BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033371
         (120 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3G8R|A Chain A, Crystal Structure Of Putative Spore Coat Polysaccharide
          Biosynthesis Protein E From Chromobacterium Violaceum
          Atcc 12472
 pdb|3G8R|B Chain B, Crystal Structure Of Putative Spore Coat Polysaccharide
          Biosynthesis Protein E From Chromobacterium Violaceum
          Atcc 12472
          Length = 350

 Score = 26.2 bits (56), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 59 FDFGYGVPFGHFLNKFLDAIFKGRDNKSVAKK 90
          FDFG+ + + + L+ F+ + FKGRD+    K+
Sbjct: 39 FDFGFKLQYRN-LDTFIHSSFKGRDDVKYVKR 69


>pdb|1CG5|B Chain B, Deoxy Form Hemoglobin From Dasyatis Akajei
 pdb|1CG8|B Chain B, Co Form Hemoglobin From Dasyatis Akajei
          Length = 141

 Score = 25.4 bits (54), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 18/39 (46%)

Query: 74  FLDAIFKGRDNKSVAKKVLLEQLIFSPWINFLFMTYFGL 112
           ++  ++K  D+K +  K L    +  PW   LF    GL
Sbjct: 10  YIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGL 48


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.142    0.437 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,082,273
Number of Sequences: 62578
Number of extensions: 92987
Number of successful extensions: 183
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 182
Number of HSP's gapped (non-prelim): 3
length of query: 120
length of database: 14,973,337
effective HSP length: 82
effective length of query: 38
effective length of database: 9,841,941
effective search space: 373993758
effective search space used: 373993758
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)