Citrus Sinensis ID: 033359


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI
cEEEEEccccccccccccEEEEEEEccccccccccccccccccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHccccc
MIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIWECIIPGKTGTDWEGGYFPLTLYFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLSILNEDNGWRPAITVKQILVGIQDLLDQPNPADPAQTDGYQLFIQDPAEYKRRVRQQAKQYPPVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SUMO-conjugating enzyme SCE1 SUMO-conjugating enzyme that accepts the SUMO proteins from the E1 SUMO-activating heterodimer SAE1/SAE2 and catalyzes its covalent attachment to other proteins with the E3 SUMO ligases SIZ1 and MMS21. Associates with SIZ1 for sumoylation of the transcription factor GTE3.probableQ42551
SUMO-conjugating enzyme UBC9 Accepts the ubiquitin-like proteins sumo1, sumo2 and sumo3 from the uble1a-uble1b E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as ranbp2 or cbx4. Essential for nuclear architecture and chromosome segregation.probableQ28CQ4
SUMO-conjugating enzyme UBC9-B Accepts the ubiquitin-like proteins sumo1, sumo2 and sumo3 from the uble1a-uble1b E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as ranbp2 or cbx4. Essential for nuclear architecture and chromosome segregation (By similarity). Mediates nuclear localization of vsx1. Required for progression through mitosis during organogenesis.probableQ9DDJ0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RCZ, chain B
Confidence level:very confident
Coverage over the Query: 1-119
View the alignment between query and template
View the model in PyMOL