Citrus Sinensis ID: 033353


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MGVFTYVCRKNGGEWSGKQIEGGDLEASAASTYELQRKLVQTSLSADSSGGVQSSFSLVTPTSAVFQVIIGGAVGSGFIGGGAAASAPSGGGGAAAEAPAAEEKKEEKEESDEDMGFSLFD
ccEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHcccccCEEEEEECcccccEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccc
MGVFTYVCRKNGGEW************SAASTYELQRKLV***************FSLVTPTSAVFQVIIGGAVGSGFIGG*************************************L**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVFTYVCRKNGGEWSGKQIEGGDLEASAASTYELQRKLVQTSLSADSSGGVQSSFSLVTPTSAVFQVIIGGAVGSGFIGGGAAASAPSGGGGAAAEAPAAEEKKEEKEESDEDMGFSLFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S acidic ribosomal protein P3 Plays an important role in the elongation step of protein synthesis.probableP56724
60S acidic ribosomal protein P3 Plays an important role in the elongation step of protein synthesis.probableO24413
60S acidic ribosomal protein P3-2 Plays an important role in the elongation step of protein synthesis.probableQ9LVC9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain g
Confidence level:probable
Coverage over the Query: 61-69
View the alignment between query and template
View the model in PyMOL
Template: 2LBF, chain A
Confidence level:probable
Coverage over the Query: 32-76
View the alignment between query and template
View the model in PyMOL