Citrus Sinensis ID: 033343


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MLAVRSAFTDRSSALLTMRAEKLEAASSKIFGGDKSRIRKIEELKETIRVTEDAKSVAINEYERIKENNRTELERLDKERRADFLNMLKGFVVNQVGYAEKIANVWAKVAEETSGYANENS
ccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
*********DRSSALLTMRAE***********************************VAINEYERIKENNRTELERLDKERRADFLNMLKGFVVNQVGYAEKIANVWAKVA***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAVRSAFTDRSSALLTMRAEKLEAASSKIFGGDKSRIRKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDFLNMLKGFVVNQVGYAEKIANVWAKVAEETSGYANENS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sorting nexin 2A Plays a role in vesicular protein sorting (By similarity). Acts at the crossroads between the secretory and endocytic pathways. Is involved in the endosome to vacuole protein transport and, as component of the membrane-associated retromer complex, is also involved in endosome-to-Golgi retrograde transport (By similarity). Also involved in the efficient sorting of seed storage protein globulin 12S.probableQ8L5Z7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DYT, chain A
Confidence level:confident
Coverage over the Query: 2-40,53-114
View the alignment between query and template
View the model in PyMOL