BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033431
(119 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2Y9W|A Chain A, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
Bisporus, In Deoxy-Form That Contains Additional Unknown
Lectin-Like Subunit
pdb|2Y9W|B Chain B, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
Bisporus, In Deoxy-Form That Contains Additional Unknown
Lectin-Like Subunit
pdb|2Y9X|A Chain A, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
Bisporus, In Deoxy-Form That Contains Additional Unknown
Lectin-Like Subunit, With Inhibitor Tropolone
pdb|2Y9X|B Chain B, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
Bisporus, In Deoxy-Form That Contains Additional Unknown
Lectin-Like Subunit, With Inhibitor Tropolone
pdb|2Y9X|C Chain C, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
Bisporus, In Deoxy-Form That Contains Additional Unknown
Lectin-Like Subunit, With Inhibitor Tropolone
pdb|2Y9X|D Chain D, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
Bisporus, In Deoxy-Form That Contains Additional Unknown
Lectin-Like Subunit, With Inhibitor Tropolone
Length = 391
Score = 26.6 bits (57), Expect = 3.6, Method: Composition-based stats.
Identities = 8/20 (40%), Positives = 14/20 (70%)
Query: 48 SEKESLVKANKDLKKRMWDW 67
S++ ++A KDL++ WDW
Sbjct: 118 SDQAEWIQAAKDLRQPFWDW 137
>pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed
With Its Cognate Trna
Length = 642
Score = 25.8 bits (55), Expect = 7.2, Method: Composition-based stats.
Identities = 10/30 (33%), Positives = 15/30 (50%)
Query: 40 QNDIEGLESEKESLVKANKDLKKRMWDWKQ 69
Q D+E LE L + N D+ K+ W +
Sbjct: 114 QEDVEALEKRMHELAEKNYDVIKKKVSWHE 143
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.124 0.330
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,266,589
Number of Sequences: 62578
Number of extensions: 62187
Number of successful extensions: 159
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 153
Number of HSP's gapped (non-prelim): 7
length of query: 119
length of database: 14,973,337
effective HSP length: 81
effective length of query: 38
effective length of database: 9,904,519
effective search space: 376371722
effective search space used: 376371722
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)