Query         033409
Match_columns 120
No_of_seqs    100 out of 179
Neff          6.3 
Searched_HMMs 46136
Date          Fri Mar 29 13:33:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033409.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033409hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0721 Molecular chaperone (D 100.0 6.4E-31 1.4E-35  200.8   5.5  108    1-110     4-111 (230)
  2 COG5407 SEC63 Preprotein trans  99.8 1.5E-21 3.2E-26  162.5   4.5  103    3-110     6-110 (610)
  3 COG2991 Uncharacterized protei  71.3     7.2 0.00016   25.5   3.4   16   41-56     42-58  (77)
  4 PF03579 SHP:  Small hydrophobi  70.2     4.6  0.0001   25.3   2.3   21    6-26     10-30  (64)
  5 PF08592 DUF1772:  Domain of un  63.9      21 0.00045   24.3   4.9   75    8-83     63-137 (139)
  6 PF03622 IBV_3B:  IBV 3B protei  59.3     4.4 9.5E-05   25.5   0.7   17   86-103    23-39  (64)
  7 PF06210 DUF1003:  Protein of u  46.2      33 0.00072   23.7   3.5    7   96-102    28-34  (108)
  8 PF00226 DnaJ:  DnaJ domain;  I  45.3     5.6 0.00012   23.8  -0.5   12   99-110     1-12  (64)
  9 PF06298 PsbY:  Photosystem II   44.1      19 0.00042   20.3   1.7   16   70-85     10-25  (36)
 10 COG4420 Predicted membrane pro  41.6      28  0.0006   26.7   2.7   26   77-102    62-88  (191)
 11 cd06257 DnaJ DnaJ domain or J-  40.5       9 0.00019   21.9  -0.1    9   99-107     1-9   (55)
 12 PF12955 DUF3844:  Domain of un  36.5      41 0.00088   23.2   2.7   30    5-34     63-92  (103)
 13 CHL00196 psbY photosystem II p  35.9      31 0.00068   19.5   1.7   15   71-85     11-25  (36)
 14 PF03311 Cornichon:  Cornichon   35.9 1.5E+02  0.0033   20.7   6.5   44   70-113    62-110 (128)
 15 COG1288 Predicted membrane pro  35.4 1.2E+02  0.0027   26.3   5.9   20   70-89    275-294 (481)
 16 KOG3672 Histidine acid phospha  34.8      31 0.00067   29.6   2.2   54   45-106   249-303 (487)
 17 PRK13240 pbsY photosystem II p  33.3      36 0.00077   19.7   1.7   17   71-87     11-27  (40)
 18 KOG0510 Ankyrin repeat protein  33.1      81  0.0018   29.4   4.7   26    8-33    505-530 (929)
 19 PF05478 Prominin:  Prominin;    32.5      68  0.0015   29.2   4.2   19   13-31     96-114 (806)
 20 PF04583 Baculo_p74:  Baculovir  31.6      37 0.00081   27.0   2.1   24   74-102   105-128 (249)
 21 smart00271 DnaJ DnaJ molecular  31.0      16 0.00034   21.3  -0.0   10   99-108     2-11  (60)
 22 PF15176 LRR19-TM:  Leucine-ric  30.9      59  0.0013   22.5   2.7   27    4-30     10-36  (102)
 23 PF06459 RR_TM4-6:  Ryanodine R  30.5      56  0.0012   26.2   3.0   31   64-95    168-200 (274)
 24 PF06422 PDR_CDR:  CDR ABC tran  30.2      64  0.0014   21.7   2.9   22   67-89     48-69  (103)
 25 PF11027 DUF2615:  Protein of u  29.4      65  0.0014   22.2   2.8   19   70-88     54-72  (103)
 26 PF03967 PRCH:  Photosynthetic   29.0      78  0.0017   23.0   3.2   22   70-91     13-34  (136)
 27 PF04911 ATP-synt_J:  ATP synth  28.7      45 0.00097   20.5   1.7   15   10-24     10-24  (54)
 28 COG3924 Predicted membrane pro  28.7      42 0.00091   22.0   1.6   15   70-84     18-32  (80)
 29 PRK13183 psbN photosystem II r  27.8      78  0.0017   18.8   2.5   32   71-102     9-42  (46)
 30 PF07172 GRP:  Glycine rich pro  27.2      84  0.0018   21.1   3.0   20   70-89      5-24  (95)
 31 PF12273 RCR:  Chitin synthesis  25.8      47   0.001   23.1   1.6   24   11-34      2-25  (130)
 32 PF14004 DUF4227:  Protein of u  25.7      84  0.0018   20.2   2.6   31   70-102     8-38  (71)
 33 PF09878 DUF2105:  Predicted me  25.1      37 0.00081   26.3   1.0   24    7-30    164-187 (212)
 34 CHL00020 psbN photosystem II p  24.8      72  0.0016   18.7   2.0   31   72-102     7-39  (43)
 35 PF07672 MFS_Mycoplasma:  Mycop  24.5 1.2E+02  0.0027   24.3   3.9   24   11-34     40-63  (267)
 36 PF04341 DUF485:  Protein of un  24.1 1.1E+02  0.0024   20.0   3.1   25   70-100    59-83  (91)
 37 PF02560 Cyanate_lyase:  Cyanat  24.0      46 0.00099   21.7   1.1   21   97-117    12-32  (73)
 38 PF12686 DUF3800:  Protein of u  23.7     5.8 0.00013   28.7  -3.5   16    4-19      4-27  (235)
 39 PF02468 PsbN:  Photosystem II   23.4 1.4E+02  0.0031   17.4   3.1   27   76-102    11-39  (43)
 40 cd00559 Cyanase_C Cyanase C-te  23.1      47   0.001   21.4   1.1   22   96-117     7-28  (69)
 41 TIGR02736 cbb3_Q_epsi cytochro  21.0   1E+02  0.0022   19.0   2.2   24   11-34      2-25  (56)
 42 PF01542 HCV_core:  Hepatitis C  20.8      63  0.0014   20.9   1.3   19    8-26     56-74  (75)
 43 COG3083 Predicted hydrolase of  20.1      69  0.0015   28.4   1.8   24   11-34     61-84  (600)

No 1  
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=99.96  E-value=6.4e-31  Score=200.78  Aligned_cols=108  Identities=24%  Similarity=0.446  Sum_probs=87.1

Q ss_pred             CCccccCCCchhHHHHHHHhhhhhhhhHHhhhcccccccccccccCccchhhHHHHHHHhhhhcCcchhHHHHHHHHHHH
Q 033409            1 MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVI   80 (120)
Q Consensus         1 ~~~YDE~g~tfpyFvLt~l~lvLIP~T~~~l~~~~~~~~~~~~c~c~~c~~~~~~i~~~~kr~~~~~~~~~l~lv~GW~l   80 (120)
                      |.||||+|+|||||+||+++++|+|+||.+|++...+.....+|||.+|+..+...++..+ + .++..+++++++||++
T Consensus         4 ~~eYDE~g~tf~yflls~~~~i~~P~Ty~~i~~~~~~~~~~~~c~c~~c~~~r~~~~~~~~-k-~~~~~~~i~lv~~W~v   81 (230)
T KOG0721|consen    4 DYEYDESGNTFPYFLLSFLAIILLPMTYLLIPRNPEPPKRKEECQCHGCDKKRRKKAKVSP-K-SISTKRKVFLVVGWAV   81 (230)
T ss_pred             ccccccccCccHHHHHHHHHHHHHHHHHHHhccccchhhhhhHHhhhhhhhhhhhhcccCc-c-cchhHHHHHHHHHHHH
Confidence            5799999999999999999999999999999853222222458999999987754333322 2 3333399999999999


Q ss_pred             HHHHHHHHHhcccccCccchhhHhHhhhhh
Q 033409           81 MIILIYYIKSTSREHTRFGTWGLRFRYKES  110 (120)
Q Consensus        81 ~~~L~y~i~~~~~~~~~fDPYeIL~~~~~~  110 (120)
                      +++|+|+|++.+++.+.|||||||++...+
T Consensus        82 ~~fL~y~i~~~~~~~~~fDPyEILGl~pga  111 (230)
T KOG0721|consen   82 IAFLIYKIMNSRRERQKFDPYEILGLDPGA  111 (230)
T ss_pred             HHHHHHHHhhhhHHhhcCCcHHhhCCCCCC
Confidence            999999999999888999999999997643


No 2  
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion]
Probab=99.84  E-value=1.5e-21  Score=162.46  Aligned_cols=103  Identities=18%  Similarity=0.322  Sum_probs=81.1

Q ss_pred             ccccCCCchhHHHHHHHhhhhhhhhHHhhhcccccc-cccccccCccchhhHHHHHHHhhhhcCcchhHHHHHHHHHHHH
Q 033409            3 ATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKK-IKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIM   81 (120)
Q Consensus         3 ~YDE~g~tfpyFvLt~l~lvLIP~T~~~l~~~~~~~-~~~~~c~c~~c~~~~~~i~~~~kr~~~~~~~~~l~lv~GW~l~   81 (120)
                      ||||+|.+||||+|+.+.++..|+||..+-+....+ ....+|.|+.|..+.++  .+||  + +.++|++++++||+++
T Consensus         6 eYDE~g~~~p~fvL~gl~~vvlpmTY~~i~gpsaSKe~~~vr~~~q~~Rpkdkn--v~rK--S-If~lR~If~ivgWl~i   80 (610)
T COG5407           6 EYDESGLASPYFVLSGLVPVVLPMTYDLIEGPSASKELRRVRCACQGCRPKDKN--VSRK--S-IFKLRKIFTIVGWLVI   80 (610)
T ss_pred             ccccccccchHHHHhhhhheeeeeehhheeCCcccchhhcchhhhhhcCccccc--hhhh--H-HHhhhHHHHHHHHHHH
Confidence            899999999999999999999999998875553222 22557888888754432  2222  3 2224999999999999


Q ss_pred             HHHHHHHHhccccc-CccchhhHhHhhhhh
Q 033409           82 IILIYYIKSTSREH-TRFGTWGLRFRYKES  110 (120)
Q Consensus        82 ~~L~y~i~~~~~~~-~~fDPYeIL~~~~~~  110 (120)
                      ++|.|+|.+.+.+. +.|||||||+|.+..
T Consensus        81 ~~L~~~I~~~k~~~~~~fDPyEILGI~~~t  110 (610)
T COG5407          81 SYLISNIRTLKIEYRRGFDPYEILGIDQDT  110 (610)
T ss_pred             HHHHHHHHHHHHHHHcCCChHHhhcccCCC
Confidence            99999999877776 899999999998753


No 3  
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.32  E-value=7.2  Score=25.50  Aligned_cols=16  Identities=25%  Similarity=0.657  Sum_probs=8.9

Q ss_pred             cccccCcc-chhhHHHH
Q 033409           41 TIHCQCSD-CARSGKYR   56 (120)
Q Consensus        41 ~~~c~c~~-c~~~~~~i   56 (120)
                      ++.|.|+. |..+.++.
T Consensus        42 ~K~CdC~~pCDt~~~kl   58 (77)
T COG2991          42 EKVCDCDEPCDTHKKKL   58 (77)
T ss_pred             chhcCCCCchHHHHHhH
Confidence            44587765 55544443


No 4  
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=70.17  E-value=4.6  Score=25.33  Aligned_cols=21  Identities=24%  Similarity=0.391  Sum_probs=15.1

Q ss_pred             cCCCchhHHHHHHHhhhhhhh
Q 033409            6 ENSQLFPIFILTIMALPLVPY   26 (120)
Q Consensus         6 E~g~tfpyFvLt~l~lvLIP~   26 (120)
                      -.|.+||||-|.+..+.++-+
T Consensus        10 FtskFW~YFtLi~M~lti~~~   30 (64)
T PF03579_consen   10 FTSKFWTYFTLIFMMLTIGFF   30 (64)
T ss_pred             eccccchHHHHHHHHHHHHHH
Confidence            368999999887766555443


No 5  
>PF08592 DUF1772:  Domain of unknown function (DUF1772);  InterPro: IPR013901  This entry represents proteins of unknown function. 
Probab=63.86  E-value=21  Score=24.34  Aligned_cols=75  Identities=9%  Similarity=0.279  Sum_probs=38.1

Q ss_pred             CCchhHHHHHHHhhhhhhhhHHhhhcccccccccccccCccchhhHHHHHHHhhhhcCcchhHHHHHHHHHHHHHH
Q 033409            8 SQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMII   83 (120)
Q Consensus         8 g~tfpyFvLt~l~lvLIP~T~~~l~~~~~~~~~~~~c~c~~c~~~~~~i~~~~kr~~~~~~~~~l~lv~GW~l~~~   83 (120)
                      +..+.+.+.+.+.+-.+|.|....... .+.-..-+-+-.+.....+..++.++|..+.+..|.++-++||++..+
T Consensus        63 ~~~~~~~~a~~~~~~~~~~T~~~~~P~-N~~l~~~~~~~~~~~~~~~~~~~l~~~W~~~n~vR~~~~~~a~~~~~~  137 (139)
T PF08592_consen   63 AARLLWLAAAALLLSIIPFTFLVNVPI-NNRLAAWDIESSPEEAPADWVRALLDRWGRLNLVRTVLSLVAFLLLLI  137 (139)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHhhHH-HHHHHHccccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344445555666677899998775222 111000000000111122233555555666644488888888887753


No 6  
>PF03622 IBV_3B:  IBV 3B protein ;  InterPro: IPR005295 These proteins are the product of ORF 3B from Infectious bronchitis virus). Currently, the function of this protein remains unknown [].
Probab=59.34  E-value=4.4  Score=25.52  Aligned_cols=17  Identities=12%  Similarity=0.167  Sum_probs=11.4

Q ss_pred             HHHHhcccccCccchhhH
Q 033409           86 YYIKSTSREHTRFGTWGL  103 (120)
Q Consensus        86 y~i~~~~~~~~~fDPYeI  103 (120)
                      +.|+ ..-+..+|||||.
T Consensus        23 q~IS-svl~t~iFDPFE~   39 (64)
T PF03622_consen   23 QHIS-SVLNTEIFDPFEV   39 (64)
T ss_pred             HHHH-HHHhhhhcCCeeE
Confidence            5554 3345578999985


No 7  
>PF06210 DUF1003:  Protein of unknown function (DUF1003);  InterPro: IPR010406 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=46.21  E-value=33  Score=23.67  Aligned_cols=7  Identities=14%  Similarity=0.439  Sum_probs=5.3

Q ss_pred             Cccchhh
Q 033409           96 TRFGTWG  102 (120)
Q Consensus        96 ~~fDPYe  102 (120)
                      ..||||-
T Consensus        28 ~~fDpyP   34 (108)
T PF06210_consen   28 PAFDPYP   34 (108)
T ss_pred             CCCCCcc
Confidence            4699965


No 8  
>PF00226 DnaJ:  DnaJ domain;  InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein []. Structurally, the DnaJ protein consists of an N-terminal conserved domain (called 'J' domain) of about 70 amino acids, a glycine-rich region ('G' domain') of about 30 residues, a central domain containing four repeats of a CXXCXGXG motif ('CRR' domain) and a C-terminal region of 120 to 170 residues. Such a structure is shown in the following schematic representation:  +------------+-+-------+-----+-----------+--------------------------------+ | N-terminal | | Gly-R | | CXXCXGXG | C-terminal | +------------+-+-------+-----+-----------+--------------------------------+   It is thought that the 'J' domain of DnaJ mediates the interaction with the dnaK protein and consists of four helices, the second of which has a charged surface that includes at least one pair of basic residues that are essential for interaction with the ATPase domain of Hsp70. The J- and CRR-domains are found in many prokaryotic and eukaryotic proteins [], either together or separately. In yeast, J-domains have been classified into 3 groups; the class III proteins are functionally distinct and do not appear to act as molecular chaperones []. ; GO: 0031072 heat shock protein binding; PDB: 2GUZ_C 2L6L_A 1HDJ_A 2EJ7_A 1FPO_C 2CUG_A 2QSA_A 2OCH_A 3BVO_B 3APQ_A ....
Probab=45.28  E-value=5.6  Score=23.83  Aligned_cols=12  Identities=0%  Similarity=-0.078  Sum_probs=9.4

Q ss_pred             chhhHhHhhhhh
Q 033409           99 GTWGLRFRYKES  110 (120)
Q Consensus        99 DPYeIL~~~~~~  110 (120)
                      |||+||++-..+
T Consensus         1 ~~y~iLgl~~~~   12 (64)
T PF00226_consen    1 NPYEILGLPPDA   12 (64)
T ss_dssp             HHHHHCTSTTTS
T ss_pred             ChHHHCCCCCCC
Confidence            799999987544


No 9  
>PF06298 PsbY:  Photosystem II protein Y (PsbY);  InterPro: IPR009388 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbY found in PSII. In higher plants, two related PsbY proteins exist, PsbY-1 and PsbY-2, which appear to function as a heterodimer. In spinach and Arabidopsis, these two proteins arise from a single-copy nuclear gene that is processed in the chloroplast. By contrast, prokaryotic and organellar chromosomes encode a single PsbY protein, as found in cyanobacteria and red algae, indicating a duplication event in the evolution of higher plants []. PsbY has two low manganese-dependent activities: a catalase-like activity and an L-arginine metabolising activity that converts L-arginine into ornithine and urea []. In addition, a redox-active group is thought to be present in the protein. In cyanobacteria, PsbY deletion mutants have a slightly impaired PSII that is less capable of coping with low levels of calcium ions than the wild-type.; GO: 0030145 manganese ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0016021 integral to membrane
Probab=44.08  E-value=19  Score=20.30  Aligned_cols=16  Identities=13%  Similarity=0.065  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHHHH
Q 033409           70 SNLSLVLLWVIMIILI   85 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L~   85 (120)
                      --+++.+||+++-..-
T Consensus        10 ~Pil~A~gWa~fNIg~   25 (36)
T PF06298_consen   10 LPILPAAGWALFNIGR   25 (36)
T ss_pred             HHHHHHHHHHHHHhHH
Confidence            3455677999986653


No 10 
>COG4420 Predicted membrane protein [Function unknown]
Probab=41.58  E-value=28  Score=26.67  Aligned_cols=26  Identities=8%  Similarity=0.202  Sum_probs=12.7

Q ss_pred             HHHHHHHHHHHHHhccccc-Cccchhh
Q 033409           77 LWVIMIILIYYIKSTSREH-TRFGTWG  102 (120)
Q Consensus        77 GW~l~~~L~y~i~~~~~~~-~~fDPYe  102 (120)
                      +|..+++++|-+-+...-. ..||||-
T Consensus        62 l~~~~~ll~Wi~lNl~~~~~~~wDpyP   88 (191)
T COG4420          62 LTFTLLLLLWIVLNLFLVPGLAWDPYP   88 (191)
T ss_pred             HHHHHHHHHHHHHHHhhhcCCcCCCcc
Confidence            3333444444433333322 6799985


No 11 
>cd06257 DnaJ DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonine family. Hsp40 proteins are characterized by the presence of a J domain, which mediates the interaction with Hsp70. They may contain other domains as well, and the architectures provide a means of classification.
Probab=40.52  E-value=9  Score=21.93  Aligned_cols=9  Identities=0%  Similarity=-0.267  Sum_probs=7.7

Q ss_pred             chhhHhHhh
Q 033409           99 GTWGLRFRY  107 (120)
Q Consensus        99 DPYeIL~~~  107 (120)
                      |||++|++-
T Consensus         1 ~~y~vLgl~    9 (55)
T cd06257           1 DYYDILGVP    9 (55)
T ss_pred             ChHHHcCCC
Confidence            799999875


No 12 
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=36.53  E-value=41  Score=23.24  Aligned_cols=30  Identities=20%  Similarity=0.108  Sum_probs=25.0

Q ss_pred             ccCCCchhHHHHHHHhhhhhhhhHHhhhcc
Q 033409            5 EENSQLFPIFILTIMALPLVPYTILKLCHA   34 (120)
Q Consensus         5 DE~g~tfpyFvLt~l~lvLIP~T~~~l~~~   34 (120)
                      |=+.++|.++-.|+++++++-..+..|+..
T Consensus        63 DvS~~F~L~~~~ti~lv~~~~~~I~lL~sv   92 (103)
T PF12955_consen   63 DVSVPFWLFAGFTIALVVLVAGAIGLLFSV   92 (103)
T ss_pred             cccchhhHHHHHHHHHHHHHHHHHHHHHHc
Confidence            667888888889999999998888888655


No 13 
>CHL00196 psbY photosystem II protein Y; Provisional
Probab=35.89  E-value=31  Score=19.47  Aligned_cols=15  Identities=13%  Similarity=0.169  Sum_probs=10.3

Q ss_pred             HHHHHHHHHHHHHHH
Q 033409           71 NLSLVLLWVIMIILI   85 (120)
Q Consensus        71 ~l~lv~GW~l~~~L~   85 (120)
                      -+++.+||+++-..-
T Consensus        11 Pil~A~~Wa~fNIg~   25 (36)
T CHL00196         11 PVLAAASWALFNIGR   25 (36)
T ss_pred             HHHHHHHHHHHHhHH
Confidence            356678999986543


No 14 
>PF03311 Cornichon:  Cornichon protein;  InterPro: IPR003377  The drosophila cornichon protein (gene: cni) [] is required in the germline for dorsal-ventral signalling. The dorsal-ventral pattern formation involves a reorganisation of the microtubule network correlated with the movement of the oocyte nucleus, and depending on the initial correct establishment of the anterior-posterior axis via a signal from the oocyte produced by cornichon and gurken and received by torpedo protein in the follicle cells. The biochemical function of the cornichon protein is currently not known. It is a protein of 144 residues that seems to contain three transmembrane regions. ; GO: 0035556 intracellular signal transduction, 0016020 membrane
Probab=35.88  E-value=1.5e+02  Score=20.74  Aligned_cols=44  Identities=18%  Similarity=0.128  Sum_probs=24.6

Q ss_pred             HHHHHHHHHHHHHH-----HHHHHHhcccccCccchhhHhHhhhhhhhh
Q 033409           70 SNLSLVLLWVIMII-----LIYYIKSTSREHTRFGTWGLRFRYKESISE  113 (120)
Q Consensus        70 ~~l~lv~GW~l~~~-----L~y~i~~~~~~~~~fDPYeIL~~~~~~~~~  113 (120)
                      ..+.++.||-+.+.     ++|.+....+....+||=||-...+..-.|
T Consensus        62 ~~l~ll~g~w~~~llnlPl~~y~~~~~~~~~~l~D~T~If~~L~~~kk~  110 (128)
T PF03311_consen   62 CLLFLLTGHWFLFLLNLPLLAYHIYRYFRRQHLYDPTEIFNQLKREKKE  110 (128)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCccccHHHHHHHHHHHHHH
Confidence            34444555554433     455554333334569999998775544444


No 15 
>COG1288 Predicted membrane protein [Function unknown]
Probab=35.40  E-value=1.2e+02  Score=26.31  Aligned_cols=20  Identities=25%  Similarity=0.507  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 033409           70 SNLSLVLLWVIMIILIYYIK   89 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L~y~i~   89 (120)
                      ++++|.+.=+.+..++|-+.
T Consensus       275 ~klvL~lf~l~f~~mI~GV~  294 (481)
T COG1288         275 DKLVLLLFTLTFVIMIWGVI  294 (481)
T ss_pred             hhHHHHHHHHHHHHHHHHhh
Confidence            45555544455555666554


No 16 
>KOG3672 consensus Histidine acid phosphatase [General function prediction only]
Probab=34.77  E-value=31  Score=29.57  Aligned_cols=54  Identities=13%  Similarity=0.076  Sum_probs=28.7

Q ss_pred             cCccchhhHHHHHHHhhhhc-CcchhHHHHHHHHHHHHHHHHHHHHhcccccCccchhhHhHh
Q 033409           45 QCSDCARSGKYRKSIFKRIS-NFSTCSNLSLVLLWVIMIILIYYIKSTSREHTRFGTWGLRFR  106 (120)
Q Consensus        45 ~c~~c~~~~~~i~~~~kr~~-~~~~~~~l~lv~GW~l~~~L~y~i~~~~~~~~~fDPYeIL~~  106 (120)
                      +| .|+.+...++....+-. .+.+ +....+.-|.-.+.+      .....+.||||+.-..
T Consensus       249 ~C-~Cp~~~~~r~~~e~~~~~q~lk-~~~~dv~~~~~~~~~------~~~p~~~~~pf~~ID~  303 (487)
T KOG3672|consen  249 QC-ACPIHKSIRRIYEEEHLQQFLK-MKSDDVADEEKKFLS------FPQPAASFDPFQMIDV  303 (487)
T ss_pred             cc-cchHHHHHHHHHHHHHHHHHHh-cchHHHHhhhcceee------ecccccccCchhHHHH
Confidence            56 37776655544443111 1123 334566677666444      2234467999987544


No 17 
>PRK13240 pbsY photosystem II protein Y; Reviewed
Probab=33.30  E-value=36  Score=19.65  Aligned_cols=17  Identities=12%  Similarity=0.049  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 033409           71 NLSLVLLWVIMIILIYY   87 (120)
Q Consensus        71 ~l~lv~GW~l~~~L~y~   87 (120)
                      =+++.+||+++-..---
T Consensus        11 Pil~A~~Wa~fNIg~~A   27 (40)
T PRK13240         11 PILAAAGWAVFNIGKAA   27 (40)
T ss_pred             HHHHHHHHHHHHhhHHH
Confidence            35667899998665433


No 18 
>KOG0510 consensus Ankyrin repeat protein [General function prediction only]
Probab=33.10  E-value=81  Score=29.41  Aligned_cols=26  Identities=35%  Similarity=0.327  Sum_probs=20.5

Q ss_pred             CCchhHHHHHHHhhhhhhhhHHhhhc
Q 033409            8 SQLFPIFILTIMALPLVPYTILKLCH   33 (120)
Q Consensus         8 g~tfpyFvLt~l~lvLIP~T~~~l~~   33 (120)
                      |--|.++-|-+++++++|+|++.+-.
T Consensus       505 g~~~~~~nL~~Y~lFlv~lT~Yv~~~  530 (929)
T KOG0510|consen  505 GKYFHLNNLLIYSLFLVSLTIYVLLI  530 (929)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            33466677899999999999988743


No 19 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=32.49  E-value=68  Score=29.20  Aligned_cols=19  Identities=16%  Similarity=0.296  Sum_probs=13.5

Q ss_pred             HHHHHHHhhhhhhhhHHhh
Q 033409           13 IFILTIMALPLVPYTILKL   31 (120)
Q Consensus        13 yFvLt~l~lvLIP~T~~~l   31 (120)
                      ..++.++.++++|++-..+
T Consensus        96 ~~~i~ll~~il~P~vg~~f  114 (806)
T PF05478_consen   96 CAVIGLLFIILMPLVGLCF  114 (806)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3456777788899986555


No 20 
>PF04583 Baculo_p74:  Baculoviridae p74 conserved region;  InterPro: IPR007663 Baculoviruses are distinct from other virus families in that there are two viral phenotypes: budded virus (BV) and occlusion-derived virus (ODV). BVs disseminate viral infection throughout the tissues of the host and ODVs transmit baculovirus between insect hosts. GFP tagging experiments implicate p74 as an ODV envelope protein [, ].; GO: 0019058 viral infectious cycle
Probab=31.55  E-value=37  Score=26.98  Aligned_cols=24  Identities=17%  Similarity=0.228  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHhcccccCccchhh
Q 033409           74 LVLLWVIMIILIYYIKSTSREHTRFGTWG  102 (120)
Q Consensus        74 lv~GW~l~~~L~y~i~~~~~~~~~fDPYe  102 (120)
                      =|+||++++..+--+     -...||||-
T Consensus       105 SVvgi~Li~~ti~Dl-----vL~~WDPfG  128 (249)
T PF04583_consen  105 SVVGIVLIFLTIADL-----VLMFWDPFG  128 (249)
T ss_pred             HHHHHHHHHHHHHHH-----HHHhcCccc
Confidence            346888876664322     125799984


No 21 
>smart00271 DnaJ DnaJ molecular chaperone homology domain.
Probab=31.01  E-value=16  Score=21.29  Aligned_cols=10  Identities=0%  Similarity=-0.180  Sum_probs=8.4

Q ss_pred             chhhHhHhhh
Q 033409           99 GTWGLRFRYK  108 (120)
Q Consensus        99 DPYeIL~~~~  108 (120)
                      |||+||++-.
T Consensus         2 ~~y~vLgl~~   11 (60)
T smart00271        2 DYYEILGVPR   11 (60)
T ss_pred             CHHHHcCCCC
Confidence            8999999854


No 22 
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=30.92  E-value=59  Score=22.47  Aligned_cols=27  Identities=11%  Similarity=0.241  Sum_probs=18.2

Q ss_pred             cccCCCchhHHHHHHHhhhhhhhhHHh
Q 033409            4 TEENSQLFPIFILTIMALPLVPYTILK   30 (120)
Q Consensus         4 YDE~g~tfpyFvLt~l~lvLIP~T~~~   30 (120)
                      -.++|..|+|.|.-+++.+.+-+-+..
T Consensus        10 ~~~~g~sW~~LVGVv~~al~~SlLIal   36 (102)
T PF15176_consen   10 PGEGGRSWPFLVGVVVTALVTSLLIAL   36 (102)
T ss_pred             CCCCCcccHhHHHHHHHHHHHHHHHHH
Confidence            357899999987666665555444443


No 23 
>PF06459 RR_TM4-6:  Ryanodine Receptor TM 4-6;  InterPro: IPR009460  The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity []. This region covers TM regions 4-6 of the ryanodine receptor 1 family.; GO: 0005219 ryanodine-sensitive calcium-release channel activity, 0006874 cellular calcium ion homeostasis, 0016021 integral to membrane
Probab=30.50  E-value=56  Score=26.18  Aligned_cols=31  Identities=32%  Similarity=0.555  Sum_probs=21.8

Q ss_pred             cCc-chhHHHHHHHHHHHHHHHH-HHHHhccccc
Q 033409           64 SNF-STCSNLSLVLLWVIMIILI-YYIKSTSREH   95 (120)
Q Consensus        64 ~~~-~~~~~l~lv~GW~l~~~L~-y~i~~~~~~~   95 (120)
                      +++ +. |.++|+++-++-++|. |||+....+.
T Consensus       168 RNFYNl-r~lALflAFaINFILLFYKVs~~~~~~  200 (274)
T PF06459_consen  168 RNFYNL-RFLALFLAFAINFILLFYKVSTSPPEE  200 (274)
T ss_pred             HHHHHH-HHHHHHHHHHHHHHHHHHHhccCCccc
Confidence            344 55 8999999998876655 8887555443


No 24 
>PF06422 PDR_CDR:  CDR ABC transporter;  InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). In yeast, the PDR and CDR ABC transporters display extensive sequence homology, and confer resistance to several anti-fungal compounds by actively transporting their substrates out of the cell. These transporters have two homologous halves, each with an N-terminal intracellular hydrophilic region that contains an ATP-binding site, followed by a C-terminal membrane-associated region containing six transmembrane segments []. This entry represents a domain of the PDR/CDR ABC transporter comprising extracellular loop 3, transmembrane segment 6 and a linker region.; GO: 0005524 ATP binding, 0042626 ATPase activity, coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane
Probab=30.16  E-value=64  Score=21.70  Aligned_cols=22  Identities=14%  Similarity=0.383  Sum_probs=16.7

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHH
Q 033409           67 STCSNLSLVLLWVIMIILIYYIK   89 (120)
Q Consensus        67 ~~~~~l~lv~GW~l~~~L~y~i~   89 (120)
                      .+ ||+-+++||.+++++++-+.
T Consensus        48 ~W-RN~GIli~f~i~f~~~~~~~   69 (103)
T PF06422_consen   48 RW-RNFGILIAFWIFFIVLTLLA   69 (103)
T ss_pred             hh-hhHHHHHHHHHHHHHHHHHH
Confidence            35 88888888888877777663


No 25 
>PF11027 DUF2615:  Protein of unknown function (DUF2615);  InterPro: IPR020309 This entry represents a group of uncharacterised protein from the Metazoa, including CD034 (or C4orf34) and YQF4 (or C34C12.4).
Probab=29.40  E-value=65  Score=22.23  Aligned_cols=19  Identities=21%  Similarity=0.831  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 033409           70 SNLSLVLLWVIMIILIYYI   88 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L~y~i   88 (120)
                      ...+++++|.++|++.|..
T Consensus        54 ~~~~~~~~w~~~A~~ly~~   72 (103)
T PF11027_consen   54 SMFMMMMLWMVLAMALYLL   72 (103)
T ss_pred             cHHHHHHHHHHHHHHHHHc
Confidence            5677888999999999887


No 26 
>PF03967 PRCH:  Photosynthetic reaction centre, H-chain N-terminal region;  InterPro: IPR015810  The photosynthetic apparatus in non-oxygenic bacteria consists of light-harvesting (LH) protein-pigment complexes LH1 and LH2, which use carotenoid and bacteriochlorophyll as primary donors []. LH1 acts as the energy collection hub, temporarily storing it before its transfer to the photosynthetic reaction centre (RC) []. Electrons are transferred from the primary donor via an intermediate acceptor (bacteriopheophytin) to the primary acceptor (quinine Qa), and finally to the secondary acceptor (quinone Qb), resulting in the formation of ubiquinol QbH2. RC uses the excitation energy to shuffle electrons across the membrane, transferring them via ubiquinol to the cytochrome bc1 complex in order to establish a proton gradient across the membrane, which is used by ATP synthetase to form ATP [, , ].  The core complex is anchored in the cell membrane, consisting of one unit of RC surrounded by LH1; in some species there may be additional subunits []. RC consists of three subunits: L (light), M (medium), and H (heavy). Subunits L and M provide the scaffolding for the chromophore, while subunit H contains a cytoplasmic domain []. In Rhodopseudomonas viridis, there is also a non-membranous tetrahaem cytochrome (4Hcyt) subunit on the periplasmic surface.  This entry represents the N-terminal domain of the photosynthetic reaction centre H subunit, which includes the transmembrane domain and part of the cytoplasmic domain [].; GO: 0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, 0019684 photosynthesis, light reaction, 0030077 plasma membrane light-harvesting complex; PDB: 1RZZ_H 1PST_H 2J8D_H 3DUQ_H 1FNP_H 1KBY_H 1E14_H 2HG3_H 1UMX_H 1YST_H ....
Probab=29.00  E-value=78  Score=22.98  Aligned_cols=22  Identities=32%  Similarity=0.786  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhc
Q 033409           70 SNLSLVLLWVIMIILIYYIKST   91 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L~y~i~~~   91 (120)
                      --++|-+.|+.|+.|+|.....
T Consensus        13 Aql~lyaFwiFFagLi~YLrrE   34 (136)
T PF03967_consen   13 AQLVLYAFWIFFAGLIYYLRRE   34 (136)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcc
Confidence            4466778999999999998533


No 27 
>PF04911 ATP-synt_J:  ATP synthase j chain;  InterPro: IPR006995 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit J found in the F0 complex of F-ATPases from fungal mitochondria. This subunit does not appear to display sequence similarity with subunits of F-ATPases found in other organisms []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o)
Probab=28.70  E-value=45  Score=20.49  Aligned_cols=15  Identities=20%  Similarity=0.370  Sum_probs=11.5

Q ss_pred             chhHHHHHHHhhhhh
Q 033409           10 LFPIFILTIMALPLV   24 (120)
Q Consensus        10 tfpyFvLt~l~lvLI   24 (120)
                      .||||+.+.+.+.+|
T Consensus        10 ~wPFf~ag~iv~ygv   24 (54)
T PF04911_consen   10 MWPFFAAGAIVYYGV   24 (54)
T ss_pred             hhHHHHHHHHHHHHH
Confidence            699999988665554


No 28 
>COG3924 Predicted membrane protein [Function unknown]
Probab=28.65  E-value=42  Score=21.99  Aligned_cols=15  Identities=20%  Similarity=0.388  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHH
Q 033409           70 SNLSLVLLWVIMIIL   84 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L   84 (120)
                      -.++.++||.+.+|+
T Consensus        18 LtllYl~gW~v~AYl   32 (80)
T COG3924          18 LTLLYLAGWLVAAYL   32 (80)
T ss_pred             HHHHHHHHHHHHHhC
Confidence            445677899999988


No 29 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=27.82  E-value=78  Score=18.80  Aligned_cols=32  Identities=9%  Similarity=0.178  Sum_probs=18.6

Q ss_pred             HHHHHHHHHHHHHHHHHH-Hhccccc-Cccchhh
Q 033409           71 NLSLVLLWVIMIILIYYI-KSTSREH-TRFGTWG  102 (120)
Q Consensus        71 ~l~lv~GW~l~~~L~y~i-~~~~~~~-~~fDPYe  102 (120)
                      .+.+.++=+++++..|-+ .+..+.+ +.=||||
T Consensus         9 ~~~i~i~~lL~~~TgyaiYtaFGppSk~LrDPFe   42 (46)
T PRK13183          9 SLAITILAILLALTGFGIYTAFGPPSKELDDPFD   42 (46)
T ss_pred             HHHHHHHHHHHHHhhheeeeccCCcccccCCchh
Confidence            344444555556666666 3344445 6789987


No 30 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=27.21  E-value=84  Score=21.13  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 033409           70 SNLSLVLLWVIMIILIYYIK   89 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L~y~i~   89 (120)
                      ..++|.+.+|+++++..-++
T Consensus         5 ~~llL~l~LA~lLlisSeva   24 (95)
T PF07172_consen    5 AFLLLGLLLAALLLISSEVA   24 (95)
T ss_pred             HHHHHHHHHHHHHHHHhhhh
Confidence            56666677777777765554


No 31 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=25.84  E-value=47  Score=23.10  Aligned_cols=24  Identities=17%  Similarity=0.301  Sum_probs=12.0

Q ss_pred             hhHHHHHHHhhhhhhhhHHhhhcc
Q 033409           11 FPIFILTIMALPLVPYTILKLCHA   34 (120)
Q Consensus        11 fpyFvLt~l~lvLIP~T~~~l~~~   34 (120)
                      |.+|++-+++++++-+...+..++
T Consensus         2 W~l~~iii~~i~l~~~~~~~~~rR   25 (130)
T PF12273_consen    2 WVLFAIIIVAILLFLFLFYCHNRR   25 (130)
T ss_pred             eeeHHHHHHHHHHHHHHHHHHHHH
Confidence            455655555555554444444333


No 32 
>PF14004 DUF4227:  Protein of unknown function (DUF4227)
Probab=25.71  E-value=84  Score=20.21  Aligned_cols=31  Identities=10%  Similarity=0.058  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcccccCccchhh
Q 033409           70 SNLSLVLLWVIMIILIYYIKSTSREHTRFGTWG  102 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L~y~i~~~~~~~~~fDPYe  102 (120)
                      |.++|-+|=.+++|-+..--  .++...+|||+
T Consensus         8 k~~~LF~~~T~lfYy~~~w~--~~~~~~~hrY~   38 (71)
T PF14004_consen    8 KFFLLFTGCTLLFYYAILWV--SDEYEPYHRYD   38 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHH--HHHhccCCCCC
Confidence            56666666665555444332  23446688875


No 33 
>PF09878 DUF2105:  Predicted membrane protein (DUF2105);  InterPro: IPR019212  This entry represents a protein found in various hypothetical archaeal proteins, has no known function. 
Probab=25.11  E-value=37  Score=26.26  Aligned_cols=24  Identities=17%  Similarity=0.288  Sum_probs=21.1

Q ss_pred             CCCchhHHHHHHHhhhhhhhhHHh
Q 033409            7 NSQLFPIFILTIMALPLVPYTILK   30 (120)
Q Consensus         7 ~g~tfpyFvLt~l~lvLIP~T~~~   30 (120)
                      ||-+|.++++.|+.+++.|--+..
T Consensus       164 SGiaWalWi~gF~~Ff~~P~~Wl~  187 (212)
T PF09878_consen  164 SGIAWALWIAGFIGFFLFPQYWLL  187 (212)
T ss_pred             hhHHHHHHHHHHHHHHHhHHHHHH
Confidence            788999999999999999976643


No 34 
>CHL00020 psbN photosystem II protein N
Probab=24.83  E-value=72  Score=18.69  Aligned_cols=31  Identities=3%  Similarity=0.091  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHHHH-Hhccccc-Cccchhh
Q 033409           72 LSLVLLWVIMIILIYYI-KSTSREH-TRFGTWG  102 (120)
Q Consensus        72 l~lv~GW~l~~~L~y~i-~~~~~~~-~~fDPYe  102 (120)
                      +.+.++=+++....|.+ .+..+.+ +.=||||
T Consensus         7 ~~i~i~~ll~~~Tgy~iYtaFGppSk~LrDPfe   39 (43)
T CHL00020          7 VAIFISGLLVSFTGYALYTAFGQPSKQLRDPFE   39 (43)
T ss_pred             HHHHHHHHHHHhhheeeeeccCCchhccCCchh
Confidence            33444445555666665 3344444 6789987


No 35 
>PF07672 MFS_Mycoplasma:  Mycoplasma MFS transporter;  InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS).
Probab=24.53  E-value=1.2e+02  Score=24.30  Aligned_cols=24  Identities=8%  Similarity=0.271  Sum_probs=18.6

Q ss_pred             hhHHHHHHHhhhhhhhhHHhhhcc
Q 033409           11 FPIFILTIMALPLVPYTILKLCHA   34 (120)
Q Consensus        11 fpyFvLt~l~lvLIP~T~~~l~~~   34 (120)
                      |-+-+..+.+++++|+-++.+.+.
T Consensus        40 W~~I~si~~lL~~IpLIly~ifGk   63 (267)
T PF07672_consen   40 WQWILSIFILLIFIPLILYIIFGK   63 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcc
Confidence            666667777889999998887544


No 36 
>PF04341 DUF485:  Protein of unknown function, DUF485;  InterPro: IPR007436 This family includes several putative integral membrane proteins.
Probab=24.15  E-value=1.1e+02  Score=20.04  Aligned_cols=25  Identities=16%  Similarity=0.373  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcccccCccch
Q 033409           70 SNLSLVLLWVIMIILIYYIKSTSREHTRFGT  100 (120)
Q Consensus        70 ~~l~lv~GW~l~~~L~y~i~~~~~~~~~fDP  100 (120)
                      -...++++|++..+-+.+..      +.|||
T Consensus        59 g~~~~~~~~~l~~~Yv~~An------~~~D~   83 (91)
T PF04341_consen   59 GLGQIVFAWVLTWLYVRRAN------REFDP   83 (91)
T ss_pred             HHHHHHHHHHHHHHHHHHHc------cccCH
Confidence            45566678888877666532      34777


No 37 
>PF02560 Cyanate_lyase:  Cyanate lyase C-terminal domain;  InterPro: IPR003712 Some bacteria can overcome the toxicity of environmental cyanate by hydrolysis of cyanate. This reaction is catalyzed by cyanate lyase (also known as cyanase) []. Cyanate lyase is found in bacteria and plants and catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide. The cyanate lyase monomer is composed of two domains. The N-terminal domain shows structural similarity to the DNA-binding alpha-helix bundle motif. The C-terminal domain has an 'open fold' with no structural homology to other proteins. The dimer structure reveals the C-terminal domains to be intertwined, and the decamer is formed by a pentamer of these dimers. The active site of the enzyme is located between dimers and is comprised of residues from four adjacent subunits of the homodecamer []. ; GO: 0008824 cyanate hydratase activity, 0009439 cyanate metabolic process; PDB: 2IV1_B 2IUO_A 2IVQ_B 1DW9_A 1DWK_E 2IVG_G 2IU7_J 2IVB_A.
Probab=23.96  E-value=46  Score=21.67  Aligned_cols=21  Identities=14%  Similarity=0.270  Sum_probs=16.5

Q ss_pred             ccchhhHhHhhhhhhhhhhhc
Q 033409           97 RFGTWGLRFRYKESISETFHT  117 (120)
Q Consensus        97 ~fDPYeIL~~~~~~~~~~~~~  117 (120)
                      +|-=||++++|-+++.+..|.
T Consensus        12 iYR~yE~v~vYG~~~K~li~E   32 (73)
T PF02560_consen   12 IYRLYEIVQVYGPAIKALIHE   32 (73)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             EeeeehhhHhhCHHHHHHHHH
Confidence            455599999999888877763


No 38 
>PF12686 DUF3800:  Protein of unknown function (DUF3800);  InterPro: IPR024524 This family of proteins is functionally uncharacterised. Some family members possess a DE motif at their N terminus and a QXXD motif at their C terminus that may be functionally important.
Probab=23.69  E-value=5.8  Score=28.70  Aligned_cols=16  Identities=25%  Similarity=0.395  Sum_probs=12.7

Q ss_pred             cccCCC--------chhHHHHHHH
Q 033409            4 TEENSQ--------LFPIFILTIM   19 (120)
Q Consensus         4 YDE~g~--------tfpyFvLt~l   19 (120)
                      .||+|+        .-|||+++.+
T Consensus         4 iDESG~~~~~~~~~~~~~fvl~gv   27 (235)
T PF12686_consen    4 IDESGNTGPNYSDKNSPYFVLGGV   27 (235)
T ss_pred             EeCCCCCCCCcCCCCCCEEEEEEE
Confidence            499998        4899987765


No 39 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=23.36  E-value=1.4e+02  Score=17.39  Aligned_cols=27  Identities=11%  Similarity=0.091  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHH-Hhccccc-Cccchhh
Q 033409           76 LLWVIMIILIYYI-KSTSREH-TRFGTWG  102 (120)
Q Consensus        76 ~GW~l~~~L~y~i-~~~~~~~-~~fDPYe  102 (120)
                      ++=+++....|-+ ....+.+ +.=||||
T Consensus        11 i~~~lv~~Tgy~iYtaFGppSk~LrDPfe   39 (43)
T PF02468_consen   11 ISCLLVSITGYAIYTAFGPPSKELRDPFE   39 (43)
T ss_pred             HHHHHHHHHhhhhhheeCCCccccCCccc
Confidence            3444444444554 2344444 6779987


No 40 
>cd00559 Cyanase_C Cyanase C-terminal domain. Cyanase (Cyanate lyase) is responsible for the hydrolysis of cyanate.  It catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide. This allows organisms that possess the enzyme to overcome the toxicity of environmental cyanate and to use cyanate as a source of nitrogen for growth. This enzyme is a homodecamer, formed by five dimers. Each monomer is composed of two domains, an N-terminal helix-turn-helix and this structurally unique C-terminal domain.
Probab=23.13  E-value=47  Score=21.36  Aligned_cols=22  Identities=9%  Similarity=0.212  Sum_probs=17.7

Q ss_pred             CccchhhHhHhhhhhhhhhhhc
Q 033409           96 TRFGTWGLRFRYKESISETFHT  117 (120)
Q Consensus        96 ~~fDPYeIL~~~~~~~~~~~~~  117 (120)
                      .+|-=||++++|-+++.|..|.
T Consensus         7 ~iYRlyE~v~vYG~~~K~li~E   28 (69)
T cd00559           7 LIYRFYEIVQVYGPTLKALIHE   28 (69)
T ss_pred             eeeehHHHHHHhhHHHHHHHHH
Confidence            3566799999999988887773


No 41 
>TIGR02736 cbb3_Q_epsi cytochrome c oxidase, cbb3-type, CcoQ subunit, epsilon-Proteobacterial. Members of this protein family are restricted to the epsilon branch of the Proteobacteria. All members are found in operons containing the other three structural subunits of the cbb3 type of cytochrome c oxidase. These small proteins show remote sequence similarity to the CcoQ subunit in other cytochrome c oxidase systems, so this family is assumed to represent the epsilonproteobacterial variant of CcoQ.
Probab=21.03  E-value=1e+02  Score=19.03  Aligned_cols=24  Identities=17%  Similarity=0.354  Sum_probs=13.9

Q ss_pred             hhHHHHHHHhhhhhhhhHHhhhcc
Q 033409           11 FPIFILTIMALPLVPYTILKLCHA   34 (120)
Q Consensus        11 fpyFvLt~l~lvLIP~T~~~l~~~   34 (120)
                      +.||++++++++++=-=++-+++.
T Consensus         2 y~yf~~ti~lvv~LYgY~yhLYrs   25 (56)
T TIGR02736         2 YAYFAFTLLLVIFLYAYIYHLYRS   25 (56)
T ss_pred             cchHHHHHHHHHHHHHHHHHhhhh
Confidence            357777777666664444445443


No 42 
>PF01542 HCV_core:  Hepatitis C virus core protein;  InterPro: IPR002521 The Hepatitis C virus (HCV) is a small (50 nm in size), enveloped, single-stranded, positive sense RNA virus. It is the only known member of the hepacivirus genus in the family Flaviviridae. There are six major genotypes of the hepatitis C virus, which are identified numerically (e.g., genotype 1, genotype 2, etc.). Although Hepatitis A virus, Hepatitis B virus, and Hepatitis C virus have similar names, because they all cause liver inflammation, these are distinctly different viruses both genetically and clinically. HCV has a positive sense RNA genome that consists of a single open reading frame of 9600 nucleotides. At the 5' and 3' ends of the RNA are the UTR regions that are not translated into proteins but are important to translation and replication of the viral RNA. The 5' UTR has a ribosome binding site (IRES - Internal ribosome entry site) that starts the translation of a 3000 amino acid containing protein that is later cut by cellular and viral proteases into 10 active structural and non-structural smaller proteins. The HCV core protein is located at the N terminus of the polyprotein and is followed by the signal sequence located between the core protein and the E1 envelope glycoprotein. This signal sequence targets the nascent HCV polyprotein to the endoplasmic reticulum (ER), allowing the translocation of E1 to the ER lumen. Cleavage by a signal peptidase in the ER lumen releases the N-terminal end of E1, leaving the 191-amino acids (aa) core protein anchored by its C-terminal signal peptide [, ]. This 191aa polypeptide, also known as p23, is the immature form of the core protein; p23 is further processed by an intramembrane protease, the signal peptide peptidase (SPP), that removes the ER anchor , releasing p21, the N-terminal 179aa mature form of the core protein []. Core protein (p21) is responsible for packaging viral RNA to form a viral nucleocapsid, and it also promotes virion budding [].  Two domains have been identified in the mature form of the HCV core protein, based on predicted structural and functional characteristics []. Domain I, corresponding to the N-terminal region of approximately 120 aa, is a highly basic domain that is probably involved in the recruitment of viral RNA during particle morphogenesis. Domain II, located between aa 120 and aa 175, is a hydrophobic region predicted to form one or two alpha-helices that are probably involved in the association of core with the ER membrane and lipid droplets.  This entry represents domain II and domain III (ER anchor sequence) of the core protein p23. ; GO: 0005198 structural molecule activity
Probab=20.75  E-value=63  Score=20.94  Aligned_cols=19  Identities=32%  Similarity=0.564  Sum_probs=15.9

Q ss_pred             CCchhHHHHHHHhhhhhhh
Q 033409            8 SQLFPIFILTIMALPLVPY   26 (120)
Q Consensus         8 g~tfpyFvLt~l~lvLIP~   26 (120)
                      |=-|..|++++++++..|.
T Consensus        56 gcsfsIFllaLlSc~~~p~   74 (75)
T PF01542_consen   56 GCSFSIFLLALLSCLTVPA   74 (75)
T ss_pred             CccHHHHHHHHHHhccccC
Confidence            5568899999999998874


No 43 
>COG3083 Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only]
Probab=20.10  E-value=69  Score=28.38  Aligned_cols=24  Identities=25%  Similarity=0.566  Sum_probs=20.3

Q ss_pred             hhHHHHHHHhhhhhhhhHHhhhcc
Q 033409           11 FPIFILTIMALPLVPYTILKLCHA   34 (120)
Q Consensus        11 fpyFvLt~l~lvLIP~T~~~l~~~   34 (120)
                      |.|++.+..++|+.|+|...+++.
T Consensus        61 FsflvFA~yLlvlfpltfiv~s~r   84 (600)
T COG3083          61 FSFLVFALYLLVLFPLTFIVLSQR   84 (600)
T ss_pred             HHHHHHHHHHHHHhhhhhhcccHH
Confidence            678899999999999998776555


Done!