Citrus Sinensis ID: 033386

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120

MAKSSFKLEHPLERRLAESARIREKYPDRIPVIVEKAEKTDVPDIDKKKYLVPADLSVGQFVYVVRKRIKLSAEKAIFVFVKNTLPPTGALMSAIYEENKDEDGFLYMTYSGENTFGWSF

cccccccccccHHHHHHHHHHHHHHccccEEEEEEEccccccccccccEEEEcccccHHEEEEEEHHccccccccEEEEEEcccccccccHHHHHHHHccccccCEEEEEcccccccccc

***SSFK*EHPLERRLAESARIREKYPDRIPVIVEKAEKTDVPDIDKKKYLVPADLSVGQFVYVVRKRIKLSAEKAIFVFVKNTLPPTGALMSAIYEENKDEDGFLYMTYSGENTFGWSF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAKSSFKLEHPLERRLAESARIREKYPDRIPVIVEKAEKTDVPDIDKKKYLVPADLSVGQFVYVVRKRIKLSAEKAIFVFVKNTLPPTGALMSAIYEENKDEDGFLYMTYSGENTFGWSF

Annotation	Function Description	Confidence Level	Reference Protein
Autophagy-related protein 8C	Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton.	confident	Q6Z1D5
Autophagy-related protein 8	Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton.	confident	P0CO54
Autophagy-related protein 8A	Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton.	confident	Q2XPP5

No EC number assigned to the protein, probably not an enzyme!

Template: 3RUI, chain B
Confidence level:very confident
Coverage over the Query: 5-117
View the alignment between query and template
View the model in PyMOL