|+++++|+|+
T Consensus         1 RW~l~~iii~~i~l~~~   17 (130)
T PF12273_consen    1 RWVLFAIIIVAILLFLF   17 (130)
T ss_pred             CeeeHHHHHHHHHHHHH
Confidence            45566555444344333


No 6  
>PF05279 Asp-B-Hydro_N:  Aspartyl beta-hydroxylase N-terminal region;  InterPro: IPR007943 This domain is found in members of the junctin, junctate and aspartyl beta-hydroxylase protein families. Junctate is an integral ER/SR membrane calcium binding protein, which comes from an alternatively spliced form of the same gene that generates aspartyl beta-hydroxylase and junctin []. Aspartyl beta-hydroxylase catalyses the post-translational hydroxylation of aspartic acid or asparagine residues contained within epidermal growth factor (EGF) domains of proteins []. This domain is also found in several eukaryotic triadin proteins. Triadin is a ryanodine receptor and calsequestrin binding protein located in junctional sarcoplasmic reticulum of striated muscles [].; GO: 0016020 membrane
Probab=53.81  E-value=11  Score=31.41  Aligned_cols=11  Identities=45%  Similarity=0.609  Sum_probs=7.8

Q ss_pred             chhHHHHHHHH
Q 033302            4 SKFSAFSLLLA   14 (122)
Q Consensus         4 ~~~~~~~~~~~   14 (122)
                      ++|..|||+++
T Consensus        10 ~~~~~~~~~~~   20 (243)
T PF05279_consen   10 SSFFTWFLVLA   20 (243)
T ss_pred             CchHHHHHHHH
Confidence            56777777766


No 7  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=35.87  E-value=30  Score=19.26  Aligned_cols=22  Identities=41%  Similarity=0.767  Sum_probs=17.5

Q ss_pred             CCc-CCCCCCCCCCCCCCCcccc
Q 033302           97 SYY-NCRAGGQANPYSRGCSAIT  118 (122)
Q Consensus        97 sYy-nC~p~~~aNPY~RGCs~it  118 (122)
                      ||+ .|.++=.-+|-.|.|.-|.
T Consensus         1 sy~C~C~~Gy~l~~d~~~C~DId   23 (24)
T PF12662_consen    1 SYTCSCPPGYQLSPDGRSCEDID   23 (24)
T ss_pred             CEEeeCCCCCcCCCCCCccccCC
Confidence            465 7888878888889998774


No 8  
>PF08358 Flexi_CP_N:  Carlavirus coat;  InterPro: IPR013569 This domain is found together with the viral coat protein domain (IPR000052 from INTERPRO) in coat/capsid proteins of the plant infecting Carlavirus. It is required for genome encapsidation by forming ribonucleoprotein complexes along with TGB1 helicase and viral RNA. The N- and the C terminus of this coat protein can be exposed on the surface of the virus particle. The central core sequence may be important in maintaining correct tertiary structure of the coat protein and/or play a role in the interaction with the viral RNA. Coat proteins are often used to distinguish between Carlavirus isolates.  In the coat protein amino acid sequences of definitive and tentative species of carlaviruses, there is a region of seven amino acids (GLGVPTE) that are conserved []. The complete coat protein (CP) sequences of 29 Indian Chrysanthemum virus B (CVB) isolates were highly heterogeneous, sharing nucleotide sequence identities of 74-98% [, ].
Probab=20.08  E-value=55  Score=21.39  Aligned_cols=10  Identities=60%  Similarity=1.052  Sum_probs=7.8

Q ss_pred             CCCCCCCCCC
Q 033302          104 GGQANPYSRG  113 (122)
Q Consensus       104 ~~~aNPY~RG  113 (122)
                      +.++|||+|-
T Consensus        38 ~d~tN~y~Rp   47 (52)
T PF08358_consen   38 GDPTNPYSRP   47 (52)
T ss_pred             CCcCcccCCc
Confidence            3589999984


No 9  
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=15.88  E-value=1.5e+02  Score=20.39  Aligned_cols=15  Identities=33%  Similarity=0.479  Sum_probs=9.4

Q ss_pred             chhHHHHHHHHHHHH
Q 033302            4 SKFSAFSLLLAAIIL   18 (122)
Q Consensus         4 ~~~~~~~~~~~~~~l   18 (122)
                      +|++.+.|+|+|++.
T Consensus         3 ~Kl~vialLC~aLva   17 (65)
T PF10731_consen    3 SKLIVIALLCVALVA   17 (65)
T ss_pred             chhhHHHHHHHHHHH
Confidence            567777777774433


No 10 
>PF13127 DUF3955:  Protein of unknown function (DUF3955)
Probab=15.79  E-value=2.4e+02  Score=18.63  Aligned_cols=35  Identities=31%  Similarity=0.379  Sum_probs=0.0

Q ss_pred             CCcchhHHHHHHHHHHHHHHHHHhcCCcccccCCCcc
Q 033302            1 MRASKFSAFSLLLAAIILAVHVASSSSSGVDFDGLGH   37 (122)
Q Consensus         1 m~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~   37 (122)
                      |..-....++++.+  ++.+..-...-+.||.+|.-|
T Consensus         1 m~~~~l~~~~~llg--~~~l~i~~~~~syVd~~G~L~   35 (63)
T PF13127_consen    1 MKKYILSLILLLLG--VVCLFIFNIIGSYVDEDGVLH   35 (63)
T ss_pred             CcchHHHHHHHHHH--HHHHHHHhcccceECCCCeEe


Done!