BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033431
         (119 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2Y9W|A Chain A, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
           Bisporus, In Deoxy-Form That Contains Additional Unknown
           Lectin-Like Subunit
 pdb|2Y9W|B Chain B, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
           Bisporus, In Deoxy-Form That Contains Additional Unknown
           Lectin-Like Subunit
 pdb|2Y9X|A Chain A, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
           Bisporus, In Deoxy-Form That Contains Additional Unknown
           Lectin-Like Subunit, With Inhibitor Tropolone
 pdb|2Y9X|B Chain B, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
           Bisporus, In Deoxy-Form That Contains Additional Unknown
           Lectin-Like Subunit, With Inhibitor Tropolone
 pdb|2Y9X|C Chain C, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
           Bisporus, In Deoxy-Form That Contains Additional Unknown
           Lectin-Like Subunit, With Inhibitor Tropolone
 pdb|2Y9X|D Chain D, Crystal Structure Of Ppo3, A Tyrosinase From Agaricus
           Bisporus, In Deoxy-Form That Contains Additional Unknown
           Lectin-Like Subunit, With Inhibitor Tropolone
          Length = 391

 Score = 26.6 bits (57), Expect = 3.6,   Method: Composition-based stats.
 Identities = 8/20 (40%), Positives = 14/20 (70%)

Query: 48  SEKESLVKANKDLKKRMWDW 67
           S++   ++A KDL++  WDW
Sbjct: 118 SDQAEWIQAAKDLRQPFWDW 137


>pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed
           With Its Cognate Trna
          Length = 642

 Score = 25.8 bits (55), Expect = 7.2,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 15/30 (50%)

Query: 40  QNDIEGLESEKESLVKANKDLKKRMWDWKQ 69
           Q D+E LE     L + N D+ K+   W +
Sbjct: 114 QEDVEALEKRMHELAEKNYDVIKKKVSWHE 143


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.311    0.124    0.330 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,266,589
Number of Sequences: 62578
Number of extensions: 62187
Number of successful extensions: 159
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 153
Number of HSP's gapped (non-prelim): 7
length of query: 119
length of database: 14,973,337
effective HSP length: 81
effective length of query: 38
effective length of database: 9,904,519
effective search space: 376371722
effective search space used: 376371722
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)