Citrus Sinensis ID: 033426

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MAAAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA
ccccccccEEEEEcHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHcccccccEEEEEEccEEEEEEEcccHHHHHHHHHHHHccccc
******G*VIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIA*HL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAEEGQVIGCHTVEAWNEQLQKSNETKQLVVVDFTASWCGPCRFIAPFLAELAKKLPNVLFLKVDVDELKSVATDWAVEAMPTFMFLKEGKIVDKVVGSKKEELQQTIAKHLATASA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin H1 Thiol-disulfide oxidoreductase involved in the redox regulation of a number of cytosolic enzymes. Activates the cytosolic malate dehydrogenase (MDH) probably by reducing an interchain disulfid bond of the inactive MDH homodimer. Possesses insulin disulfide bonds reducing activity.confidentP29448
Thioredoxin H-type 2 Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide. The H form is known to activate a number of cytosolic enzymes.probableQ07090
Thioredoxin H-type Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide. The H form is known to activate a number of cytosolic enzymes.probableQ43636

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XFL, chain A
Confidence level:very confident
Coverage over the Query: 4-114
View the alignment between query and template
View the model in PyMOL