Query         033308
Match_columns 122
No_of_seqs    91 out of 93
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 12:19:47 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033308.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033308hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00088 predicted protein; Pr 100.0 2.7E-39 5.8E-44  242.6   8.1  119    1-121     1-126 (127)
  2 PF06596 PsbX:  Photosystem II   99.8 4.5E-20 9.8E-25  115.6   2.7   37   85-121     1-38  (39)
  3 CHL00114 psbX photosystem II p  99.8 1.3E-19 2.8E-24  113.8   3.8   37   85-121     1-38  (39)
  4 PF04956 TrbC:  TrbC/VIRB2 fami  70.4      11 0.00023   25.3   4.3   52   66-118    16-75  (99)
  5 PF14187 DUF4310:  Domain of un  67.4     9.1  0.0002   31.6   4.1   41   74-116    94-134 (209)
  6 TIGR03579 EF_0833 conserved hy  55.5      19 0.00041   29.8   3.9   40   74-115    92-131 (209)
  7 PF12732 YtxH:  YtxH-like prote  51.4      13 0.00028   24.4   2.0   16   92-107     1-16  (74)
  8 PF09813 Coiled-coil_56:  Coile  48.3      19 0.00041   26.8   2.6   30   88-117    48-77  (100)
  9 PF13706 PepSY_TM_3:  PepSY-ass  40.2      18 0.00039   21.5   1.2   26   94-121    11-37  (37)
 10 PHA02680 ORF090 IMV phosphoryl  38.9      28  0.0006   25.7   2.2   29   87-115     5-35  (91)
 11 PF05767 Pox_A14:  Poxvirus vir  37.3      22 0.00048   26.1   1.6   31   87-117     5-37  (92)
 12 PF04835 Pox_A9:  A9 protein co  33.3      72  0.0016   21.5   3.4   33   88-120    21-53  (54)
 13 PHA03048 IMV membrane protein;  30.7      32  0.0007   25.4   1.5   29   88-116     6-36  (93)
 14 PF07423 DUF1510:  Protein of u  29.9      63  0.0014   26.3   3.2   25   91-115    13-38  (217)
 15 COG4062 MtrB Tetrahydromethano  29.7      55  0.0012   24.8   2.6   18   87-104    75-92  (108)
 16 PRK10927 essential cell divisi  28.7      54  0.0012   28.6   2.7   22   97-118    38-59  (319)
 17 TIGR03546 conserved hypothetic  28.4      56  0.0012   25.2   2.5   21   89-109   102-122 (154)
 18 COG2354 Uncharacterized protei  25.9      66  0.0014   28.0   2.8   21   85-105   274-294 (303)
 19 PF05283 MGC-24:  Multi-glycosy  25.1      35 0.00077   27.3   1.0   23   91-113   157-179 (186)
 20 PHA02898 virion envelope prote  25.0      46 0.00099   24.6   1.5   30   88-117     6-37  (92)
 21 TIGR02838 spore_V_AC stage V s  23.5      70  0.0015   24.9   2.3   21   85-105    13-33  (141)
 22 PF14575 EphA2_TM:  Ephrin type  22.4      97  0.0021   21.0   2.6   22   93-114     3-24  (75)
 23 PF09835 DUF2062:  Uncharacteri  21.8   1E+02  0.0022   22.3   2.7   24   88-111   112-135 (154)
 24 PF11021 DUF2613:  Protein of u  20.6 1.9E+02  0.0042   19.3   3.6   25   94-118    10-34  (56)
 25 TIGR02761 TraE_TIGR type IV co  20.0      92   0.002   23.8   2.3   25   90-114    17-41  (181)

No 1  
>PLN00088 predicted protein; Provisional
Probab=100.00  E-value=2.7e-39  Score=242.62  Aligned_cols=119  Identities=36%  Similarity=0.503  Sum_probs=103.4

Q ss_pred             CCcccccc-ccccccc-ccccc---cccccccc-ccCCCCchhhhhhhcCCCCceEEeecchhHHHHHHHH-HHHHhhhc
Q 033308            1 MTSSSAIS-MAIPLTH-ASQKM---VVNSEAFF-KPLPVKPSKVLAAASKSSGRFEVEASSLKEKAVTALM-AALAASMV   73 (122)
Q Consensus         1 MAS~Sa~s-ma~pla~-as~~~---~pss~~ff-~Plp~rps~~~~~~~~~~~r~~v~As~~k~k~~~glt-aa~~Asm~   73 (122)
                      |||++..+ .+.++++ +++.|   .++.|+|- .+-+.||+++...+|  |+|+|++++.+|||+++|+| +|++|+|+
T Consensus         1 ma~~~~~s~~~a~~~~~~t~~~~~k~~~~~g~~l~~p~~~~~~~~~~~n--~~r~~~~as~~~ekav~gltaaAl~Asmv   78 (127)
T PLN00088          1 MACAAMASVSSAATAPLATLVWEAKLLSRQGLALAAPSGKKQVSVAISN--RSRVVMSLPAKEDHNVASLTSLALLAAAV   78 (127)
T ss_pred             CchHHHHHhhccccchhhHhhhhhhhhccccceecCCCCccchhhhhcc--cceeEEecchHHHHHHHHHHHHHHHHHhh
Confidence            77776555 4667777 77774   59999993 331378888887755  69999999669999999999 89999999


Q ss_pred             chHHHHhcCCCCChhHHHHHHHHHHHHHHHHHHHhhheeeecCCCccc
Q 033308           74 IPEVAEAAGPGVSSSLTNFLLSIAAGGVVLAALIGAVIGVSNFDPIKR  121 (122)
Q Consensus        74 ~P~vAeAa~~~mTPSL~NFL~SlvaGgvVv~~i~~ali~VSq~D~V~R  121 (122)
                      +||||||||+||||||+||||||+|||+|++.|+++||||||||||+|
T Consensus        79 ~pevAeAA~~gvTPSLsNFL~SLvaGgvVv~pI~~Ali~VSq~D~V~R  126 (127)
T PLN00088         79 VPEIAEAAQPGVSPSLKNLLLSVVAGGVVITVIGVAVAGVSTFDPVKR  126 (127)
T ss_pred             CHHHHHhccCCCChhHHHHHHHHHhhhhhhhhhheeeEEEeccCcccc
Confidence            999999999999999999999999999999999999999999999999


No 2  
>PF06596 PsbX:  Photosystem II reaction centre X protein (PsbX);  InterPro: IPR009518 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The low molecular weight transmembrane protein PsbX found in PSII is associated with the oxygen-evolving complex. Its expression is light-regulated. PsbX appears to be involved in the regulation of the amount of PSII [], and may be involved in the binding or turnover of quinone molecules at the Qb (PsbA) site [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0016020 membrane; PDB: 3ARC_x 3A0H_X 3A0B_X 3PRR_X 1S5L_x 4FBY_j 3PRQ_X 3KZI_X 3BZ2_X 3BZ1_X.
Probab=99.79  E-value=4.5e-20  Score=115.59  Aligned_cols=37  Identities=51%  Similarity=0.829  Sum_probs=29.4

Q ss_pred             CChhHHHHHHHHHHHH-HHHHHHHhhheeeecCCCccc
Q 033308           85 VSSSLTNFLLSIAAGG-VVLAALIGAVIGVSNFDPIKR  121 (122)
Q Consensus        85 mTPSL~NFL~SlvaGg-vVv~~i~~ali~VSq~D~V~R  121 (122)
                      |||||+|||+||+||| +|++.|+++|++|||+|+|+|
T Consensus         1 mTpSL~nfl~Sl~aG~~iVv~~i~~ali~VSq~D~v~R   38 (39)
T PF06596_consen    1 MTPSLSNFLLSLVAGAVIVVIPIAGALIFVSQFDRVKR   38 (39)
T ss_dssp             --HHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCS----
T ss_pred             CCHhHHHHHHHHHhhhhhhhhhhhhheEEEeccCcccc
Confidence            8999999999999999 666679999999999999999


No 3  
>CHL00114 psbX photosystem II protein X; Reviewed
Probab=99.78  E-value=1.3e-19  Score=113.76  Aligned_cols=37  Identities=27%  Similarity=0.419  Sum_probs=35.7

Q ss_pred             CChhHHHHHHHHHHHHHHHH-HHHhhheeeecCCCccc
Q 033308           85 VSSSLTNFLLSIAAGGVVLA-ALIGAVIGVSNFDPIKR  121 (122)
Q Consensus        85 mTPSL~NFL~SlvaGgvVv~-~i~~ali~VSq~D~V~R  121 (122)
                      |||||+|||+||+||++|++ .|+++|+||||+|+++|
T Consensus         1 MTpSLsnF~~SL~~Ga~ivvipi~~aLifvSq~D~v~R   38 (39)
T CHL00114          1 MTPSLSAFINSLLLGAIIVVIPITLALLFVSQKDRTTR   38 (39)
T ss_pred             CChhHHHHHHHHHHHHHHhHHHhhhheEEEeccceecc
Confidence            89999999999999999988 59999999999999999


No 4  
>PF04956 TrbC:  TrbC/VIRB2 family;  InterPro: IPR007039 Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure[]. This family also contains several VirB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species [].
Probab=70.38  E-value=11  Score=25.34  Aligned_cols=52  Identities=15%  Similarity=0.214  Sum_probs=26.8

Q ss_pred             HHHHhhhcchHHHHhcCCCCChhH-------HHHHHH-HHHHHHHHHHHHhhheeeecCCC
Q 033308           66 AALAASMVIPEVAEAAGPGVSSSL-------TNFLLS-IAAGGVVLAALIGAVIGVSNFDP  118 (122)
Q Consensus        66 aa~~Asm~~P~vAeAa~~~mTPSL-------~NFL~S-lvaGgvVv~~i~~ali~VSq~D~  118 (122)
                      ..+...+.+|+.|-|++.+. ...       .++|.+ +.-.-.+++++..++....+.+.
T Consensus        16 ~~~~~~~~~~~~A~A~~~~~-~~~~~~l~~i~~~l~gp~~~~i~~i~ii~~g~~~~~g~~~   75 (99)
T PF04956_consen   16 LLALALLLLASPAFAQGGGG-DPWTSFLCKIIDWLTGPIGKAIAIIAIIVAGIMMMFGRQS   75 (99)
T ss_pred             HHHHHHHHhCchhhhcCCCC-ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCcC
Confidence            55556777888888876654 333       334444 22222233345555555554443


No 5  
>PF14187 DUF4310:  Domain of unknown function (DUF4310)
Probab=67.41  E-value=9.1  Score=31.58  Aligned_cols=41  Identities=29%  Similarity=0.484  Sum_probs=32.0

Q ss_pred             chHHHHhcCCCCChhHHHHHHHHHHHHHHHHHHHhhheeeecC
Q 033308           74 IPEVAEAAGPGVSSSLTNFLLSIAAGGVVLAALIGAVIGVSNF  116 (122)
Q Consensus        74 ~P~vAeAa~~~mTPSL~NFL~SlvaGgvVv~~i~~ali~VSq~  116 (122)
                      +|.+--++  |.+-.++||-+||+-|+++=.+|...+|++-+|
T Consensus        94 ipAllL~~--Gi~~p~~~F~laLl~G~~iG~~iG~iIi~iRK~  134 (209)
T PF14187_consen   94 IPALLLSA--GITAPLENFPLALLTGAVIGLIIGYIIILIRKF  134 (209)
T ss_pred             hHHHHHhc--cccchHHHhHHHHHHHHHHHHHHhheeEEEEee
Confidence            34444454  688899999999999999888888888877653


No 6  
>TIGR03579 EF_0833 conserved hypothetical protein EF_0833/AHA_3914. Members of this family of relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown.
Probab=55.50  E-value=19  Score=29.77  Aligned_cols=40  Identities=28%  Similarity=0.404  Sum_probs=30.2

Q ss_pred             chHHHHhcCCCCChhHHHHHHHHHHHHHHHHHHHhhheeeec
Q 033308           74 IPEVAEAAGPGVSSSLTNFLLSIAAGGVVLAALIGAVIGVSN  115 (122)
Q Consensus        74 ~P~vAeAa~~~mTPSL~NFL~SlvaGgvVv~~i~~ali~VSq  115 (122)
                      +|.+--.+  |++-.++||-+||+-|+++=.+|...+|++-+
T Consensus        92 vpAllL~~--G~~~pv~nF~lsL~tG~~lG~~iG~iIi~~RK  131 (209)
T TIGR03579        92 VPAILLGA--GIVAPVENFGLSLLTGAVLGLAVGYVIILIRK  131 (209)
T ss_pred             hHHHHHhc--cccccHHHHHHHHHHHHHHHHHhheeEEEEEe
Confidence            34444444  68999999999999999887777777776544


No 7  
>PF12732 YtxH:  YtxH-like protein;  InterPro: IPR024623 This family of uncharacterised proteins is found in bacteria. Proteins in this family are typically between 100 and 143 amino acids in length. The N-terminal region is the most conserved.
Probab=51.38  E-value=13  Score=24.39  Aligned_cols=16  Identities=44%  Similarity=0.409  Sum_probs=11.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q 033308           92 FLLSIAAGGVVLAALI  107 (122)
Q Consensus        92 FL~SlvaGgvVv~~i~  107 (122)
                      |++++++|+++-++++
T Consensus         1 F~~g~l~Ga~~Ga~~g   16 (74)
T PF12732_consen    1 FLLGFLAGAAAGAAAG   16 (74)
T ss_pred             CHHHHHHHHHHHHHHH
Confidence            7888888887655443


No 8  
>PF09813 Coiled-coil_56:  Coiled-coil domain-containing protein 56;  InterPro: IPR018628  Members of this family of proteins have no known function. 
Probab=48.28  E-value=19  Score=26.78  Aligned_cols=30  Identities=23%  Similarity=0.290  Sum_probs=25.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhheeeecCC
Q 033308           88 SLTNFLLSIAAGGVVLAALIGAVIGVSNFD  117 (122)
Q Consensus        88 SL~NFL~SlvaGgvVv~~i~~ali~VSq~D  117 (122)
                      .-+|-+.++..|++|+++-+--+..|+|-|
T Consensus        48 R~rN~~Tgl~L~~~v~gIY~YTi~sV~Qe~   77 (100)
T PF09813_consen   48 RRRNLLTGLALGAFVVGIYAYTIYSVKQED   77 (100)
T ss_pred             hhhhHHHHHHHHHHHHHHHhheeeeechhh
Confidence            358999999999999999877888888865


No 9  
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=40.20  E-value=18  Score=21.46  Aligned_cols=26  Identities=35%  Similarity=0.483  Sum_probs=16.0

Q ss_pred             HHHHHHHHHHHH-HHhhheeeecCCCccc
Q 033308           94 LSIAAGGVVLAA-LIGAVIGVSNFDPIKR  121 (122)
Q Consensus        94 ~SlvaGgvVv~~-i~~ali~VSq~D~V~R  121 (122)
                      ++|+.|-+.+++ ++|++...  .|.++|
T Consensus        11 ~Gl~~g~~l~~~~~tG~~~~f--~~ei~r   37 (37)
T PF13706_consen   11 LGLILGLLLFVIFLTGAVMVF--RDEIDR   37 (37)
T ss_pred             HHHHHHHHHHHHHHHhHHHHH--HHhhcC
Confidence            567777777775 66655444  455554


No 10 
>PHA02680 ORF090 IMV phosphorylated membrane protein; Provisional
Probab=38.92  E-value=28  Score=25.66  Aligned_cols=29  Identities=21%  Similarity=0.342  Sum_probs=22.3

Q ss_pred             hhHHHHHHHHHHHHHHHHH--HHhhheeeec
Q 033308           87 SSLTNFLLSIAAGGVVLAA--LIGAVIGVSN  115 (122)
Q Consensus        87 PSL~NFL~SlvaGgvVv~~--i~~ali~VSq  115 (122)
                      --++|+..+++.||++|.+  ...|.+=.|+
T Consensus         5 ~~i~ny~s~vli~GIiLL~~ACIFAfidFSK   35 (91)
T PHA02680          5 ETLKSYYSGVLICGVLLLTAACVFAFVDFSK   35 (91)
T ss_pred             HHHHHhccHHHHHHHHHHHHHHHHhhhhhhc
Confidence            3589999999999999986  4446665565


No 11 
>PF05767 Pox_A14:  Poxvirus virion envelope protein A14;  InterPro: IPR008785 This family consists of several Poxvirus virion envelope protein A14-like sequences. A14 is a component of the virion membrane and has been found to be an H1 phosphatase substrate in vivo and in vitro. A14 is hyperphosphorylated on serine residues in the absence of H1 expression [].; GO: 0019031 viral envelope
Probab=37.28  E-value=22  Score=26.13  Aligned_cols=31  Identities=29%  Similarity=0.417  Sum_probs=22.9

Q ss_pred             hhHHHHHHHHHHHHHHHHH--HHhhheeeecCC
Q 033308           87 SSLTNFLLSIAAGGVVLAA--LIGAVIGVSNFD  117 (122)
Q Consensus        87 PSL~NFL~SlvaGgvVv~~--i~~ali~VSq~D  117 (122)
                      --|+|+..+.+.||++|.+  ...|.+=.|+.-
T Consensus         5 ~~~~n~~S~vli~GiiLL~~aCIfAfidfsK~~   37 (92)
T PF05767_consen    5 GFLSNYFSGVLIGGIILLIAACIFAFIDFSKNT   37 (92)
T ss_pred             HHHHhccchHHHHHHHHHHHHHHHHhhhhccCC
Confidence            4589999999999999986  444555555443


No 12 
>PF04835 Pox_A9:  A9 protein conserved region;  InterPro: IPR006920 This entry represents a family of Chordopoxvirus A9 proteins. Chordopoxvirus belongs to the family Poxviridae and is the cause of vertebrate infections [].
Probab=33.29  E-value=72  Score=21.54  Aligned_cols=33  Identities=21%  Similarity=0.082  Sum_probs=24.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhheeeecCCCcc
Q 033308           88 SLTNFLLSIAAGGVVLAALIGAVIGVSNFDPIK  120 (122)
Q Consensus        88 SL~NFL~SlvaGgvVv~~i~~ali~VSq~D~V~  120 (122)
                      |+.+-+.=++.+-++-.+++++|+.+|+.|.-+
T Consensus        21 sF~fViik~vismimylilGi~L~yis~~~~~~   53 (54)
T PF04835_consen   21 SFWFVIIKSVISMIMYLILGIALIYISSNDDKK   53 (54)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhhhccCcccc
Confidence            455556666777777778999999999988643


No 13 
>PHA03048 IMV membrane protein; Provisional
Probab=30.68  E-value=32  Score=25.40  Aligned_cols=29  Identities=28%  Similarity=0.438  Sum_probs=21.9

Q ss_pred             hHHHHHHHHHHHHHHHHH--HHhhheeeecC
Q 033308           88 SLTNFLLSIAAGGVVLAA--LIGAVIGVSNF  116 (122)
Q Consensus        88 SL~NFL~SlvaGgvVv~~--i~~ali~VSq~  116 (122)
                      -++|+....+.||++|.+  ...|.+=.|+.
T Consensus         6 ~~~ny~S~vli~GIiLL~~aCIfAfidfsK~   36 (93)
T PHA03048          6 MISNYFSTALIGGIILLAASCIFAFVDFSKN   36 (93)
T ss_pred             HhhcccchHHHHHHHHHHHHHHHhhhhhhcC
Confidence            489999999999999986  34455555554


No 14 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=29.90  E-value=63  Score=26.33  Aligned_cols=25  Identities=32%  Similarity=0.250  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHh-hheeeec
Q 033308           91 NFLLSIAAGGVVLAALIG-AVIGVSN  115 (122)
Q Consensus        91 NFL~SlvaGgvVv~~i~~-ali~VSq  115 (122)
                      |-+|=++.|-|+|.+|++ .-+|+.+
T Consensus        13 N~iLNiaI~IV~lLIiiva~~lf~~~   38 (217)
T PF07423_consen   13 NKILNIAIGIVSLLIIIVAYQLFFGG   38 (217)
T ss_pred             hhhHHHHHHHHHHHHHHHhhhheecC
Confidence            556666677666666444 4455533


No 15 
>COG4062 MtrB Tetrahydromethanopterin S-methyltransferase, subunit B [Coenzyme metabolism]
Probab=29.66  E-value=55  Score=24.76  Aligned_cols=18  Identities=28%  Similarity=0.305  Sum_probs=14.8

Q ss_pred             hhHHHHHHHHHHHHHHHH
Q 033308           87 SSLTNFLLSIAAGGVVLA  104 (122)
Q Consensus        87 PSL~NFL~SlvaGgvVv~  104 (122)
                      --|+||+++++.|-.|.+
T Consensus        75 G~~tna~yGfviGl~i~a   92 (108)
T COG4062          75 GYLTNAFYGFVIGLGIMA   92 (108)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            358999999999988844


No 16 
>PRK10927 essential cell division protein FtsN; Provisional
Probab=28.74  E-value=54  Score=28.61  Aligned_cols=22  Identities=23%  Similarity=0.386  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHhhheeeecCCC
Q 033308           97 AAGGVVLAALIGAVIGVSNFDP  118 (122)
Q Consensus        97 vaGgvVv~~i~~ali~VSq~D~  118 (122)
                      +....||++.+|+|.||+++.+
T Consensus        38 alAvavlv~fiGGLyFith~k~   59 (319)
T PRK10927         38 AIAAAVLVTFIGGLYFITHHKK   59 (319)
T ss_pred             HHHHHHHHHHhhheEEEecCCC
Confidence            3445567777888999998664


No 17 
>TIGR03546 conserved hypothetical protein TIGR03546. Members of this family are uncharacterized proteins, usually encoded by a gene adjacent to a member of family TIGR03545, which is also uncharacterized.
Probab=28.45  E-value=56  Score=25.17  Aligned_cols=21  Identities=24%  Similarity=0.381  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHhh
Q 033308           89 LTNFLLSIAAGGVVLAALIGA  109 (122)
Q Consensus        89 L~NFL~SlvaGgvVv~~i~~a  109 (122)
                      +..|..+++.|+++++.|.+.
T Consensus       102 l~~f~~tl~~Gg~l~Gli~~~  122 (154)
T TIGR03546       102 LARFNNTIVMGSFVVGLILLP  122 (154)
T ss_pred             HHHHHHHHHHhhHHHHHHHHH
Confidence            778889999999999986654


No 18 
>COG2354 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.85  E-value=66  Score=28.01  Aligned_cols=21  Identities=33%  Similarity=0.510  Sum_probs=18.9

Q ss_pred             CChhHHHHHHHHHHHHHHHHH
Q 033308           85 VSSSLTNFLLSIAAGGVVLAA  105 (122)
Q Consensus        85 mTPSL~NFL~SlvaGgvVv~~  105 (122)
                      ..|++-|+.+.+++|+++++.
T Consensus       274 ~~~t~~~~v~g~v~G~vvv~~  294 (303)
T COG2354         274 LVPTLLNAVLGLVIGAVVVAL  294 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            568999999999999999876


No 19 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=25.15  E-value=35  Score=27.30  Aligned_cols=23  Identities=30%  Similarity=0.296  Sum_probs=15.5

Q ss_pred             HHHHHHHHHHHHHHHHHhhheee
Q 033308           91 NFLLSIAAGGVVLAALIGAVIGV  113 (122)
Q Consensus        91 NFL~SlvaGgvVv~~i~~ali~V  113 (122)
                      -|=-.=+.||+||+.-..+++|+
T Consensus       157 ~FD~~SFiGGIVL~LGv~aI~ff  179 (186)
T PF05283_consen  157 TFDAASFIGGIVLTLGVLAIIFF  179 (186)
T ss_pred             CCchhhhhhHHHHHHHHHHHHHH
Confidence            46666678999998755555543


No 20 
>PHA02898 virion envelope protein; Provisional
Probab=25.05  E-value=46  Score=24.57  Aligned_cols=30  Identities=27%  Similarity=0.207  Sum_probs=22.2

Q ss_pred             hHHHHHHHHHHHHHHHHH--HHhhheeeecCC
Q 033308           88 SLTNFLLSIAAGGVVLAA--LIGAVIGVSNFD  117 (122)
Q Consensus        88 SL~NFL~SlvaGgvVv~~--i~~ali~VSq~D  117 (122)
                      -.+|+..+++.||++|.+  ...|.+=.|+..
T Consensus         6 ~~~N~~s~vli~GIiLL~~ACIfAfidfSK~~   37 (92)
T PHA02898          6 FFKNRPSYVVAFGIILLIVACICAYIELSKSE   37 (92)
T ss_pred             hhhcCcchHHHHHHHHHHHHHHHheehhhcCC
Confidence            368999999999999986  444555555543


No 21 
>TIGR02838 spore_V_AC stage V sporulation protein AC. This model describes stage V sporulation protein AC, a paralog of stage V sporulation protein AE. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAC have a stage V sproulation defect.
Probab=23.45  E-value=70  Score=24.87  Aligned_cols=21  Identities=19%  Similarity=0.390  Sum_probs=18.7

Q ss_pred             CChhHHHHHHHHHHHHHHHHH
Q 033308           85 VSSSLTNFLLSIAAGGVVLAA  105 (122)
Q Consensus        85 mTPSL~NFL~SlvaGgvVv~~  105 (122)
                      =.|.++|+++..+.||+|-++
T Consensus        13 k~~~~~n~l~AFlvGG~IC~i   33 (141)
T TIGR02838        13 KPPYLKNCVMAFLVGGLICLI   33 (141)
T ss_pred             CCcHHHHHHHHHHhCcHHHHH
Confidence            468899999999999999875


No 22 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=22.39  E-value=97  Score=20.96  Aligned_cols=22  Identities=32%  Similarity=0.304  Sum_probs=12.6

Q ss_pred             HHHHHHHHHHHHHHHhhheeee
Q 033308           93 LLSIAAGGVVLAALIGAVIGVS  114 (122)
Q Consensus        93 L~SlvaGgvVv~~i~~ali~VS  114 (122)
                      .++++.|.++++++.+.++++.
T Consensus         3 i~~~~~g~~~ll~~v~~~~~~~   24 (75)
T PF14575_consen    3 IASIIVGVLLLLVLVIIVIVCF   24 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCC
T ss_pred             EehHHHHHHHHHHhheeEEEEE
Confidence            4566667666665554455443


No 23 
>PF09835 DUF2062:  Uncharacterized protein conserved in bacteria (DUF2062);  InterPro: IPR018639  This domain, found in various prokaryotic proteins, has no known function. It is found at the C-terminal of family 2 glycosyltransferase proteins, in addition to proteins of unknown function.
Probab=21.76  E-value=1e+02  Score=22.25  Aligned_cols=24  Identities=29%  Similarity=0.508  Sum_probs=19.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhhe
Q 033308           88 SLTNFLLSIAAGGVVLAALIGAVI  111 (122)
Q Consensus        88 SL~NFL~SlvaGgvVv~~i~~ali  111 (122)
                      .+.++++.++.|++|++++.+.+.
T Consensus       112 ~~~~~~~~~~~G~~i~~~v~~~i~  135 (154)
T PF09835_consen  112 SLWEFGLPFLLGSLILGIVLGIIS  135 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            678899999999999998665443


No 24 
>PF11021 DUF2613:  Protein of unknown function (DUF2613);  InterPro: IPR022566  This is a family of putative small secreted proteins expressed by Actinobacteria. The function is not known. 
Probab=20.60  E-value=1.9e+02  Score=19.29  Aligned_cols=25  Identities=24%  Similarity=0.145  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHhhheeeecCCC
Q 033308           94 LSIAAGGVVLAALIGAVIGVSNFDP  118 (122)
Q Consensus        94 ~SlvaGgvVv~~i~~ali~VSq~D~  118 (122)
                      -|.++|-++=++.++++-..++.|.
T Consensus        10 aSaV~Gi~lG~~av~gvt~~~~~~s   34 (56)
T PF11021_consen   10 ASAVVGIVLGVAAVFGVTAAAQQDS   34 (56)
T ss_pred             HHHHHHHHHHHHHHhhhheeeecCC
Confidence            4556655544445555555666664


No 25 
>TIGR02761 TraE_TIGR type IV conjugative transfer system protein TraE. TraE is a component of type IV secretion systems involved in conjugative transfer of plasmid DNA. The function of the TraE protein is unknown.
Probab=20.02  E-value=92  Score=23.81  Aligned_cols=25  Identities=24%  Similarity=0.454  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHHHHhhheeee
Q 033308           90 TNFLLSIAAGGVVLAALIGAVIGVS  114 (122)
Q Consensus        90 ~NFL~SlvaGgvVv~~i~~ali~VS  114 (122)
                      -|+++.++.|++++..+.+......
T Consensus        17 ~n~l~~l~~~~l~~~~ll~~~~~~~   41 (181)
T TIGR02761        17 RNLLFVLVSGVLAVNVLLSIVLIVA   41 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5888888888887776555444443


Done!