BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033371
(120 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3G8R|A Chain A, Crystal Structure Of Putative Spore Coat Polysaccharide
Biosynthesis Protein E From Chromobacterium Violaceum
Atcc 12472
pdb|3G8R|B Chain B, Crystal Structure Of Putative Spore Coat Polysaccharide
Biosynthesis Protein E From Chromobacterium Violaceum
Atcc 12472
Length = 350
Score = 26.2 bits (56), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%)
Query: 59 FDFGYGVPFGHFLNKFLDAIFKGRDNKSVAKK 90
FDFG+ + + + L+ F+ + FKGRD+ K+
Sbjct: 39 FDFGFKLQYRN-LDTFIHSSFKGRDDVKYVKR 69
>pdb|1CG5|B Chain B, Deoxy Form Hemoglobin From Dasyatis Akajei
pdb|1CG8|B Chain B, Co Form Hemoglobin From Dasyatis Akajei
Length = 141
Score = 25.4 bits (54), Expect = 8.5, Method: Compositional matrix adjust.
Identities = 11/39 (28%), Positives = 18/39 (46%)
Query: 74 FLDAIFKGRDNKSVAKKVLLEQLIFSPWINFLFMTYFGL 112
++ ++K D+K + K L + PW LF GL
Sbjct: 10 YIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGL 48
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.142 0.437
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,082,273
Number of Sequences: 62578
Number of extensions: 92987
Number of successful extensions: 183
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 182
Number of HSP's gapped (non-prelim): 3
length of query: 120
length of database: 14,973,337
effective HSP length: 82
effective length of query: 38
effective length of database: 9,841,941
effective search space: 373993758
effective search space used: 373993758
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)