Query         033313
Match_columns 122
No_of_seqs    135 out of 889
Neff          6.3 
Searched_HMMs 46136
Date          Fri Mar 29 12:23:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033313.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033313hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd04660 nsLTP_like nsLTP_like:  99.7 2.4E-17 5.3E-22  107.1   4.1   69   46-116     1-73  (73)
  2 cd01959 nsLTP2 nsLTP2: Non-spe  99.6 6.2E-16 1.3E-20   99.3   3.8   58   53-111     5-64  (66)
  3 cd01960 nsLTP1 nsLTP1: Non-spe  99.5   3E-14 6.4E-19   95.3   3.0   72   45-117     2-89  (89)
  4 PF14368 LTP_2:  Probable lipid  99.4   1E-14 2.2E-19   97.5  -0.1   69   43-116    19-96  (96)
  5 cd00010 AAI_LTSS AAI_LTSS: Alp  99.1   2E-11 4.3E-16   76.4   2.3   55   54-108     1-63  (63)
  6 smart00499 AAI Plant lipid tra  99.0 3.3E-10 7.2E-15   71.8   4.2   69   46-116     1-79  (79)
  7 PF00234 Tryp_alpha_amyl:  Prot  98.7 2.1E-10 4.5E-15   76.1  -5.6   63   53-116    14-90  (90)
  8 PF14547 Hydrophob_seed:  Hydro  96.7 0.00072 1.6E-08   45.4   1.2   65   53-117     8-85  (85)
  9 cd01958 HPS_like HPS_like: Hyd  96.4  0.0031 6.7E-08   42.4   2.9   70   46-116     4-85  (85)
 10 PF12273 RCR:  Chitin synthesis  91.3    0.12 2.6E-06   36.6   1.5   24   10-33      1-24  (130)
 11 cd00261 AAI_SS AAI_SS: Alpha-A  67.5     2.3 5.1E-05   28.7   0.6   43   68-110    45-104 (110)
 12 PHA02975 hypothetical protein;  64.0      12 0.00026   24.2   3.3   22    4-25     37-58  (69)
 13 PHA02819 hypothetical protein;  63.6      10 0.00023   24.6   3.0   15    6-20     38-52  (71)
 14 PHA02844 putative transmembran  63.2      10 0.00023   24.8   3.0   15    7-21     44-58  (75)
 15 PF03100 CcmE:  CcmE;  InterPro  61.4     2.7 5.8E-05   29.8   0.0   24    4-27      1-24  (131)
 16 PHA02650 hypothetical protein;  60.3      12 0.00026   24.8   2.9   14    8-21     46-59  (81)
 17 PHA02844 putative transmembran  57.8      15 0.00033   24.0   3.1   25    4-28     38-62  (75)
 18 PHA03054 IMV membrane protein;  53.6      23 0.00051   23.0   3.4   15    7-21     44-58  (72)
 19 PHA02819 hypothetical protein;  50.7      24 0.00052   22.9   3.1   23    5-27     40-62  (71)
 20 PHA02650 hypothetical protein;  42.7      37  0.0008   22.6   3.1   21    7-27     42-62  (81)
 21 PF11368 DUF3169:  Protein of u  42.0      27 0.00059   27.0   2.8   26    4-29      1-26  (248)
 22 PF05617 Prolamin_like:  Prolam  40.6      16 0.00034   22.6   1.1   21   64-84     26-46  (70)
 23 PF09889 DUF2116:  Uncharacteri  38.9      27 0.00059   21.7   1.9   19    8-26     37-55  (59)
 24 PF12853 NADH_u_ox_C:  C-termin  37.6      17 0.00036   24.6   0.9   21    4-24     27-47  (90)
 25 PF13253 DUF4044:  Protein of u  36.7      69  0.0015   17.9   3.2   16    5-20      3-18  (35)
 26 PF12911 OppC_N:  N-terminal TM  35.8      49  0.0011   19.3   2.7   21    9-29     15-35  (56)
 27 PRK13254 cytochrome c-type bio  30.7      63  0.0014   23.6   3.1   15    4-18      2-16  (148)
 28 PHA02692 hypothetical protein;  28.4      67  0.0015   20.8   2.5   10    8-17     42-51  (70)
 29 COG1580 FliL Flagellar basal b  28.1      70  0.0015   23.6   2.9   24    3-26     11-34  (159)
 30 COG3117 Uncharacterized protei  28.0      70  0.0015   24.5   3.0   24    6-29      1-24  (188)
 31 PF11466 Doppel:  Prion-like pr  28.0      62  0.0013   17.5   1.9   17    4-20      1-17  (30)
 32 PRK09510 tolA cell envelope in  27.5      75  0.0016   26.9   3.4   24    1-24      1-26  (387)
 33 PF07172 GRP:  Glycine rich pro  26.9      56  0.0012   22.1   2.1    8   17-24     11-18  (95)
 34 PRK10299 PhoPQ regulatory prot  26.3      64  0.0014   19.3   2.0   17    8-24      3-19  (47)
 35 PF12575 DUF3753:  Protein of u  24.3      98  0.0021   20.1   2.8    9   13-21     50-58  (72)
 36 PF04995 CcmD:  Heme exporter p  23.8 1.2E+02  0.0025   17.5   2.8   18   10-27      7-24  (46)
 37 PF13800 Sigma_reg_N:  Sigma fa  21.8      67  0.0015   21.1   1.7   19    8-26     11-29  (96)
 38 TIGR03141 cytochro_ccmD heme e  21.8 1.4E+02  0.0029   17.2   2.8   18   10-27      8-25  (45)
 39 PRK10617 cytochrome c-type pro  21.0      67  0.0015   24.6   1.8   11    7-17     20-30  (200)
 40 PF13721 SecD-TM1:  SecD export  20.4   1E+02  0.0022   20.8   2.4   18   10-27      3-20  (101)

No 1  
>cd04660 nsLTP_like nsLTP_like: Non-specific lipid-transfer protein (nsLTP)-like subfamily; composed of predominantly uncharacterized proteins with similarity to nsLTPs, including Medicago truncatula MtN5, the root-specific Phaseolus vulgaris PVR3, Antirrhinum majus FIL1, and Lilium longiflorum LIM3. Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes. The MtN5 gene is induced during root nodule development. FIL1 is thought to be important in petal and stamen formation. The LIM3 gene is induced during the early prophase stage of meiosis in lily microsporocytes.
Probab=99.68  E-value=2.4e-17  Score=107.09  Aligned_cols=69  Identities=35%  Similarity=0.767  Sum_probs=59.0

Q ss_pred             CchhhhccccCCcccccC-C---CCCHhHHHHHHhcCccccccCCCCCCcCCCCHHHHHHHHhhcCCCCCCCCCC
Q 033313           46 CNEERRLGLNACKPIVYG-Q---PPSPACCQRIRVQHFECICPSITPKLASLVDINKAILLLKTCGRRVPRHFKC  116 (122)
Q Consensus        46 C~~~~~~~L~pC~~yv~g-~---~Ps~~CC~~vk~~d~~ClC~~~~~~~~~~in~~~a~~Lp~~Cgv~~p~~~~C  116 (122)
                      |+.++ ..|.||++|++| .   +||++||++||++|+.|+|.+++.....+||+++|.+||++||+++|+ ++|
T Consensus         1 C~~~~-~~L~~C~~yl~~~~~~~~Ps~~CC~~vk~~~~~C~C~~~~~~~~~~i~~~~a~~Lp~~Cgv~~p~-~~C   73 (73)
T cd04660           1 CNMDL-DLLAECQPYVTGPNPPPPPSRECCAALRRADLPCLCRYKTSLVLQIIDPDKAVYLPAKCGLPLPP-SSC   73 (73)
T ss_pred             CCCCH-HHHHHHHHHHcCCCCCCCCCHHHHHHHHcCCcCCEeeccCCCcccccCHHHHHHHHHHcCCCCCC-CCC
Confidence            55664 579999999875 3   489999999999999999999965444469999999999999999999 887


No 2  
>cd01959 nsLTP2 nsLTP2: Non-specific lipid-transfer protein type 2 (nsLTP2) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes. In addition to lipid transport and assembly, nsLTPs also play a key role in the defense of plants against pathogens. There are two closely-related types of nsLTPs, types 1 and 2, which differ in protein sequence, molecular weight, and biological properties. nsLTPs contain an internal hydrophobic cavity, which serves as the binding site for lipids. nsLTP2 can bind lipids and sterols. Structure studies of rice nsLTPs show that the plasticity of the hydrophobic cavity is an important factor in ligand binding. The flexibility of the sLTP2 cavity allows its binding to rigid sterol molecules, whereas nsLTP1 cannot bind sterols despite its larger cavity size. The resulting nsLTP2/sterol complexes may bind to receptors that trigger defense responses. nsLTP2 gene exp
Probab=99.60  E-value=6.2e-16  Score=99.28  Aligned_cols=58  Identities=36%  Similarity=0.849  Sum_probs=53.6

Q ss_pred             cccCCccccc-CCCCCHhHHHHHHhcCccccccCC-CCCCcCCCCHHHHHHHHhhcCCCCC
Q 033313           53 GLNACKPIVY-GQPPSPACCQRIRVQHFECICPSI-TPKLASLVDINKAILLLKTCGRRVP  111 (122)
Q Consensus        53 ~L~pC~~yv~-g~~Ps~~CC~~vk~~d~~ClC~~~-~~~~~~~in~~~a~~Lp~~Cgv~~p  111 (122)
                      .|.+|++|+. |.+||++||+.+|+++ .|||+|+ ++.+..+||.++|++|+++||+++|
T Consensus         5 ~L~~C~~ai~~~~~Ps~~CC~~Lk~~~-~CLC~y~~~p~l~~~i~~~~A~~l~~~Cgv~~P   64 (66)
T cd01959           5 QLSPCLPAILGGSPPSAACCAKLKEQQ-SCLCQYAKNPSLKQYVNSPNARKVLAACGVPYP   64 (66)
T ss_pred             hcccCHHHHhCCCCCCHHHHHHHhcCC-CCeeeeecCccHHhhcCcHHHHHHHHHcCCCCC
Confidence            7999999976 6799999999999988 9999999 6788888999999999999999997


No 3  
>cd01960 nsLTP1 nsLTP1: Non-specific lipid-transfer protein type 1 (nsLTP1) subfamily; Plant nsLTPs are small, soluble proteins that facilitate the transfer of fatty acids, phospholipids, glycolipids, and steroids between membranes. In addition to lipid transport and assembly, nsLTPs also play a key role in the defense of plants against pathogens. There are two closely-related types of nsLTPs, types 1 and 2, which differ in protein sequence, molecular weight, and biological properties. nsLTPs contain an internal hydrophobic cavity, which serves as the binding site for lipids. The hydrophobic cavity accommodates various fatty acid ligands containing from ten to 18 carbon atoms. In general, the cavity is larger in nsLTP1 than in nsLTP2. nsLTP1 proteins are located in extracellular layers and in vacuolar structures. They may be involved in the formation of cutin layers on plant surfaces by transporting cutin monomers. Many nsLTP1 proteins have been characterized as allergens in humans.
Probab=99.46  E-value=3e-14  Score=95.34  Aligned_cols=72  Identities=25%  Similarity=0.536  Sum_probs=56.8

Q ss_pred             CCchhhhccccCCcccccC--CCCCHhHHHHHHhc--------CccccccCCCCCCcC--CCCHHHHHHHHhhcCCCCC-
Q 033313           45 QCNEERRLGLNACKPIVYG--QPPSPACCQRIRVQ--------HFECICPSITPKLAS--LVDINKAILLLKTCGRRVP-  111 (122)
Q Consensus        45 ~C~~~~~~~L~pC~~yv~g--~~Ps~~CC~~vk~~--------d~~ClC~~~~~~~~~--~in~~~a~~Lp~~Cgv~~p-  111 (122)
                      +|..+ ...|.||++|++|  ..|+++||++++++        |+.|+|..+......  .||.++|.+||++||+++| 
T Consensus         2 ~C~~v-~~~l~~C~~y~~g~~~~Ps~~CC~~v~~l~~~~~t~~~~~~~C~C~~~~~~~~~~i~~~~a~~LP~~C~v~~~~   80 (89)
T cd01960           2 SCGQV-TSLLAPCLGYLTGGGPAPSPACCSGVKSLNGLAKTTADRQAACNCLKSAAAGISGLNPGRAAGLPGKCGVSIPY   80 (89)
T ss_pred             CHHHH-HhhHHhHHHHHhCCCCCCChHHhhhhHHHhhccCCCCchhhhhhcccccccccCCCCHHHHHhChHhcccCCCC
Confidence            58887 4689999999986  37999999999994        456777776322222  2899999999999999865 


Q ss_pred             ---CCCCCC
Q 033313          112 ---RHFKCG  117 (122)
Q Consensus       112 ---~~~~C~  117 (122)
                         +++||+
T Consensus        81 ~i~~~~dC~   89 (89)
T cd01960          81 PISPSTDCS   89 (89)
T ss_pred             CCCCCCCCC
Confidence               778884


No 4  
>PF14368 LTP_2:  Probable lipid transfer; PDB: 2RKN_A 1N89_A 1TUK_A.
Probab=99.45  E-value=1e-14  Score=97.47  Aligned_cols=69  Identities=29%  Similarity=0.639  Sum_probs=46.4

Q ss_pred             CCCCchhhhccccCC---cccccC-CCCCHhHHHHHHhc---CccccccCCCCCC-cC-CCCHHHHHHHHhhcCCCCCCC
Q 033313           43 PSQCNEERRLGLNAC---KPIVYG-QPPSPACCQRIRVQ---HFECICPSITPKL-AS-LVDINKAILLLKTCGRRVPRH  113 (122)
Q Consensus        43 ~~~C~~~~~~~L~pC---~~yv~g-~~Ps~~CC~~vk~~---d~~ClC~~~~~~~-~~-~in~~~a~~Lp~~Cgv~~p~~  113 (122)
                      ..+|.+    .|.+|   ..|+.+ .+||++||+++|++   |+.|||++++... .. .||++++.+||++||+++|+ 
T Consensus        19 ~~~c~~----~l~~c~~~~~~~~~~~~Ps~~CC~~l~~~~~~~~~ClC~~~~~~~~~~~~in~~~a~~Lp~~Cg~~~~~-   93 (96)
T PF14368_consen   19 CCSCAN----SLLPCCPCLCYVTGGPAPSAACCSALKSVVQADPPCLCQLLNSPGAPGFGINVTRALALPAACGVPVPP-   93 (96)
T ss_dssp             TTB-HC----CCCHH--HHHHHCC-----HHHHHHHCC----HCCHHHCCCC-CCHCHHCCTCHHHHHHHHHCTSS-S--
T ss_pred             cchhHH----HHhccccchhccCCCCCCCHHHHHHHHHhccCCCCCHHHhcCccccccCCcCHHHHHHHHHHcCCCCCC-
Confidence            456644    46676   677764 68999999999995   7899999996433 33 49999999999999999998 


Q ss_pred             CCC
Q 033313          114 FKC  116 (122)
Q Consensus       114 ~~C  116 (122)
                      ++|
T Consensus        94 ~~C   96 (96)
T PF14368_consen   94 SKC   96 (96)
T ss_dssp             ---
T ss_pred             CCC
Confidence            877


No 5  
>cd00010 AAI_LTSS AAI_LTSS: Alpha-Amylase Inhibitors (AAI), Lipid Transfer (LT) and Seed Storage (SS) Protein family; a protein family unique to higher plants that includes cereal-type alpha-amylase inhibitors, lipid transfer proteins, seed storage proteins, and similar proteins. Proteins in this family are known to play important roles, in defending plants from insects and pathogens, lipid transport between intracellular membranes, and nutrient storage. Many proteins of this family have been identified as allergens in humans. These proteins contain a common pattern of eight cysteines that form four disulfide bridges.
Probab=99.14  E-value=2e-11  Score=76.37  Aligned_cols=55  Identities=24%  Similarity=0.664  Sum_probs=45.0

Q ss_pred             ccCCcccccC--CCCCHhHHHHHHhc---CccccccCCC-CCCcC-CC-CHHHHHHHHhhcCC
Q 033313           54 LNACKPIVYG--QPPSPACCQRIRVQ---HFECICPSIT-PKLAS-LV-DINKAILLLKTCGR  108 (122)
Q Consensus        54 L~pC~~yv~g--~~Ps~~CC~~vk~~---d~~ClC~~~~-~~~~~-~i-n~~~a~~Lp~~Cgv  108 (122)
                      |.||++|++|  ..||.+||++++++   |+.|+|+++. +.... .+ |.+++..||++||+
T Consensus         1 L~~C~~y~~~~~~~Ps~~CC~~l~~~~~~~~~ClC~~~~~~~~~~~~~~~~~~a~~LP~~Cgv   63 (63)
T cd00010           1 LAPCLSYLTGGATAPPSDCCSGLKSVVKSDPKCLCAALNGPGASLLGLKNATRALALPAACGL   63 (63)
T ss_pred             CcchHHHHcCCCCCCChHHHHHHHHHHhcChhhHHHHHcCccccccCcccHHHHHhchHhcCC
Confidence            5799999986  47999999999996   5799999994 32222 24 79999999999996


No 6  
>smart00499 AAI Plant lipid transfer protein / seed storage protein / trypsin-alpha amylase inhibitor domain family.
Probab=99.02  E-value=3.3e-10  Score=71.77  Aligned_cols=69  Identities=29%  Similarity=0.668  Sum_probs=53.6

Q ss_pred             CchhhhccccCCcccccC----CCCCHhHHHHHHhc-CccccccCCCCCCcCC-----CCHHHHHHHHhhcCCCCCCCCC
Q 033313           46 CNEERRLGLNACKPIVYG----QPPSPACCQRIRVQ-HFECICPSITPKLASL-----VDINKAILLLKTCGRRVPRHFK  115 (122)
Q Consensus        46 C~~~~~~~L~pC~~yv~g----~~Ps~~CC~~vk~~-d~~ClC~~~~~~~~~~-----in~~~a~~Lp~~Cgv~~p~~~~  115 (122)
                      |... ...+.+|.+|+.+    ..|+++||++++.+ +..|+|..+.......     ++..++.+||+.||+..+. ++
T Consensus         1 C~~~-~~~~~~c~~~~~~~~~~~~p~~~CC~~l~~~~~~~C~C~~~~~~~~~~~~~~~~~~~~a~~lp~~C~~~~~~-~~   78 (79)
T smart00499        1 CGQV-LLQLAPCLSYLTGGSPGAPPSQQCCSQLRGLNSAQCRCLALRAAVLGILEIPGVNAQNAASLPSACGVPPPY-TD   78 (79)
T ss_pred             Chhh-hhhHHhhHHHHcCCCCCCCCchHHHHHHHHhcccCCcchhhhcccccccchhhhhHHHHHhhHHhcCCCCCC-CC
Confidence            4444 2356699999864    36889999999999 9999999995333222     4899999999999999875 45


Q ss_pred             C
Q 033313          116 C  116 (122)
Q Consensus       116 C  116 (122)
                      |
T Consensus        79 C   79 (79)
T smart00499       79 C   79 (79)
T ss_pred             C
Confidence            4


No 7  
>PF00234 Tryp_alpha_amyl:  Protease inhibitor/seed storage/LTP family This is a small subfamily;  InterPro: IPR003612 This domain is found is several proteins, including plant lipid transfer proteins [], seed storage proteins [] and trypsin-alpha amylase inhibitors [, ]. The domain forms a four-helical bundle in a right-handed superhelix with a folded leaf topology, which is stabilised by disulphide bonds, and which has an internal cavity. More information about this protein can be found at Protein of the Month: alpha-Amylase [].; PDB: 1BFA_A 1BEA_A 1MID_A 1BE2_A 1LIP_A 3GSH_A 1JTB_A 1UVC_B 1BV2_A 1UVB_A ....
Probab=98.69  E-value=2.1e-10  Score=76.11  Aligned_cols=63  Identities=30%  Similarity=0.620  Sum_probs=52.0

Q ss_pred             cccCCcccccC--CCCCHhHHHHHHhcCccccccCCCCCCcC------------CCCHHHHHHHHhhcCCCCCCCCCC
Q 033313           53 GLNACKPIVYG--QPPSPACCQRIRVQHFECICPSITPKLAS------------LVDINKAILLLKTCGRRVPRHFKC  116 (122)
Q Consensus        53 ~L~pC~~yv~g--~~Ps~~CC~~vk~~d~~ClC~~~~~~~~~------------~in~~~a~~Lp~~Cgv~~p~~~~C  116 (122)
                      .+.+|.+|+++  ..|+.+||++|++++..|.|..+......            .++..+|..||+.||+++|. ++|
T Consensus        14 ~l~~c~~~~~~~~~~~~~~CC~~L~~l~~~C~C~~i~~~~~~~~~q~~~~~~~~~~~~~~a~~LP~~C~v~~~~-~~C   90 (90)
T PF00234_consen   14 RLSPCLPYLQGGCQQPSQQCCQQLRQLDPQCRCEAIRQMVRQVIQQQQQGGQEMQIMAQRAQNLPSMCNVSPPY-TDC   90 (90)
T ss_dssp             HHHGGHHHHTTSSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHSHHCTSTCSHHHHHHHHHHHHHHHHTTSSSSS-S-G
T ss_pred             cccccHHHHhcccccchHHHhHHHHHHhHHhhCHHHHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHCCCCCCC-CCC
Confidence            58999999986  36899999999999999999999422222            38899999999999999876 666


No 8  
>PF14547 Hydrophob_seed:  Hydrophobic seed protein
Probab=96.70  E-value=0.00072  Score=45.39  Aligned_cols=65  Identities=35%  Similarity=0.802  Sum_probs=45.9

Q ss_pred             cccCCcccc------cCCCCCHhHHHHHHhc-C---ccccccCCCCCCcCC--CCH-HHHHHHHhhcCCCCCCCCCCC
Q 033313           53 GLNACKPIV------YGQPPSPACCQRIRVQ-H---FECICPSITPKLASL--VDI-NKAILLLKTCGRRVPRHFKCG  117 (122)
Q Consensus        53 ~L~pC~~yv------~g~~Ps~~CC~~vk~~-d---~~ClC~~~~~~~~~~--in~-~~a~~Lp~~Cgv~~p~~~~C~  117 (122)
                      .|.-|...+      .|.++.++||.-++.. |   ..|+|..+..+....  +|. -....+...||...|++|+|.
T Consensus         8 kLgvC~~vL~l~~~~~g~~~~~~CC~li~gL~d~~AA~CLC~aika~vlg~i~~~ipv~l~~lln~CGk~~p~gf~C~   85 (85)
T PF14547_consen    8 KLGVCANVLGLVNLVIGNPPRQPCCSLIAGLADLDAAVCLCTAIKANVLGLINVNIPVALNLLLNACGKTVPSGFTCP   85 (85)
T ss_pred             hhhhhhhhhhhhccccCCCCCCCcChHHhCcccchHHHHHHHHHhhhcccccccccccHHHHHHHHhCCcCcCCCcCC
Confidence            566676655      2457889999999995 2   399999885433221  222 245677888999999999994


No 9  
>cd01958 HPS_like HPS_like: Hydrophobic Protein from Soybean (HPS)-like subfamily; composed of proteins with similarity to HPS, a small hydrophobic protein with unknown function related to cereal-type alpha-amylase inhibitors and lipid transfer proteins. In addition to HPS, members of this subfamily include a hybrid proline-rich protein (HyPRP) from maize, a dark-inducible protein (LeDI-2) from Lithospermum erythrorhizon, maize ZRP3 protein, and rice RcC3 protein. HyPRP is an embryo-specific protein that contains an N-terminal proline-rich domain and a C-terminal HPS-like cysteine-rich domain. It has been suggested that HyPRP may be involved in the stability and defense of the developing embryo. LeDI-2 is a root-specific protein that may be involved in regulating the biosynthesis of shikonin derivatives in L. erythrorhizon. Maize ZRP3 and rice RcC3 are root-specific proteins whose functions are yet to be determined. It has been reported that ZRP3 largely accumulates in a distinct subset
Probab=96.43  E-value=0.0031  Score=42.36  Aligned_cols=70  Identities=33%  Similarity=0.771  Sum_probs=46.7

Q ss_pred             CchhhhccccCCccccc------CCCCCHhHHHHHHhc---C-ccccccCCCCCCcC-CCCHH-HHHHHHhhcCCCCCCC
Q 033313           46 CNEERRLGLNACKPIVY------GQPPSPACCQRIRVQ---H-FECICPSITPKLAS-LVDIN-KAILLLKTCGRRVPRH  113 (122)
Q Consensus        46 C~~~~~~~L~pC~~yv~------g~~Ps~~CC~~vk~~---d-~~ClC~~~~~~~~~-~in~~-~a~~Lp~~Cgv~~p~~  113 (122)
                      |..+ ...+.-|..-+.      |.+|.++||..++..   | ..|+|..+..+... .+|.+ +..-+-..||...|++
T Consensus         4 CP~d-alkLgvCanvL~l~~~~~g~~~~~~CC~ll~GL~dldAA~CLCtaikan~lgi~~~~pv~l~llln~CGk~~P~g   82 (85)
T cd01958           4 CPRD-ALKLGVCANVLGLSLLLLGTPAVQPCCPLIGGLADLDAAVCLCTAIKANILGISINIPVALSLLLNSCGRNVPPG   82 (85)
T ss_pred             CCcc-hHHhchhHhhhhccccccCCCccchHHHHHcCchhhheeeeeeeeeeccccCcccccChhHHHHHHHHcCcCCCC
Confidence            5544 234566655432      457889999999985   3 39999999543322 23333 3445667899999999


Q ss_pred             CCC
Q 033313          114 FKC  116 (122)
Q Consensus       114 ~~C  116 (122)
                      |+|
T Consensus        83 f~C   85 (85)
T cd01958          83 FTC   85 (85)
T ss_pred             CcC
Confidence            998


No 10 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=91.29  E-value=0.12  Score=36.57  Aligned_cols=24  Identities=29%  Similarity=0.479  Sum_probs=18.2

Q ss_pred             hhhHHHHHHHHHHHHHHHHhhccc
Q 033313           10 RWSSFIMSRVACVLMLMMVMDGRV   33 (122)
Q Consensus        10 ~~~~~~~~~l~~~v~~~~~~~~~~   33 (122)
                      ||++|+++|+++++++.+..-++-
T Consensus         1 RW~l~~iii~~i~l~~~~~~~~~r   24 (130)
T PF12273_consen    1 RWVLFAIIIVAILLFLFLFYCHNR   24 (130)
T ss_pred             CeeeHHHHHHHHHHHHHHHHHHHH
Confidence            899999988888777766554554


No 11 
>cd00261 AAI_SS AAI_SS: Alpha-Amylase Inhibitors (AAIs) and Seed Storage (SS) Protein subfamily; composed of cereal-type AAIs and SS proteins. They are mainly present in the seeds of a variety of plants. AAIs play an important role in the natural defenses of plants against insects and pathogens such as fungi, bacteria and viruses. AAIs impede the digestion of plant starch and proteins by inhibiting digestive alpha-amylases and proteinases. Also included in this subfamily are SS proteins such as 2S albumin, gamma-gliadin, napin, and prolamin. These AAIs and SS proteins are also known allergens in humans.
Probab=67.48  E-value=2.3  Score=28.69  Aligned_cols=43  Identities=19%  Similarity=0.318  Sum_probs=32.1

Q ss_pred             HhHHHHHHhcCccccccCCCC-------CC-------cC---CCCHHHHHHHHhhcCCCC
Q 033313           68 PACCQRIRVQHFECICPSITP-------KL-------AS---LVDINKAILLLKTCGRRV  110 (122)
Q Consensus        68 ~~CC~~vk~~d~~ClC~~~~~-------~~-------~~---~in~~~a~~Lp~~Cgv~~  110 (122)
                      ..||..++.++..|.|..+..       ..       ..   ..-...|.+||..||+..
T Consensus        45 qqCCqqL~~i~~qcrC~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~Lp~~C~~~~  104 (110)
T cd00261          45 QQCCQQLAQIPEQCRCEALRQMVQGVIQQQQQQQEQQQGQEVERMRQAAQNLPSMCNLYP  104 (110)
T ss_pred             HHHHHHHHhCcHhhhHHHHHHHHHHHHHhhhccccccCcChHHHHHHHHHhhchhcCCCC
Confidence            579999999999999998821       10       00   123468999999999986


No 12 
>PHA02975 hypothetical protein; Provisional
Probab=63.97  E-value=12  Score=24.17  Aligned_cols=22  Identities=23%  Similarity=0.063  Sum_probs=14.7

Q ss_pred             cccccchhhHHHHHHHHHHHHH
Q 033313            4 MKKKNSRWSSFIMSRVACVLML   25 (122)
Q Consensus         4 ~~~~~~~~~~~~~~~l~~~v~~   25 (122)
                      -+++++.|+.|++.+++.++++
T Consensus        37 ~~~~~~~~~~~ii~i~~v~~~~   58 (69)
T PHA02975         37 PKKKSSLSIILIIFIIFITCIA   58 (69)
T ss_pred             CCcCCchHHHHHHHHHHHHHHH
Confidence            4557788888887766654443


No 13 
>PHA02819 hypothetical protein; Provisional
Probab=63.62  E-value=10  Score=24.57  Aligned_cols=15  Identities=13%  Similarity=-0.075  Sum_probs=6.8

Q ss_pred             cccchhhHHHHHHHH
Q 033313            6 KKNSRWSSFIMSRVA   20 (122)
Q Consensus         6 ~~~~~~~~~~~~~l~   20 (122)
                      ++|+.|+.|..++++
T Consensus        38 ~~~~~~~~~~~~ii~   52 (71)
T PHA02819         38 KKTKKSFLRYYLIIG   52 (71)
T ss_pred             ccccCChhHHHHHHH
Confidence            344444444444444


No 14 
>PHA02844 putative transmembrane protein; Provisional
Probab=63.17  E-value=10  Score=24.82  Aligned_cols=15  Identities=13%  Similarity=0.118  Sum_probs=7.4

Q ss_pred             ccchhhHHHHHHHHH
Q 033313            7 KNSRWSSFIMSRVAC   21 (122)
Q Consensus         7 ~~~~~~~~~~~~l~~   21 (122)
                      +.+.|+.|++.+++.
T Consensus        44 ~~~~~~~~ii~i~~v   58 (75)
T PHA02844         44 CSSSTKIWILTIIFV   58 (75)
T ss_pred             CChhHHHHHHHHHHH
Confidence            344555555544443


No 15 
>PF03100 CcmE:  CcmE;  InterPro: IPR004329 CcmE is the product of one of a cluster of Ccm genes that are necessary for cytochrome c biosynthesis in eubacteria. Expression of these proteins is induced when the organisms are grown under anaerobic conditions with nitrate or nitrite as the final electron acceptor.; GO: 0017003 protein-heme linkage, 0017004 cytochrome complex assembly, 0005886 plasma membrane; PDB: 1SR3_A 2KCT_A 1J6Q_A 1LM0_A.
Probab=61.37  E-value=2.7  Score=29.81  Aligned_cols=24  Identities=17%  Similarity=0.324  Sum_probs=0.0

Q ss_pred             cccccchhhHHHHHHHHHHHHHHH
Q 033313            4 MKKKNSRWSSFIMSRVACVLMLMM   27 (122)
Q Consensus         4 ~~~~~~~~~~~~~~~l~~~v~~~~   27 (122)
                      |++|+.||..++..++++.+++.+
T Consensus         1 ~~~~~~rl~~~~~~~~~i~~~~~l   24 (131)
T PF03100_consen    1 MKRRKKRLILVVLGLVIIAAAIYL   24 (131)
T ss_dssp             ------------------------
T ss_pred             CCcceeehhhHHHHHHHHHHHHHH
Confidence            789999988777665555444333


No 16 
>PHA02650 hypothetical protein; Provisional
Probab=60.35  E-value=12  Score=24.84  Aligned_cols=14  Identities=14%  Similarity=-0.026  Sum_probs=6.1

Q ss_pred             cchhhHHHHHHHHH
Q 033313            8 NSRWSSFIMSRVAC   21 (122)
Q Consensus         8 ~~~~~~~~~~~l~~   21 (122)
                      .+.|+.|++.+++.
T Consensus        46 ~~~~~~~ii~i~~v   59 (81)
T PHA02650         46 WFNGQNFIFLIFSL   59 (81)
T ss_pred             CchHHHHHHHHHHH
Confidence            34444444444333


No 17 
>PHA02844 putative transmembrane protein; Provisional
Probab=57.79  E-value=15  Score=24.04  Aligned_cols=25  Identities=16%  Similarity=0.152  Sum_probs=20.2

Q ss_pred             cccccchhhHHHHHHHHHHHHHHHH
Q 033313            4 MKKKNSRWSSFIMSRVACVLMLMMV   28 (122)
Q Consensus         4 ~~~~~~~~~~~~~~~l~~~v~~~~~   28 (122)
                      -.++|+.|+.|..++++++.+++..
T Consensus        38 ~~~~~~~~~~~~~~ii~i~~v~~~~   62 (75)
T PHA02844         38 VNKNNVCSSSTKIWILTIIFVVFAT   62 (75)
T ss_pred             ccccccCChhHHHHHHHHHHHHHHH
Confidence            4568999999999999877776653


No 18 
>PHA03054 IMV membrane protein; Provisional
Probab=53.57  E-value=23  Score=22.98  Aligned_cols=15  Identities=13%  Similarity=0.104  Sum_probs=7.0

Q ss_pred             ccchhhHHHHHHHHH
Q 033313            7 KNSRWSSFIMSRVAC   21 (122)
Q Consensus         7 ~~~~~~~~~~~~l~~   21 (122)
                      +.+.|+.|++.+++.
T Consensus        44 ~~~~~~~~ii~l~~v   58 (72)
T PHA03054         44 GCWGWYWLIIIFFIV   58 (72)
T ss_pred             CCchHHHHHHHHHHH
Confidence            344555555544443


No 19 
>PHA02819 hypothetical protein; Provisional
Probab=50.66  E-value=24  Score=22.91  Aligned_cols=23  Identities=22%  Similarity=0.299  Sum_probs=17.5

Q ss_pred             ccccchhhHHHHHHHHHHHHHHH
Q 033313            5 KKKNSRWSSFIMSRVACVLMLMM   27 (122)
Q Consensus         5 ~~~~~~~~~~~~~~l~~~v~~~~   27 (122)
                      .++.+.|+.|++.+++.++++.+
T Consensus        40 ~~~~~~~~~~ii~l~~~~~~~~~   62 (71)
T PHA02819         40 TKKSFLRYYLIIGLVTIVFVIIF   62 (71)
T ss_pred             ccCChhHHHHHHHHHHHHHHHHH
Confidence            46788999999888887666544


No 20 
>PHA02650 hypothetical protein; Provisional
Probab=42.71  E-value=37  Score=22.55  Aligned_cols=21  Identities=10%  Similarity=0.101  Sum_probs=18.0

Q ss_pred             ccchhhHHHHHHHHHHHHHHH
Q 033313            7 KNSRWSSFIMSRVACVLMLMM   27 (122)
Q Consensus         7 ~~~~~~~~~~~~l~~~v~~~~   27 (122)
                      |++.|+.|..++++++++++.
T Consensus        42 ~~~~~~~~~~~ii~i~~v~i~   62 (81)
T PHA02650         42 KSVSWFNGQNFIFLIFSLIIV   62 (81)
T ss_pred             cccCCchHHHHHHHHHHHHHH
Confidence            889999999999997777655


No 21 
>PF11368 DUF3169:  Protein of unknown function (DUF3169);  InterPro: IPR021509  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function. 
Probab=41.96  E-value=27  Score=26.99  Aligned_cols=26  Identities=27%  Similarity=0.240  Sum_probs=17.2

Q ss_pred             cccccchhhHHHHHHHHHHHHHHHHh
Q 033313            4 MKKKNSRWSSFIMSRVACVLMLMMVM   29 (122)
Q Consensus         4 ~~~~~~~~~~~~~~~l~~~v~~~~~~   29 (122)
                      ||||.+|+--+...+++..++-++.|
T Consensus         1 MK~~k~~~~~~~~~illg~~iGg~~G   26 (248)
T PF11368_consen    1 MKKKKKRILRFLLLILLGGLIGGFIG   26 (248)
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHHH
Confidence            88877777666666666665555543


No 22 
>PF05617 Prolamin_like:  Prolamin-like;  InterPro: IPR008502 This entry consists of several proteins of unknown function found exclusively in Arabidopsis thaliana.
Probab=40.57  E-value=16  Score=22.58  Aligned_cols=21  Identities=24%  Similarity=0.572  Sum_probs=17.9

Q ss_pred             CCCCHhHHHHHHhcCcccccc
Q 033313           64 QPPSPACCQRIRVQHFECICP   84 (122)
Q Consensus        64 ~~Ps~~CC~~vk~~d~~ClC~   84 (122)
                      ...+.+||.++...+..|.=.
T Consensus        26 ~~i~~~CC~~i~~~g~~C~~~   46 (70)
T PF05617_consen   26 KNIGPECCKAINKMGKDCHPA   46 (70)
T ss_pred             CCCChHHHHHHHHHhHhHHHH
Confidence            478899999999998888766


No 23 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=38.90  E-value=27  Score=21.74  Aligned_cols=19  Identities=5%  Similarity=0.114  Sum_probs=9.9

Q ss_pred             cchhhHHHHHHHHHHHHHH
Q 033313            8 NSRWSSFIMSRVACVLMLM   26 (122)
Q Consensus         8 ~~~~~~~~~~~l~~~v~~~   26 (122)
                      +.+|-+|++.++.+++.+.
T Consensus        37 ~~~~i~~~~~i~~l~v~~~   55 (59)
T PF09889_consen   37 KTQYIFFGIFILFLAVWIF   55 (59)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4556555555554444443


No 24 
>PF12853 NADH_u_ox_C:  C-terminal of NADH-ubiquinone oxidoreductase 21 kDa subunit;  InterPro: IPR024549 This domain is found in the C-terminal region of fungal NADH-ubiquinone oxidoreductase 21 kDa subunits [].
Probab=37.61  E-value=17  Score=24.61  Aligned_cols=21  Identities=19%  Similarity=0.406  Sum_probs=16.8

Q ss_pred             cccccchhhHHHHHHHHHHHH
Q 033313            4 MKKKNSRWSSFIMSRVACVLM   24 (122)
Q Consensus         4 ~~~~~~~~~~~~~~~l~~~v~   24 (122)
                      +--+|||||.+.+.++-++=+
T Consensus        27 vA~RNS~yS~l~~~viPWFNf   47 (90)
T PF12853_consen   27 VAARNSRYSQLFFAVIPWFNF   47 (90)
T ss_pred             HHHhhhHHHHHHHHHhcchhh
Confidence            345899999999999887654


No 25 
>PF13253 DUF4044:  Protein of unknown function (DUF4044)
Probab=36.72  E-value=69  Score=17.93  Aligned_cols=16  Identities=38%  Similarity=0.372  Sum_probs=9.5

Q ss_pred             ccccchhhHHHHHHHH
Q 033313            5 KKKNSRWSSFIMSRVA   20 (122)
Q Consensus         5 ~~~~~~~~~~~~~~l~   20 (122)
                      |||.|+..-.+..++.
T Consensus         3 kkkKS~fekiT~v~v~   18 (35)
T PF13253_consen    3 KKKKSTFEKITMVVVW   18 (35)
T ss_pred             CccccHHHHHHHHHHH
Confidence            5677777665544433


No 26 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=35.78  E-value=49  Score=19.29  Aligned_cols=21  Identities=5%  Similarity=0.148  Sum_probs=12.8

Q ss_pred             chhhHHHHHHHHHHHHHHHHh
Q 033313            9 SRWSSFIMSRVACVLMLMMVM   29 (122)
Q Consensus         9 ~~~~~~~~~~l~~~v~~~~~~   29 (122)
                      +|..++.+.+++.++++++.|
T Consensus        15 nk~a~~gl~il~~~vl~ai~~   35 (56)
T PF12911_consen   15 NKLAVIGLIILLILVLLAIFA   35 (56)
T ss_pred             CchHHHHHHHHHHHHHHHHHH
Confidence            455566666666666666653


No 27 
>PRK13254 cytochrome c-type biogenesis protein CcmE; Reviewed
Probab=30.73  E-value=63  Score=23.57  Aligned_cols=15  Identities=27%  Similarity=0.286  Sum_probs=8.1

Q ss_pred             cccccchhhHHHHHH
Q 033313            4 MKKKNSRWSSFIMSR   18 (122)
Q Consensus         4 ~~~~~~~~~~~~~~~   18 (122)
                      |++|..||..++..+
T Consensus         2 ~~~~~~rl~~~~~~~   16 (148)
T PRK13254          2 MKRKRRRLLIILGAL   16 (148)
T ss_pred             CccchhHHHHHHHHH
Confidence            456666774444333


No 28 
>PHA02692 hypothetical protein; Provisional
Probab=28.37  E-value=67  Score=20.78  Aligned_cols=10  Identities=10%  Similarity=0.594  Sum_probs=4.4

Q ss_pred             cchhhHHHHH
Q 033313            8 NSRWSSFIMS   17 (122)
Q Consensus         8 ~~~~~~~~~~   17 (122)
                      .+.|+.+++.
T Consensus        42 ~~~~~~~ii~   51 (70)
T PHA02692         42 GVPWTTVFLI   51 (70)
T ss_pred             CcchHHHHHH
Confidence            3444444444


No 29 
>COG1580 FliL Flagellar basal body-associated protein [Cell motility and secretion]
Probab=28.06  E-value=70  Score=23.62  Aligned_cols=24  Identities=33%  Similarity=0.314  Sum_probs=15.1

Q ss_pred             ccccccchhhHHHHHHHHHHHHHH
Q 033313            3 SMKKKNSRWSSFIMSRVACVLMLM   26 (122)
Q Consensus         3 ~~~~~~~~~~~~~~~~l~~~v~~~   26 (122)
                      .+|||.+.|-+++..++...+.++
T Consensus        11 ~~~~k~~~~I~liv~ivl~~~a~~   34 (159)
T COG1580          11 AKKKKKSLWILLIVLIVLLALAGA   34 (159)
T ss_pred             ccCCCceeehHHHHHHHHHHHHHH
Confidence            466777777777666665544433


No 30 
>COG3117 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.02  E-value=70  Score=24.47  Aligned_cols=24  Identities=21%  Similarity=0.270  Sum_probs=14.8

Q ss_pred             cccchhhHHHHHHHHHHHHHHHHh
Q 033313            6 KKNSRWSSFIMSRVACVLMLMMVM   29 (122)
Q Consensus         6 ~~~~~~~~~~~~~l~~~v~~~~~~   29 (122)
                      +++.||-..|++.+++.++-.+.+
T Consensus         1 ~~~~Rw~~~ILll~a~~~~~w~~~   24 (188)
T COG3117           1 SMSRRWVYLILLLAALALSGWLLG   24 (188)
T ss_pred             CcchhHHHHHHHHHHHHHHHHhhh
Confidence            367899986665555555544443


No 31 
>PF11466 Doppel:  Prion-like protein Doppel;  InterPro: IPR021566  Dpl is a homologue related to the prion protein (PrP). Dpl is toxic to neurons and is expressed in the brains of mice that do not express PrP. In DHPC and SDS micelles, Dpl shoes about 40% alpha-helical structure however in aqueous solution it consists of a random coil. The alpha helical segment can adopt a transmembrane localisation also in a membrane. The unprocessed Dpl protein is thought to posses a possible channel formation mechanism which may be related to toxicity through direct interaction with cell membranes and damage to the cell membrane. ; PDB: 1Z65_A.
Probab=28.00  E-value=62  Score=17.52  Aligned_cols=17  Identities=24%  Similarity=0.354  Sum_probs=8.6

Q ss_pred             cccccchhhHHHHHHHH
Q 033313            4 MKKKNSRWSSFIMSRVA   20 (122)
Q Consensus         4 ~~~~~~~~~~~~~~~l~   20 (122)
                      |+|.-.-|-++++++|.
T Consensus         1 Mrk~Lg~~~lAi~c~LL   17 (30)
T PF11466_consen    1 MRKHLGGWWLAIVCVLL   17 (30)
T ss_dssp             --SS-SSHHHHHHHHHH
T ss_pred             CccchhhHHHHHHHHHH
Confidence            66766777666655543


No 32 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=27.54  E-value=75  Score=26.87  Aligned_cols=24  Identities=17%  Similarity=0.219  Sum_probs=11.2

Q ss_pred             CCccccccc-hhhHHH-HHHHHHHHH
Q 033313            1 MGSMKKKNS-RWSSFI-MSRVACVLM   24 (122)
Q Consensus         1 ~~~~~~~~~-~~~~~~-~~~l~~~v~   24 (122)
                      |+.|..+|+ .+..++ ..+|+++++
T Consensus         1 m~~~~~~~~~~~~aiiiSv~LHvlLi   26 (387)
T PRK09510          1 MSKATEQNDKLKRAIIISVVLHIILF   26 (387)
T ss_pred             CCccccccccchhHHHHHHHHHHHHH
Confidence            777744433 333444 444444333


No 33 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=26.92  E-value=56  Score=22.08  Aligned_cols=8  Identities=25%  Similarity=0.376  Sum_probs=2.9

Q ss_pred             HHHHHHHH
Q 033313           17 SRVACVLM   24 (122)
Q Consensus        17 ~~l~~~v~   24 (122)
                      ++||++++
T Consensus        11 l~LA~lLl   18 (95)
T PF07172_consen   11 LLLAALLL   18 (95)
T ss_pred             HHHHHHHH
Confidence            33333333


No 34 
>PRK10299 PhoPQ regulatory protein; Provisional
Probab=26.33  E-value=64  Score=19.29  Aligned_cols=17  Identities=29%  Similarity=0.841  Sum_probs=12.6

Q ss_pred             cchhhHHHHHHHHHHHH
Q 033313            8 NSRWSSFIMSRVACVLM   24 (122)
Q Consensus         8 ~~~~~~~~~~~l~~~v~   24 (122)
                      .-||-..+..+++++++
T Consensus         3 k~rwiili~iv~~Cl~l   19 (47)
T PRK10299          3 KFRWVVLVVVVLACLLL   19 (47)
T ss_pred             eeeehHHHHHHHHHHHH
Confidence            46898888877777664


No 35 
>PF12575 DUF3753:  Protein of unknown function (DUF3753);  InterPro: IPR009175 This group represents an uncharacterised conserved protein belonging to poxvirus family I2.
Probab=24.31  E-value=98  Score=20.11  Aligned_cols=9  Identities=22%  Similarity=0.272  Sum_probs=3.6

Q ss_pred             HHHHHHHHH
Q 033313           13 SFIMSRVAC   21 (122)
Q Consensus        13 ~~~~~~l~~   21 (122)
                      .+++.+++.
T Consensus        50 ~~ii~ii~v   58 (72)
T PF12575_consen   50 ILIISIIFV   58 (72)
T ss_pred             HHHHHHHHH
Confidence            344444333


No 36 
>PF04995 CcmD:  Heme exporter protein D (CcmD);  InterPro: IPR007078 The CcmD protein is part of a C-type cytochrome biogenesis operon []. The exact function of this protein is uncertain. It has been proposed that CcmC, CcmD and CcmE interact directly with each other, establishing a cytoplasm to periplasm haem delivery pathway for cytochrome c maturation []. This protein is found fused to CcmE in P52224 from SWISSPROT. These proteins contain a predicted transmembrane helix.; GO: 0006810 transport, 0016021 integral to membrane
Probab=23.78  E-value=1.2e+02  Score=17.48  Aligned_cols=18  Identities=17%  Similarity=0.409  Sum_probs=12.5

Q ss_pred             hhhHHHHHHHHHHHHHHH
Q 033313           10 RWSSFIMSRVACVLMLMM   27 (122)
Q Consensus        10 ~~~~~~~~~l~~~v~~~~   27 (122)
                      -|+++.+..++++.++..
T Consensus         7 VW~sYg~t~~~l~~l~~~   24 (46)
T PF04995_consen    7 VWSSYGVTALVLAGLIVW   24 (46)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            488888877777665554


No 37 
>PF13800 Sigma_reg_N:  Sigma factor regulator N-terminal
Probab=21.84  E-value=67  Score=21.07  Aligned_cols=19  Identities=16%  Similarity=0.511  Sum_probs=8.2

Q ss_pred             cchhhHHHHHHHHHHHHHH
Q 033313            8 NSRWSSFIMSRVACVLMLM   26 (122)
Q Consensus         8 ~~~~~~~~~~~l~~~v~~~   26 (122)
                      .++|.-++++++++++++.
T Consensus        11 k~~l~~~~isi~~~lvi~~   29 (96)
T PF13800_consen   11 KSRLRTVVISIISALVIFI   29 (96)
T ss_pred             HHHHHHHHHHHhhhhhhHH
Confidence            3444443344444444433


No 38 
>TIGR03141 cytochro_ccmD heme exporter protein CcmD. The model for this protein family describes a small, hydrophobic, and only moderately well-conserved protein, tricky to identify accurately for all of these reasons. However, members are found as part of large operons involved in heme export across the inner membrane for assembly of c-type cytochromes in a large number of bacteria. The gray zone between the trusted cutoff (13.0) and noise cutoff (4.75) includes both low-scoring examples and false-positive matches to hydrophobic domains of longer proteins.
Probab=21.82  E-value=1.4e+02  Score=17.17  Aligned_cols=18  Identities=6%  Similarity=0.348  Sum_probs=12.6

Q ss_pred             hhhHHHHHHHHHHHHHHH
Q 033313           10 RWSSFIMSRVACVLMLMM   27 (122)
Q Consensus        10 ~~~~~~~~~l~~~v~~~~   27 (122)
                      -|+++.+..+.++.++..
T Consensus         8 VW~sYg~t~l~l~~li~~   25 (45)
T TIGR03141         8 VWLAYGITALVLAGLILW   25 (45)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            488888887777555544


No 39 
>PRK10617 cytochrome c-type protein NapC; Provisional
Probab=20.98  E-value=67  Score=24.61  Aligned_cols=11  Identities=18%  Similarity=-0.019  Sum_probs=4.8

Q ss_pred             ccchhhHHHHH
Q 033313            7 KNSRWSSFIMS   17 (122)
Q Consensus         7 ~~~~~~~~~~~   17 (122)
                      |+++|++++++
T Consensus        20 k~~~~~l~~ll   30 (200)
T PRK10617         20 TPSRLALGTLL   30 (200)
T ss_pred             hhHHHHHHHHH
Confidence            34455444433


No 40 
>PF13721 SecD-TM1:  SecD export protein N-terminal TM region
Probab=20.44  E-value=1e+02  Score=20.80  Aligned_cols=18  Identities=22%  Similarity=0.298  Sum_probs=9.6

Q ss_pred             hhhHHHHHHHHHHHHHHH
Q 033313           10 RWSSFIMSRVACVLMLMM   27 (122)
Q Consensus        10 ~~~~~~~~~l~~~v~~~~   27 (122)
                      |.+.|+-+.+++++++++
T Consensus         3 ~yp~WKyllil~vl~~~~   20 (101)
T PF13721_consen    3 RYPLWKYLLILVVLLLGA   20 (101)
T ss_pred             CcchHHHHHHHHHHHHHH
Confidence            445556555555554444


Done!