Citrus Sinensis ID: 033329
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| 359486314 | 282 | PREDICTED: nitrilase homolog 1-like [Vit | 0.975 | 0.418 | 0.805 | 2e-51 | |
| 255568181 | 333 | nitrilase and fragile histidine triad fu | 0.991 | 0.360 | 0.783 | 1e-49 | |
| 224098154 | 271 | predicted protein [Populus trichocarpa] | 0.975 | 0.435 | 0.762 | 6e-49 | |
| 224112919 | 293 | predicted protein [Populus trichocarpa] | 0.975 | 0.402 | 0.754 | 1e-48 | |
| 363807860 | 283 | uncharacterized protein LOC100781131 [Gl | 0.975 | 0.416 | 0.771 | 2e-48 | |
| 357445021 | 283 | Nitrilase-like protein [Medicago truncat | 0.966 | 0.413 | 0.777 | 3e-48 | |
| 388500566 | 317 | unknown [Lotus japonicus] | 1.0 | 0.381 | 0.743 | 4e-48 | |
| 297813341 | 307 | hypothetical protein ARALYDRAFT_911156 [ | 0.950 | 0.374 | 0.741 | 3e-47 | |
| 18413157 | 307 | Nitrilase/cyanide hydratase and apolipop | 0.950 | 0.374 | 0.732 | 9e-47 | |
| 7267521 | 316 | nitrilase 1 like protein [Arabidopsis th | 0.950 | 0.363 | 0.732 | 1e-46 |
| >gi|359486314|ref|XP_002275667.2| PREDICTED: nitrilase homolog 1-like [Vitis vinifera] gi|297736451|emb|CBI25322.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 206 bits (523), Expect = 2e-51, Method: Compositional matrix adjust.
Identities = 95/118 (80%), Positives = 104/118 (88%)
Query: 4 AHSVRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKIAE 63
A+SVRVA QMTS+NDLAANFATCSRLVKEA SAGAK +CFPENFS+V KD +++ IAE
Sbjct: 2 ANSVRVAAVQMTSVNDLAANFATCSRLVKEAVSAGAKFICFPENFSFVATKDGESLTIAE 61
Query: 64 PLDGPIMQGYCSLARESSMWLSLGGFQEKGSDDARLCNTHVLLDDAGNIRSTYRKIHL 121
PLDGPIMQGY SLARES +WLSLGGFQEKG DDA LCNTHVL+DD GNIRS YRKIHL
Sbjct: 62 PLDGPIMQGYRSLARESKIWLSLGGFQEKGQDDAHLCNTHVLIDDTGNIRSKYRKIHL 119
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255568181|ref|XP_002525066.1| nitrilase and fragile histidine triad fusion protein, putative [Ricinus communis] gi|223535647|gb|EEF37313.1| nitrilase and fragile histidine triad fusion protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224098154|ref|XP_002311127.1| predicted protein [Populus trichocarpa] gi|222850947|gb|EEE88494.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224112919|ref|XP_002316330.1| predicted protein [Populus trichocarpa] gi|222865370|gb|EEF02501.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|363807860|ref|NP_001242187.1| uncharacterized protein LOC100781131 [Glycine max] gi|255647154|gb|ACU24045.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357445021|ref|XP_003592788.1| Nitrilase-like protein [Medicago truncatula] gi|355481836|gb|AES63039.1| Nitrilase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388500566|gb|AFK38349.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|297813341|ref|XP_002874554.1| hypothetical protein ARALYDRAFT_911156 [Arabidopsis lyrata subsp. lyrata] gi|297320391|gb|EFH50813.1| hypothetical protein ARALYDRAFT_911156 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18413157|ref|NP_567340.1| Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase family protein [Arabidopsis thaliana] gi|13926307|gb|AAK49620.1|AF372904_1 AT4g08790/T32A17_100 [Arabidopsis thaliana] gi|22137058|gb|AAM91374.1| At4g08790/T32A17_100 [Arabidopsis thaliana] gi|332657278|gb|AEE82678.1| Nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|7267521|emb|CAB78004.1| nitrilase 1 like protein [Arabidopsis thaliana] gi|7321068|emb|CAB82115.1| nitrilase 1 like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| TAIR|locus:2138208 | 307 | AT4G08790 "AT4G08790" [Arabido | 0.950 | 0.374 | 0.732 | 1.9e-44 | |
| ZFIN|ZDB-GENE-040912-65 | 316 | nit1 "nitrilase 1" [Danio reri | 0.958 | 0.367 | 0.458 | 1.1e-23 | |
| UNIPROTKB|F1S193 | 312 | NIT1 "Uncharacterized protein" | 0.933 | 0.362 | 0.456 | 1.4e-23 | |
| UNIPROTKB|F1S194 | 332 | NIT1 "Uncharacterized protein" | 0.933 | 0.340 | 0.456 | 1.4e-23 | |
| UNIPROTKB|B1AQP4 | 243 | NIT1 "Nitrilase homolog 1" [Ho | 0.933 | 0.465 | 0.465 | 2.9e-23 | |
| UNIPROTKB|Q86X76 | 327 | NIT1 "Nitrilase homolog 1" [Ho | 0.933 | 0.345 | 0.465 | 2.9e-23 | |
| UNIPROTKB|F1PLS8 | 549 | NIT1 "Uncharacterized protein" | 0.933 | 0.205 | 0.465 | 9.9e-23 | |
| UNIPROTKB|F1N1W5 | 328 | NIT1 "Nitrilase homolog 1" [Bo | 0.933 | 0.344 | 0.439 | 1.3e-22 | |
| UNIPROTKB|Q32LH4 | 328 | NIT1 "Nitrilase homolog 1" [Bo | 0.933 | 0.344 | 0.431 | 2.1e-22 | |
| MGI|MGI:1350916 | 323 | Nit1 "nitrilase 1" [Mus muscul | 0.933 | 0.349 | 0.448 | 2.1e-22 |
| TAIR|locus:2138208 AT4G08790 "AT4G08790" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 468 (169.8 bits), Expect = 1.9e-44, P = 1.9e-44
Identities = 85/116 (73%), Positives = 104/116 (89%)
Query: 6 SVRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKIAEPL 65
+VRVA AQMTS+NDL NFATCSRLV+EAA AGAKL+CFPENFS+VGDK+ +++KIAEPL
Sbjct: 36 TVRVAAAQMTSVNDLMTNFATCSRLVQEAALAGAKLICFPENFSFVGDKEGESVKIAEPL 95
Query: 66 DGPIMQGYCSLARESSMWLSLGGFQEKGSDDARLCNTHVLLDDAGNIRSTYRKIHL 121
DGP+M+ YCSLAR+S++WLSLGGFQE+ DD LCNTHV++DDAG IR TY+K+HL
Sbjct: 96 DGPVMERYCSLARDSNIWLSLGGFQER-FDDTHLCNTHVVIDDAGMIRDTYQKMHL 150
|
|
| ZFIN|ZDB-GENE-040912-65 nit1 "nitrilase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S193 NIT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S194 NIT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B1AQP4 NIT1 "Nitrilase homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86X76 NIT1 "Nitrilase homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PLS8 NIT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N1W5 NIT1 "Nitrilase homolog 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32LH4 NIT1 "Nitrilase homolog 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1350916 Nit1 "nitrilase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00029495001 | SubName- Full=Chromosome chr13 scaffold_48, whole genome shotgun sequence; (282 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00017570001 | • | • | • | 0.575 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| PLN02798 | 286 | PLN02798, PLN02798, nitrilase | 4e-76 | |
| cd07572 | 265 | cd07572, nit, Nit1, Nit 2, and related proteins, a | 2e-45 | |
| cd07581 | 255 | cd07581, nitrilase_3, Uncharacterized subgroup of | 4e-30 | |
| cd07197 | 253 | cd07197, nitrilase, Nitrilase superfamily, includi | 2e-25 | |
| pfam00795 | 172 | pfam00795, CN_hydrolase, Carbon-nitrogen hydrolase | 4e-25 | |
| cd07583 | 253 | cd07583, nitrilase_5, Uncharacterized subgroup of | 1e-21 | |
| cd07584 | 258 | cd07584, nitrilase_6, Uncharacterized subgroup of | 2e-19 | |
| cd07580 | 268 | cd07580, nitrilase_2, Uncharacterized subgroup of | 8e-19 | |
| COG0388 | 274 | COG0388, COG0388, Predicted amidohydrolase [Genera | 3e-18 | |
| cd07576 | 254 | cd07576, R-amidase_like, Pseudomonas sp | 3e-17 | |
| cd07579 | 279 | cd07579, nitrilase_1_R2, Second nitrilase domain o | 2e-15 | |
| cd07585 | 261 | cd07585, nitrilase_7, Uncharacterized subgroup of | 3e-15 | |
| TIGR03381 | 279 | TIGR03381, agmatine_aguB, N-carbamoylputrescine am | 8e-15 | |
| cd07573 | 284 | cd07573, CPA, N-carbamoylputrescine amidohydrolase | 2e-14 | |
| cd07564 | 297 | cd07564, nitrilases_CHs, Nitrilases, cyanide hydra | 4e-12 | |
| cd07569 | 302 | cd07569, DCase, N-carbamyl-D-amino acid amidohydro | 1e-11 | |
| PLN02747 | 296 | PLN02747, PLN02747, N-carbamolyputrescine amidase | 3e-10 | |
| cd07574 | 280 | cd07574, nitrilase_Rim1_like, Uncharacterized subg | 2e-07 | |
| cd07568 | 287 | cd07568, ML_beta-AS_like, mammalian-like beta-alan | 2e-07 | |
| TIGR04048 | 301 | TIGR04048, nitrile_sll0784, putative nitrilase, sl | 7e-07 | |
| cd07578 | 258 | cd07578, nitrilase_1_R1, First nitrilase domain of | 1e-06 | |
| cd07577 | 259 | cd07577, Ph0642_like, Pyrococcus horikoshii Ph0642 | 4e-06 | |
| PLN02504 | 346 | PLN02504, PLN02504, nitrilase | 5e-06 | |
| cd07586 | 269 | cd07586, nitrilase_8, Uncharacterized subgroup of | 1e-05 | |
| cd07570 | 261 | cd07570, GAT_Gln-NAD-synth, Glutamine aminotransfe | 1e-05 | |
| cd07571 | 270 | cd07571, ALP_N-acyl_transferase, Apolipoprotein N- | 2e-05 | |
| PRK13981 | 540 | PRK13981, PRK13981, NAD synthetase; Provisional | 8e-05 | |
| PRK02628 | 679 | PRK02628, nadE, NAD synthetase; Reviewed | 4e-04 | |
| cd07565 | 291 | cd07565, aliphatic_amidase, aliphatic amidases (cl | 5e-04 | |
| cd07567 | 299 | cd07567, biotinidase_like, biotinidase and vanins | 0.002 | |
| cd07566 | 295 | cd07566, ScNTA1_like, Saccharomyces cerevisiae N-t | 0.002 |
| >gnl|CDD|215428 PLN02798, PLN02798, nitrilase | Back alignment and domain information |
|---|
Score = 226 bits (578), Expect = 4e-76
Identities = 91/120 (75%), Positives = 102/120 (85%)
Query: 2 AGAHSVRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKI 61
SVRVAVAQMTS NDLAANFATCSRL KEAA+AGAKLL PE FS++GDKD +++ I
Sbjct: 6 TAGSSVRVAVAQMTSTNDLAANFATCSRLAKEAAAAGAKLLFLPECFSFIGDKDGESLAI 65
Query: 62 AEPLDGPIMQGYCSLARESSMWLSLGGFQEKGSDDARLCNTHVLLDDAGNIRSTYRKIHL 121
AEPLDGPIMQ Y SLARES +WLSLGGFQEKG DD+ L NTHVL+DD+G IRS+YRKIHL
Sbjct: 66 AEPLDGPIMQRYRSLARESGLWLSLGGFQEKGPDDSHLYNTHVLIDDSGEIRSSYRKIHL 125
|
Length = 286 |
| >gnl|CDD|143596 cd07572, nit, Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143605 cd07581, nitrilase_3, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143587 cd07197, nitrilase, Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|216124 pfam00795, CN_hydrolase, Carbon-nitrogen hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|143607 cd07583, nitrilase_5, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143608 cd07584, nitrilase_6, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143604 cd07580, nitrilase_2, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|223465 COG0388, COG0388, Predicted amidohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|143600 cd07576, R-amidase_like, Pseudomonas sp | Back alignment and domain information |
|---|
| >gnl|CDD|143603 cd07579, nitrilase_1_R2, Second nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143609 cd07585, nitrilase_7, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|188311 TIGR03381, agmatine_aguB, N-carbamoylputrescine amidase | Back alignment and domain information |
|---|
| >gnl|CDD|143597 cd07573, CPA, N-carbamoylputrescine amidohydrolase (CPA) (class 11 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143588 cd07564, nitrilases_CHs, Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143593 cd07569, DCase, N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|215398 PLN02747, PLN02747, N-carbamolyputrescine amidase | Back alignment and domain information |
|---|
| >gnl|CDD|143598 cd07574, nitrilase_Rim1_like, Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143592 cd07568, ML_beta-AS_like, mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|188563 TIGR04048, nitrile_sll0784, putative nitrilase, sll0784 family | Back alignment and domain information |
|---|
| >gnl|CDD|143602 cd07578, nitrilase_1_R1, First nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143601 cd07577, Ph0642_like, Pyrococcus horikoshii Ph0642 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|178120 PLN02504, PLN02504, nitrilase | Back alignment and domain information |
|---|
| >gnl|CDD|143610 cd07586, nitrilase_8, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143594 cd07570, GAT_Gln-NAD-synth, Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143595 cd07571, ALP_N-acyl_transferase, Apolipoprotein N-acyl transferase (class 9 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|237577 PRK13981, PRK13981, NAD synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235057 PRK02628, nadE, NAD synthetase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|143589 cd07565, aliphatic_amidase, aliphatic amidases (class 2 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143591 cd07567, biotinidase_like, biotinidase and vanins (class 4 nitrilases) | Back alignment and domain information |
|---|
| >gnl|CDD|143590 cd07566, ScNTA1_like, Saccharomyces cerevisiae N-terminal amidase NTA1, and related proteins (class 3 nitrilases) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| PLN02798 | 286 | nitrilase | 99.95 | |
| PLN02747 | 296 | N-carbamolyputrescine amidase | 99.95 | |
| cd07583 | 253 | nitrilase_5 Uncharacterized subgroup of the nitril | 99.95 | |
| TIGR03381 | 279 | agmatine_aguB N-carbamoylputrescine amidase. Membe | 99.95 | |
| cd07572 | 265 | nit Nit1, Nit 2, and related proteins, and the Nit | 99.94 | |
| cd07568 | 287 | ML_beta-AS_like mammalian-like beta-alanine syntha | 99.94 | |
| cd07581 | 255 | nitrilase_3 Uncharacterized subgroup of the nitril | 99.94 | |
| cd07566 | 295 | ScNTA1_like Saccharomyces cerevisiae N-terminal am | 99.94 | |
| PLN02504 | 346 | nitrilase | 99.94 | |
| cd07573 | 284 | CPA N-carbamoylputrescine amidohydrolase (CPA) (cl | 99.94 | |
| cd07564 | 297 | nitrilases_CHs Nitrilases, cyanide hydratase (CH)s | 99.94 | |
| cd07576 | 254 | R-amidase_like Pseudomonas sp. MCI3434 R-amidase a | 99.93 | |
| PF00795 | 186 | CN_hydrolase: Carbon-nitrogen hydrolase The Prosit | 99.93 | |
| cd07579 | 279 | nitrilase_1_R2 Second nitrilase domain of an uncha | 99.93 | |
| cd07565 | 291 | aliphatic_amidase aliphatic amidases (class 2 nitr | 99.93 | |
| cd07584 | 258 | nitrilase_6 Uncharacterized subgroup of the nitril | 99.93 | |
| cd07587 | 363 | ML_beta-AS mammalian-like beta-alanine synthase (b | 99.93 | |
| cd07569 | 302 | DCase N-carbamyl-D-amino acid amidohydrolase (DCas | 99.93 | |
| PLN00202 | 405 | beta-ureidopropionase | 99.93 | |
| cd07578 | 258 | nitrilase_1_R1 First nitrilase domain of an unchar | 99.93 | |
| PRK13287 | 333 | amiF formamidase; Provisional | 99.92 | |
| cd07585 | 261 | nitrilase_7 Uncharacterized subgroup of the nitril | 99.92 | |
| PRK10438 | 256 | C-N hydrolase family amidase; Provisional | 99.92 | |
| cd07567 | 299 | biotinidase_like biotinidase and vanins (class 4 n | 99.92 | |
| cd07575 | 252 | Xc-1258_like Xanthomonas campestris XC1258 and rel | 99.92 | |
| cd07580 | 268 | nitrilase_2 Uncharacterized subgroup of the nitril | 99.92 | |
| cd07582 | 294 | nitrilase_4 Uncharacterized subgroup of the nitril | 99.92 | |
| cd07197 | 253 | nitrilase Nitrilase superfamily, including nitrile | 99.92 | |
| PRK13286 | 345 | amiE acylamide amidohydrolase; Provisional | 99.91 | |
| COG0388 | 274 | Predicted amidohydrolase [General function predict | 99.91 | |
| cd07574 | 280 | nitrilase_Rim1_like Uncharacterized subgroup of th | 99.91 | |
| cd07577 | 259 | Ph0642_like Pyrococcus horikoshii Ph0642 and relat | 99.91 | |
| cd07570 | 261 | GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, | 99.9 | |
| PRK02628 | 679 | nadE NAD synthetase; Reviewed | 99.9 | |
| cd07571 | 270 | ALP_N-acyl_transferase Apolipoprotein N-acyl trans | 99.9 | |
| cd07586 | 269 | nitrilase_8 Uncharacterized subgroup of the nitril | 99.9 | |
| PLN02339 | 700 | NAD+ synthase (glutamine-hydrolysing) | 99.89 | |
| KOG0807 | 295 | consensus Carbon-nitrogen hydrolase [Amino acid tr | 99.89 | |
| PRK13981 | 540 | NAD synthetase; Provisional | 99.88 | |
| TIGR00546 | 391 | lnt apolipoprotein N-acyltransferase. This enzyme | 99.85 | |
| KOG0806 | 298 | consensus Carbon-nitrogen hydrolase [Amino acid tr | 99.82 | |
| PRK00302 | 505 | lnt apolipoprotein N-acyltransferase; Reviewed | 99.8 | |
| KOG0805 | 337 | consensus Carbon-nitrogen hydrolase [Amino acid tr | 99.78 | |
| PRK12291 | 418 | apolipoprotein N-acyltransferase; Reviewed | 99.76 | |
| KOG0808 | 387 | consensus Carbon-nitrogen hydrolase [Amino acid tr | 99.62 | |
| COG0815 | 518 | Lnt Apolipoprotein N-acyltransferase [Cell envelop | 99.61 | |
| PRK13825 | 388 | conjugal transfer protein TraB; Provisional | 99.52 | |
| KOG2303 | 706 | consensus Predicted NAD synthase, contains CN hydr | 98.86 | |
| cd07565 | 291 | aliphatic_amidase aliphatic amidases (class 2 nitr | 95.06 | |
| KOG0807 | 295 | consensus Carbon-nitrogen hydrolase [Amino acid tr | 94.48 | |
| cd07585 | 261 | nitrilase_7 Uncharacterized subgroup of the nitril | 93.88 | |
| cd07586 | 269 | nitrilase_8 Uncharacterized subgroup of the nitril | 93.72 | |
| cd07576 | 254 | R-amidase_like Pseudomonas sp. MCI3434 R-amidase a | 93.66 | |
| cd07572 | 265 | nit Nit1, Nit 2, and related proteins, and the Nit | 93.41 | |
| cd07584 | 258 | nitrilase_6 Uncharacterized subgroup of the nitril | 93.39 | |
| PRK15018 | 245 | 1-acyl-sn-glycerol-3-phosphate acyltransferase; Pr | 93.38 | |
| cd07197 | 253 | nitrilase Nitrilase superfamily, including nitrile | 93.01 | |
| cd07567 | 299 | biotinidase_like biotinidase and vanins (class 4 n | 92.79 | |
| cd07570 | 261 | GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, | 92.49 | |
| TIGR03381 | 279 | agmatine_aguB N-carbamoylputrescine amidase. Membe | 92.46 | |
| PRK13286 | 345 | amiE acylamide amidohydrolase; Provisional | 92.3 | |
| PLN02798 | 286 | nitrilase | 91.98 | |
| cd07580 | 268 | nitrilase_2 Uncharacterized subgroup of the nitril | 91.95 | |
| cd07587 | 363 | ML_beta-AS mammalian-like beta-alanine synthase (b | 91.67 | |
| cd07583 | 253 | nitrilase_5 Uncharacterized subgroup of the nitril | 91.38 | |
| cd07577 | 259 | Ph0642_like Pyrococcus horikoshii Ph0642 and relat | 91.34 | |
| cd07573 | 284 | CPA N-carbamoylputrescine amidohydrolase (CPA) (cl | 90.94 | |
| TIGR00530 | 130 | AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltra | 90.93 | |
| cd07568 | 287 | ML_beta-AS_like mammalian-like beta-alanine syntha | 90.71 | |
| PRK13981 | 540 | NAD synthetase; Provisional | 90.3 | |
| PF01553 | 132 | Acyltransferase: Acyltransferase; InterPro: IPR002 | 90.28 | |
| COG0388 | 274 | Predicted amidohydrolase [General function predict | 90.22 | |
| PLN02747 | 296 | N-carbamolyputrescine amidase | 89.02 | |
| cd07990 | 193 | LPLAT_LCLAT1-like Lysophospholipid Acyltransferase | 88.88 | |
| cd07578 | 258 | nitrilase_1_R1 First nitrilase domain of an unchar | 88.53 | |
| PLN00202 | 405 | beta-ureidopropionase | 88.49 | |
| PLN02504 | 346 | nitrilase | 88.05 | |
| cd07581 | 255 | nitrilase_3 Uncharacterized subgroup of the nitril | 87.94 | |
| KOG2792 | 280 | consensus Putative cytochrome C oxidase assembly p | 87.77 | |
| cd07582 | 294 | nitrilase_4 Uncharacterized subgroup of the nitril | 87.57 | |
| PRK10438 | 256 | C-N hydrolase family amidase; Provisional | 86.72 | |
| smart00563 | 118 | PlsC Phosphate acyltransferases. Function in phosp | 86.52 | |
| cd07988 | 163 | LPLAT_ABO13168-like Lysophospholipid Acyltransfera | 85.93 | |
| cd07986 | 210 | LPLAT_ACT14924-like Lysophospholipid Acyltransfera | 85.05 | |
| TIGR00542 | 279 | hxl6Piso_put hexulose-6-phosphate isomerase, putat | 84.84 | |
| PRK09856 | 275 | fructoselysine 3-epimerase; Provisional | 84.32 | |
| cd07579 | 279 | nitrilase_1_R2 Second nitrilase domain of an uncha | 83.98 | |
| cd07564 | 297 | nitrilases_CHs Nitrilases, cyanide hydratase (CH)s | 83.97 | |
| PTZ00261 | 355 | acyltransferase; Provisional | 83.77 | |
| COG1941 | 247 | FrhG Coenzyme F420-reducing hydrogenase, gamma sub | 83.06 | |
| PRK13287 | 333 | amiF formamidase; Provisional | 80.18 |
| >PLN02798 nitrilase | Back alignment and domain information |
|---|
Probab=99.95 E-value=4.9e-27 Score=162.54 Aligned_cols=117 Identities=78% Similarity=1.178 Sum_probs=100.5
Q ss_pred cccEEEEEEeccccCHHHHHHHHHHHHHHHHHCCCcEEEccCCccCCCCCCchhhhcccCCCChHHHHHHHHHHHcCcEE
Q 033329 5 HSVRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKIAEPLDGPIMQGYCSLARESSMWL 84 (121)
Q Consensus 5 ~~~~ia~vQ~~~~~~~~~n~~~~~~~~~~a~~~~~dlvv~PE~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~~~i 84 (121)
..||||++|++..+|.+.|++++.+++++|++.|+|||||||++..+|+...+...+++..+++..+.++++|+++++.|
T Consensus 9 ~~~ria~~Q~~~~~d~~~N~~~~~~~i~~A~~~gadlvvfPE~~~~~g~~~~~~~~~~~~~~~~~~~~l~~~A~~~~i~i 88 (286)
T PLN02798 9 SSVRVAVAQMTSTNDLAANFATCSRLAKEAAAAGAKLLFLPECFSFIGDKDGESLAIAEPLDGPIMQRYRSLARESGLWL 88 (286)
T ss_pred CccEEEEEEccCCCCHHHHHHHHHHHHHHHHHCCCCEEEcCCCccccCcCchhhhhhcccCCCHHHHHHHHHHHHcCeEE
Confidence 57999999999889999999999999999999999999999986436776555445555567788999999999999999
Q ss_pred EeccceeecCCCCceEEEEEEECCCCCEEeeeecCCC
Q 033329 85 SLGGFQEKGSDDARLCNTHVLLDDAGNIRSTYRKIHL 121 (121)
Q Consensus 85 i~G~~~~~~~~~~~~~Ns~~~i~~~G~i~~~y~K~hL 121 (121)
++|++.++..+++++||++++|+|+|++++.|+|+||
T Consensus 89 v~G~~~~~~~~~~~~yNs~~vi~~~G~i~~~y~K~~L 125 (286)
T PLN02798 89 SLGGFQEKGPDDSHLYNTHVLIDDSGEIRSSYRKIHL 125 (286)
T ss_pred EEeeeEcccCCCCceEEEEEEECCCCCEEEEEEEEEe
Confidence 9987665322457899999999999999999999986
|
|
| >PLN02747 N-carbamolyputrescine amidase | Back alignment and domain information |
|---|
| >cd07583 nitrilase_5 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >TIGR03381 agmatine_aguB N-carbamoylputrescine amidase | Back alignment and domain information |
|---|
| >cd07572 nit Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases) | Back alignment and domain information |
|---|
| >cd07568 ML_beta-AS_like mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) | Back alignment and domain information |
|---|
| >cd07581 nitrilase_3 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07566 ScNTA1_like Saccharomyces cerevisiae N-terminal amidase NTA1, and related proteins (class 3 nitrilases) | Back alignment and domain information |
|---|
| >PLN02504 nitrilase | Back alignment and domain information |
|---|
| >cd07573 CPA N-carbamoylputrescine amidohydrolase (CPA) (class 11 nitrilases) | Back alignment and domain information |
|---|
| >cd07564 nitrilases_CHs Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases) | Back alignment and domain information |
|---|
| >cd07576 R-amidase_like Pseudomonas sp | Back alignment and domain information |
|---|
| >PF00795 CN_hydrolase: Carbon-nitrogen hydrolase The Prosite family is specific to nitrilases The Prosite family is specific to UPF0012; InterPro: IPR003010 This family contains nitrilases that break carbon-nitrogen bonds and appear to be involved in the reduction of organic nitrogen compounds and ammonia production [] | Back alignment and domain information |
|---|
| >cd07579 nitrilase_1_R2 Second nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07565 aliphatic_amidase aliphatic amidases (class 2 nitrilases) | Back alignment and domain information |
|---|
| >cd07584 nitrilase_6 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07587 ML_beta-AS mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) | Back alignment and domain information |
|---|
| >cd07569 DCase N-carbamyl-D-amino acid amidohydrolase (DCase, class 6 nitrilases) | Back alignment and domain information |
|---|
| >PLN00202 beta-ureidopropionase | Back alignment and domain information |
|---|
| >cd07578 nitrilase_1_R1 First nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >PRK13287 amiF formamidase; Provisional | Back alignment and domain information |
|---|
| >cd07585 nitrilase_7 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >PRK10438 C-N hydrolase family amidase; Provisional | Back alignment and domain information |
|---|
| >cd07567 biotinidase_like biotinidase and vanins (class 4 nitrilases) | Back alignment and domain information |
|---|
| >cd07575 Xc-1258_like Xanthomonas campestris XC1258 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07580 nitrilase_2 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07582 nitrilase_4 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07197 nitrilase Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes | Back alignment and domain information |
|---|
| >PRK13286 amiE acylamide amidohydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0388 Predicted amidohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd07574 nitrilase_Rim1_like Uncharacterized subgroup of the nitrilase superfamily; some members of this subgroup have an N-terminal RimI domain (class 12 nitrilases) | Back alignment and domain information |
|---|
| >cd07577 Ph0642_like Pyrococcus horikoshii Ph0642 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07570 GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases) | Back alignment and domain information |
|---|
| >PRK02628 nadE NAD synthetase; Reviewed | Back alignment and domain information |
|---|
| >cd07571 ALP_N-acyl_transferase Apolipoprotein N-acyl transferase (class 9 nitrilases) | Back alignment and domain information |
|---|
| >cd07586 nitrilase_8 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >PLN02339 NAD+ synthase (glutamine-hydrolysing) | Back alignment and domain information |
|---|
| >KOG0807 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13981 NAD synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00546 lnt apolipoprotein N-acyltransferase | Back alignment and domain information |
|---|
| >KOG0806 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00302 lnt apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG0805 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12291 apolipoprotein N-acyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG0808 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0815 Lnt Apolipoprotein N-acyltransferase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK13825 conjugal transfer protein TraB; Provisional | Back alignment and domain information |
|---|
| >KOG2303 consensus Predicted NAD synthase, contains CN hydrolase domain [Coenzyme transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >cd07565 aliphatic_amidase aliphatic amidases (class 2 nitrilases) | Back alignment and domain information |
|---|
| >KOG0807 consensus Carbon-nitrogen hydrolase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd07585 nitrilase_7 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07586 nitrilase_8 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07576 R-amidase_like Pseudomonas sp | Back alignment and domain information |
|---|
| >cd07572 nit Nit1, Nit 2, and related proteins, and the Nit1-like domain of NitFhit (class 10 nitrilases) | Back alignment and domain information |
|---|
| >cd07584 nitrilase_6 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >PRK15018 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd07197 nitrilase Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes | Back alignment and domain information |
|---|
| >cd07567 biotinidase_like biotinidase and vanins (class 4 nitrilases) | Back alignment and domain information |
|---|
| >cd07570 GAT_Gln-NAD-synth Glutamine aminotransferase (GAT, glutaminase) domain of glutamine-dependent NAD synthetases (class 7 and 8 nitrilases) | Back alignment and domain information |
|---|
| >TIGR03381 agmatine_aguB N-carbamoylputrescine amidase | Back alignment and domain information |
|---|
| >PRK13286 amiE acylamide amidohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02798 nitrilase | Back alignment and domain information |
|---|
| >cd07580 nitrilase_2 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07587 ML_beta-AS mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) | Back alignment and domain information |
|---|
| >cd07583 nitrilase_5 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07577 Ph0642_like Pyrococcus horikoshii Ph0642 and related proteins, members of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07573 CPA N-carbamoylputrescine amidohydrolase (CPA) (class 11 nitrilases) | Back alignment and domain information |
|---|
| >TIGR00530 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltransferases | Back alignment and domain information |
|---|
| >cd07568 ML_beta-AS_like mammalian-like beta-alanine synthase (beta-AS) and similar proteins (class 5 nitrilases) | Back alignment and domain information |
|---|
| >PRK13981 NAD synthetase; Provisional | Back alignment and domain information |
|---|
| >PF01553 Acyltransferase: Acyltransferase; InterPro: IPR002123 This family contains acyltransferases involved in phospholipid biosynthesis and other proteins of unknown function [] | Back alignment and domain information |
|---|
| >COG0388 Predicted amidohydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02747 N-carbamolyputrescine amidase | Back alignment and domain information |
|---|
| >cd07990 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like | Back alignment and domain information |
|---|
| >cd07578 nitrilase_1_R1 First nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >PLN00202 beta-ureidopropionase | Back alignment and domain information |
|---|
| >PLN02504 nitrilase | Back alignment and domain information |
|---|
| >cd07581 nitrilase_3 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd07582 nitrilase_4 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >PRK10438 C-N hydrolase family amidase; Provisional | Back alignment and domain information |
|---|
| >smart00563 PlsC Phosphate acyltransferases | Back alignment and domain information |
|---|
| >cd07988 LPLAT_ABO13168-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ABO13168 | Back alignment and domain information |
|---|
| >cd07986 LPLAT_ACT14924-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ACT14924 | Back alignment and domain information |
|---|
| >TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative | Back alignment and domain information |
|---|
| >PRK09856 fructoselysine 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >cd07579 nitrilase_1_R2 Second nitrilase domain of an uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases) | Back alignment and domain information |
|---|
| >cd07564 nitrilases_CHs Nitrilases, cyanide hydratase (CH)s, and similar proteins (class 1 nitrilases) | Back alignment and domain information |
|---|
| >PTZ00261 acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13287 amiF formamidase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 121 | ||||
| 1ems_A | 440 | Crystal Structure Of The C. Elegans Nitfhit Protein | 2e-18 | ||
| 1j31_A | 262 | Crystal Structure Of Hypothetical Protein Ph0642 Fr | 9e-07 | ||
| 2w1v_A | 276 | Crystal Structure Of Mouse Nitrilase-2 At 1.4a Reso | 9e-07 | ||
| 3ivz_A | 262 | Crystal Structure Of Hyperthermophilic Nitrilase Le | 1e-06 | ||
| 1uf4_A | 303 | Crystal Structure Of C171aV236A MUTANT OF N-Carbamy | 6e-05 | ||
| 1erz_A | 303 | Crystal Structure Of N-Carbamyl-D-Amino Acid Amidoh | 7e-05 | ||
| 1fo6_A | 304 | Crystal Structure Analysis Of N-Carbamoyl-D-Amino-A | 1e-04 | ||
| 2ggl_A | 304 | The Mutant A222c Of Agrobacterium Radiobacter N-Car | 2e-04 | ||
| 2ggk_A | 304 | The Mutant A302c Of Agrobacterium Radiobacter N-Car | 2e-04 |
| >pdb|1EMS|A Chain A, Crystal Structure Of The C. Elegans Nitfhit Protein Length = 440 | Back alignment and structure |
|
| >pdb|1J31|A Chain A, Crystal Structure Of Hypothetical Protein Ph0642 From Pyrococcus Horikoshii Length = 262 | Back alignment and structure |
| >pdb|2W1V|A Chain A, Crystal Structure Of Mouse Nitrilase-2 At 1.4a Resolution Length = 276 | Back alignment and structure |
| >pdb|3IVZ|A Chain A, Crystal Structure Of Hyperthermophilic Nitrilase Length = 262 | Back alignment and structure |
| >pdb|1UF4|A Chain A, Crystal Structure Of C171aV236A MUTANT OF N-Carbamyl-D- Amino Acid Amidohydrolase Length = 303 | Back alignment and structure |
| >pdb|1ERZ|A Chain A, Crystal Structure Of N-Carbamyl-D-Amino Acid Amidohydrolase With A Novel Catalytic Framework Common To Amidohydrolases Length = 303 | Back alignment and structure |
| >pdb|1FO6|A Chain A, Crystal Structure Analysis Of N-Carbamoyl-D-Amino-Acid Amidohydrolase Length = 304 | Back alignment and structure |
| >pdb|2GGL|A Chain A, The Mutant A222c Of Agrobacterium Radiobacter N-Carbamoyl-D-Amino Acid Amidohydrolase Length = 304 | Back alignment and structure |
| >pdb|2GGK|A Chain A, The Mutant A302c Of Agrobacterium Radiobacter N-Carbamoyl-D- Amino-Acid Amidohydrolase Length = 304 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| 1ems_A | 440 | Nitfhit, NIT-fragIle histidine triad fusion protei | 2e-47 | |
| 2w1v_A | 276 | Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A | 2e-43 | |
| 1f89_A | 291 | 32.5 kDa protein YLR351C; nitrilase, dimer, struct | 2e-37 | |
| 3hkx_A | 283 | Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alp | 9e-33 | |
| 3p8k_A | 281 | Hydrolase, carbon-nitrogen family; HET: PGE; 1.70A | 2e-30 | |
| 1uf5_A | 303 | N-carbamyl-D-amino acid amidohydrolase; HET: CDT; | 2e-28 | |
| 2uxy_A | 341 | Aliphatic amidase; nitrilase superfamily, hydrolas | 6e-28 | |
| 2vhh_A | 405 | CG3027-PA; hydrolase; 2.8A {Drosophila melanogaste | 6e-28 | |
| 2dyu_A | 334 | Formamidase; AMIF, CEK, catalytic triad, helicobac | 4e-25 | |
| 3ivz_A | 262 | Nitrilase; alpha-beta sandwich, hydrolase; 1.57A { | 4e-25 | |
| 2e11_A | 266 | Hydrolase; dimethylarsenic inhibi complex, cacodyl | 4e-24 | |
| 4f4h_A | 565 | Glutamine dependent NAD+ synthetase; structural ge | 1e-08 | |
| 3sdb_A | 680 | Glutamine-dependent NAD(+) synthetase; glutamine-a | 9e-07 | |
| 3n05_A | 590 | NH(3)-dependent NAD(+) synthetase; ligase, structu | 2e-06 | |
| 3ilv_A | 634 | Glutamine-dependent NAD(+) synthetase; protein str | 2e-06 |
| >1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Length = 440 | Back alignment and structure |
|---|
Score = 156 bits (397), Expect = 2e-47
Identities = 43/117 (36%), Positives = 63/117 (53%), Gaps = 1/117 (0%)
Query: 6 SVRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKIAEPL 65
+AV QMTS NDL NF +++ A +++ PE F ++G + I +A
Sbjct: 14 RHFIAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFIGLNKNEQIDLAMAT 73
Query: 66 DGPIMQGYCSLARESSMWLSLGGFQEKGSDDA-RLCNTHVLLDDAGNIRSTYRKIHL 121
D M+ Y LAR+ ++WLSLGG K DA NTH+++D G R+ Y K+HL
Sbjct: 74 DCEYMEKYRELARKHNIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYNKLHL 130
|
| >2w1v_A Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A {Mus musculus} Length = 276 | Back alignment and structure |
|---|
| >1f89_A 32.5 kDa protein YLR351C; nitrilase, dimer, structural genomics, four layer sandwich, PSI, protein structure initiative; 2.40A {Saccharomyces cerevisiae} SCOP: d.160.1.1 Length = 291 | Back alignment and structure |
|---|
| >3hkx_A Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alpha dimeric sandwich hydrolase; 1.66A {Nesterenkonia SP} Length = 283 | Back alignment and structure |
|---|
| >3p8k_A Hydrolase, carbon-nitrogen family; HET: PGE; 1.70A {Staphylococcus aureus subsp} Length = 281 | Back alignment and structure |
|---|
| >1uf5_A N-carbamyl-D-amino acid amidohydrolase; HET: CDT; 1.60A {Agrobacterium SP} SCOP: d.160.1.2 PDB: 1uf4_A* 1uf7_A* 1uf8_A* 1erz_A 1fo6_A 2ggl_A 2ggk_A Length = 303 | Back alignment and structure |
|---|
| >2uxy_A Aliphatic amidase; nitrilase superfamily, hydrolase, acyl transfer, thiol enzymes, hydroxamic acid; HET: C3Y; 1.25A {Pseudomonas aeruginosa} PDB: 2plq_A Length = 341 | Back alignment and structure |
|---|
| >2vhh_A CG3027-PA; hydrolase; 2.8A {Drosophila melanogaster} PDB: 2vhi_A Length = 405 | Back alignment and structure |
|---|
| >2dyu_A Formamidase; AMIF, CEK, catalytic triad, helicobacter pylori aliphatic amidase, hydrolase; 1.75A {Helicobacter pylori} PDB: 2dyv_A 2e2l_A 2e2k_A Length = 334 | Back alignment and structure |
|---|
| >3ivz_A Nitrilase; alpha-beta sandwich, hydrolase; 1.57A {Pyrococcus abyssi} PDB: 3iw3_A 3ki8_A 3klc_A 1j31_A Length = 262 | Back alignment and structure |
|---|
| >2e11_A Hydrolase; dimethylarsenic inhibi complex, cacodylate; 1.73A {Xanthomonas campestris PV} Length = 266 | Back alignment and structure |
|---|
| >4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} Length = 565 | Back alignment and structure |
|---|
| >3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* Length = 680 | Back alignment and structure |
|---|
| >3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Length = 590 | Back alignment and structure |
|---|
| >3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Length = 634 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| 2w1v_A | 276 | Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A | 99.96 | |
| 3p8k_A | 281 | Hydrolase, carbon-nitrogen family; HET: PGE; 1.70A | 99.96 | |
| 3hkx_A | 283 | Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alp | 99.96 | |
| 1f89_A | 291 | 32.5 kDa protein YLR351C; nitrilase, dimer, struct | 99.96 | |
| 3ivz_A | 262 | Nitrilase; alpha-beta sandwich, hydrolase; 1.57A { | 99.95 | |
| 2e11_A | 266 | Hydrolase; dimethylarsenic inhibi complex, cacodyl | 99.95 | |
| 1uf5_A | 303 | N-carbamyl-D-amino acid amidohydrolase; HET: CDT; | 99.94 | |
| 1ems_A | 440 | Nitfhit, NIT-fragIle histidine triad fusion protei | 99.94 | |
| 2vhh_A | 405 | CG3027-PA; hydrolase; 2.8A {Drosophila melanogaste | 99.93 | |
| 2dyu_A | 334 | Formamidase; AMIF, CEK, catalytic triad, helicobac | 99.93 | |
| 2uxy_A | 341 | Aliphatic amidase; nitrilase superfamily, hydrolas | 99.93 | |
| 3ilv_A | 634 | Glutamine-dependent NAD(+) synthetase; protein str | 99.92 | |
| 3n05_A | 590 | NH(3)-dependent NAD(+) synthetase; ligase, structu | 99.9 | |
| 3sdb_A | 680 | Glutamine-dependent NAD(+) synthetase; glutamine-a | 99.9 | |
| 4f4h_A | 565 | Glutamine dependent NAD+ synthetase; structural ge | 99.89 | |
| 3p8k_A | 281 | Hydrolase, carbon-nitrogen family; HET: PGE; 1.70A | 94.25 | |
| 1f89_A | 291 | 32.5 kDa protein YLR351C; nitrilase, dimer, struct | 93.34 | |
| 3hkx_A | 283 | Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alp | 93.09 | |
| 2w1v_A | 276 | Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A | 92.62 | |
| 3ivz_A | 262 | Nitrilase; alpha-beta sandwich, hydrolase; 1.57A { | 92.13 | |
| 2uxy_A | 341 | Aliphatic amidase; nitrilase superfamily, hydrolas | 92.11 | |
| 2dyu_A | 334 | Formamidase; AMIF, CEK, catalytic triad, helicobac | 91.82 | |
| 1ems_A | 440 | Nitfhit, NIT-fragIle histidine triad fusion protei | 91.62 | |
| 4f4h_A | 565 | Glutamine dependent NAD+ synthetase; structural ge | 91.35 | |
| 3n05_A | 590 | NH(3)-dependent NAD(+) synthetase; ligase, structu | 90.45 | |
| 1iuq_A | 367 | Glycerol-3-phosphate acyltransferase; open twisted | 89.41 | |
| 2e11_A | 266 | Hydrolase; dimethylarsenic inhibi complex, cacodyl | 89.3 | |
| 3obe_A | 305 | Sugar phosphate isomerase/epimerase; structural ge | 87.84 | |
| 1uf5_A | 303 | N-carbamyl-D-amino acid amidohydrolase; HET: CDT; | 84.09 | |
| 4fva_A | 256 | 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy | 83.7 | |
| 2vhh_A | 405 | CG3027-PA; hydrolase; 2.8A {Drosophila melanogaste | 82.77 | |
| 4f1h_A | 250 | Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA com | 80.24 | |
| 2j6v_A | 301 | UV endonuclease, UVDE; plasmid, TIM barrel, DNA re | 80.02 |
| >2w1v_A Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A {Mus musculus} | Back alignment and structure |
|---|
Probab=99.96 E-value=6.6e-29 Score=169.91 Aligned_cols=114 Identities=31% Similarity=0.422 Sum_probs=102.6
Q ss_pred cccEEEEEEeccccCHHHHHHHHHHHHHHHHHCCCcEEEccCCccCCCCCCchhhhcccCCCChHHHHHHHHHHHcCcEE
Q 033329 5 HSVRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKIAEPLDGPIMQGYCSLARESSMWL 84 (121)
Q Consensus 5 ~~~~ia~vQ~~~~~~~~~n~~~~~~~~~~a~~~~~dlvv~PE~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~~~~i 84 (121)
.++|||++|+++.+|.+.|++++.+++++|++.++|||||||+++ +||...+...+++..+++..+.++++|++++++|
T Consensus 2 ~~~~va~vQ~~~~~d~~~n~~~~~~~i~~a~~~gadlvv~PE~~~-~gy~~~~~~~~~~~~~~~~~~~l~~~a~~~~~~i 80 (276)
T 2w1v_A 2 STFRLALIQLQVSSIKSDNLTRACSLVREAAKQGANIVSLPECFN-SPYGTTYFPDYAEKIPGESTQKLSEVAKESSIYL 80 (276)
T ss_dssp CEEEEEEEECCCCSCHHHHHHHHHHHHHHHHHTTCSEEECCTTTT-SCCSTTTHHHHCBCSSSHHHHHHHHHHHHHTSEE
T ss_pred CccEEEEEeccccCCHHHHHHHHHHHHHHHHHCCCCEEEcCCCcc-cCCCHHHHHHHhccCCCHHHHHHHHHHHHcCeEE
Confidence 469999999998899999999999999999999999999999999 8887766655666667899999999999999999
Q ss_pred EeccceeecCCCCceEEEEEEECCCCCEEeeeecCCC
Q 033329 85 SLGGFQEKGSDDARLCNTHVLLDDAGNIRSTYRKIHL 121 (121)
Q Consensus 85 i~G~~~~~~~~~~~~~Ns~~~i~~~G~i~~~y~K~hL 121 (121)
++|++.++ .++++||++++++|+|++++.|+|+||
T Consensus 81 v~G~~~~~--~~~~~yNs~~~i~~~G~i~~~y~K~hL 115 (276)
T 2w1v_A 81 IGGSIPEE--DAGKLYNTCSVFGPDGSLLVKHRKIHL 115 (276)
T ss_dssp ECCCEEEE--ETTEEEEEEEEECTTSCEEEEEECSSC
T ss_pred Eecceeec--CCCcEEEEEEEECCCCcEEEEEecccc
Confidence 99977664 367899999999999999999999997
|
| >3p8k_A Hydrolase, carbon-nitrogen family; HET: PGE; 1.70A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3hkx_A Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alpha dimeric sandwich hydrolase; 1.66A {Nesterenkonia SP} | Back alignment and structure |
|---|
| >1f89_A 32.5 kDa protein YLR351C; nitrilase, dimer, structural genomics, four layer sandwich, PSI, protein structure initiative; 2.40A {Saccharomyces cerevisiae} SCOP: d.160.1.1 | Back alignment and structure |
|---|
| >3ivz_A Nitrilase; alpha-beta sandwich, hydrolase; 1.57A {Pyrococcus abyssi} SCOP: d.160.1.2 PDB: 3iw3_A 3ki8_A 3klc_A 1j31_A | Back alignment and structure |
|---|
| >2e11_A Hydrolase; dimethylarsenic inhibi complex, cacodylate; 1.73A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1uf5_A N-carbamyl-D-amino acid amidohydrolase; HET: CDT; 1.60A {Agrobacterium SP} SCOP: d.160.1.2 PDB: 1uf4_A* 1uf7_A* 1uf8_A* 1erz_A 1fo6_A 2ggl_A 2ggk_A | Back alignment and structure |
|---|
| >1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 | Back alignment and structure |
|---|
| >2vhh_A CG3027-PA; hydrolase; 2.8A {Drosophila melanogaster} PDB: 2vhi_A | Back alignment and structure |
|---|
| >2dyu_A Formamidase; AMIF, CEK, catalytic triad, helicobacter pylori aliphatic amidase, hydrolase; 1.75A {Helicobacter pylori} PDB: 2dyv_A 2e2l_A 2e2k_A | Back alignment and structure |
|---|
| >2uxy_A Aliphatic amidase; nitrilase superfamily, hydrolase, acyl transfer, thiol enzymes, hydroxamic acid; HET: C3Y; 1.25A {Pseudomonas aeruginosa} PDB: 2plq_A | Back alignment and structure |
|---|
| >3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* | Back alignment and structure |
|---|
| >4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3p8k_A Hydrolase, carbon-nitrogen family; HET: PGE; 1.70A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1f89_A 32.5 kDa protein YLR351C; nitrilase, dimer, structural genomics, four layer sandwich, PSI, protein structure initiative; 2.40A {Saccharomyces cerevisiae} SCOP: d.160.1.1 | Back alignment and structure |
|---|
| >3hkx_A Amidase; alpha-beta-BETA-alpha:alpha-beta-BETA-alpha dimeric sandwich hydrolase; 1.66A {Nesterenkonia SP} | Back alignment and structure |
|---|
| >2w1v_A Nitrilase-2, nitrilase homolog 2; hydrolase; 1.49A {Mus musculus} | Back alignment and structure |
|---|
| >3ivz_A Nitrilase; alpha-beta sandwich, hydrolase; 1.57A {Pyrococcus abyssi} SCOP: d.160.1.2 PDB: 3iw3_A 3ki8_A 3klc_A 1j31_A | Back alignment and structure |
|---|
| >2uxy_A Aliphatic amidase; nitrilase superfamily, hydrolase, acyl transfer, thiol enzymes, hydroxamic acid; HET: C3Y; 1.25A {Pseudomonas aeruginosa} PDB: 2plq_A | Back alignment and structure |
|---|
| >2dyu_A Formamidase; AMIF, CEK, catalytic triad, helicobacter pylori aliphatic amidase, hydrolase; 1.75A {Helicobacter pylori} PDB: 2dyv_A 2e2l_A 2e2k_A | Back alignment and structure |
|---|
| >1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 | Back alignment and structure |
|---|
| >4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1iuq_A Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} SCOP: c.112.1.1 PDB: 1k30_A | Back alignment and structure |
|---|
| >2e11_A Hydrolase; dimethylarsenic inhibi complex, cacodylate; 1.73A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1uf5_A N-carbamyl-D-amino acid amidohydrolase; HET: CDT; 1.60A {Agrobacterium SP} SCOP: d.160.1.2 PDB: 1uf4_A* 1uf7_A* 1uf8_A* 1erz_A 1fo6_A 2ggl_A 2ggk_A | Back alignment and structure |
|---|
| >4fva_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; HET: EDO; 2.07A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vhh_A CG3027-PA; hydrolase; 2.8A {Drosophila melanogaster} PDB: 2vhi_A | Back alignment and structure |
|---|
| >4f1h_A Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA complex; HET: DNA; 1.66A {Danio rerio} PDB: 4fpv_A* 4f1h_B* | Back alignment and structure |
|---|
| >2j6v_A UV endonuclease, UVDE; plasmid, TIM barrel, DNA repair, DNA binding protein, lyase; HET: KCX ALY; 1.55A {Thermus thermophilus} PDB: 3bzg_A 3c0s_A* 3c0l_A 3c0q_A* 3bzj_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 121 | ||||
| d1emsa2 | 271 | d.160.1.1 (A:10-280) NIT-FHIT fusion protein, N-te | 5e-22 | |
| d1uf5a_ | 303 | d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrol | 3e-16 | |
| d1j31a_ | 262 | d.160.1.2 (A:) Hypothetical protein PH0642 {Archae | 1e-13 | |
| d1f89a_ | 281 | d.160.1.1 (A:) hypothetical protein yl85 {Baker's | 4e-12 |
| >d1emsa2 d.160.1.1 (A:10-280) NIT-FHIT fusion protein, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 271 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Carbon-nitrogen hydrolase superfamily: Carbon-nitrogen hydrolase family: Nitrilase domain: NIT-FHIT fusion protein, N-terminal domain species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Score = 85.6 bits (210), Expect = 5e-22
Identities = 41/115 (35%), Positives = 61/115 (53%), Gaps = 1/115 (0%)
Query: 7 VRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKIAEPLD 66
+AV QMTS NDL NF +++ A +++ PE F ++G + I +A D
Sbjct: 6 HFIAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFIGLNKNEQIDLAMATD 65
Query: 67 GPIMQGYCSLARESSMWLSLGGFQEKGSD-DARLCNTHVLLDDAGNIRSTYRKIH 120
M+ Y LAR+ ++WLSLGG K A NTH+++D G R+ Y K+H
Sbjct: 66 CEYMEKYRELARKHNIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYNKLH 120
|
| >d1uf5a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp. [TaxId: 361]} Length = 303 | Back information, alignment and structure |
|---|
| >d1j31a_ d.160.1.2 (A:) Hypothetical protein PH0642 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 262 | Back information, alignment and structure |
|---|
| >d1f89a_ d.160.1.1 (A:) hypothetical protein yl85 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 281 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| d1emsa2 | 271 | NIT-FHIT fusion protein, N-terminal domain {Nemato | 99.96 | |
| d1f89a_ | 281 | hypothetical protein yl85 {Baker's yeast (Saccharo | 99.95 | |
| d1j31a_ | 262 | Hypothetical protein PH0642 {Archaeon Pyrococcus h | 99.94 | |
| d1uf5a_ | 303 | N-carbamoyl-D-aminoacid amidohydrolase {Agrobacter | 99.93 | |
| d1j31a_ | 262 | Hypothetical protein PH0642 {Archaeon Pyrococcus h | 93.96 | |
| d1uf5a_ | 303 | N-carbamoyl-D-aminoacid amidohydrolase {Agrobacter | 93.25 | |
| d1emsa2 | 271 | NIT-FHIT fusion protein, N-terminal domain {Nemato | 93.21 | |
| d1f89a_ | 281 | hypothetical protein yl85 {Baker's yeast (Saccharo | 90.7 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 84.57 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 82.0 | |
| d1wdua_ | 228 | Endonuclease domain of TRAS1 retrotransposon (ORF2 | 80.89 |
| >d1emsa2 d.160.1.1 (A:10-280) NIT-FHIT fusion protein, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Carbon-nitrogen hydrolase superfamily: Carbon-nitrogen hydrolase family: Nitrilase domain: NIT-FHIT fusion protein, N-terminal domain species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=99.96 E-value=8.8e-29 Score=167.02 Aligned_cols=120 Identities=38% Similarity=0.641 Sum_probs=103.1
Q ss_pred CCCCcccEEEEEEeccccCHHHHHHHHHHHHHHHHHCCCcEEEccCCccCCCCCCchhhhcccCCCChHHHHHHHHHHHc
Q 033329 1 MAGAHSVRVAVAQMTSINDLAANFATCSRLVKEAASAGAKLLCFPENFSYVGDKDADNIKIAEPLDGPIMQGYCSLARES 80 (121)
Q Consensus 1 ~~~~~~~~ia~vQ~~~~~~~~~n~~~~~~~~~~a~~~~~dlvv~PE~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~a~~~ 80 (121)
|.. .++|||++|+++.+|++.|++++.+++++|++.|+|||||||+++++++...+..+.+...+++.++.++++|+++
T Consensus 1 m~~-~~~rVA~~Q~~~~~d~~~N~~~i~~~i~~A~~~gadlvvfPE~~~~~~~~~~~~~~~a~~~~~~~~~~l~~~a~~~ 79 (271)
T d1emsa2 1 MAT-GRHFIAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFIGLNKNEQIDLAMATDCEYMEKYRELARKH 79 (271)
T ss_dssp CCC-SEEEEEEECBCCCSCHHHHHHHHHHHHHHHHHTTCSEEEECTTCSCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred CCC-CCeEEEEEeCCCCCCHHHHHHHHHHHHHHHHHCcCeEEECCccccccCCCHHHHHHHHHhhcchHHHhhhhhhhcc
Confidence 443 4699999999988999999999999999999999999999999875676666555566666778899999999999
Q ss_pred CcEEEeccceeecC-CCCceEEEEEEECCCCCEEeeeecCCC
Q 033329 81 SMWLSLGGFQEKGS-DDARLCNTHVLLDDAGNIRSTYRKIHL 121 (121)
Q Consensus 81 ~~~ii~G~~~~~~~-~~~~~~Ns~~~i~~~G~i~~~y~K~hL 121 (121)
++++++|+++.... +++++||++++++++|++++.|+|+||
T Consensus 80 ~i~v~~G~~~~~~~~~~~~~yNsa~vi~~~g~i~~~~~K~~l 121 (271)
T d1emsa2 80 NIWLSLGGLHHKDPSDAAHPWNTHLIIDSDGVTRAEYNKLHL 121 (271)
T ss_dssp TCEEEEEEEEEEETTEEEEEEEEEEEECTTSCEEEEEECCCC
T ss_pred cccccccceeeeeecCCCceeEEEEEEeCCceEEEeeeeecc
Confidence 99999997765432 346899999999999999999999997
|
| >d1f89a_ d.160.1.1 (A:) hypothetical protein yl85 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j31a_ d.160.1.2 (A:) Hypothetical protein PH0642 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uf5a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp. [TaxId: 361]} | Back information, alignment and structure |
|---|
| >d1j31a_ d.160.1.2 (A:) Hypothetical protein PH0642 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uf5a_ d.160.1.2 (A:) N-carbamoyl-D-aminoacid amidohydrolase {Agrobacterium sp. [TaxId: 361]} | Back information, alignment and structure |
|---|
| >d1emsa2 d.160.1.1 (A:10-280) NIT-FHIT fusion protein, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1f89a_ d.160.1.1 (A:) hypothetical protein yl85 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} | Back information, alignment and structure |
|---|