Query         033432
Match_columns 119
No_of_seqs    101 out of 249
Neff          6.0 
Searched_HMMs 29240
Date          Mon Mar 25 23:11:20 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033432.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/033432hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2l2t_A Receptor tyrosine-prote  40.7      20 0.00069   20.3   2.3   13   42-54     10-22  (44)
  2 1afo_A Glycophorin A; integral  40.1      15 0.00052   20.5   1.7   14   41-54     12-25  (40)
  3 1q90_G Cytochrome B6F complex   32.8      16 0.00056   20.1   1.0   14   43-56      4-17  (37)
  4 2ks1_B Epidermal growth factor  31.5      12 0.00042   21.2   0.4   12   43-54     12-23  (44)
  5 2l34_A TYRO protein tyrosine k  23.2      65  0.0022   17.0   2.3   23   43-65      7-29  (33)
  6 1vf5_G Protein PET G; photosyn  19.6      19 0.00063   19.8  -0.4   14   43-56      4-17  (37)
  7 2e8o_A SAM domain and HD domai  18.0 1.6E+02  0.0056   18.6   4.0   20   22-41     23-42  (103)
  8 3arc_J Photosystem II reaction  16.7      70  0.0024   17.8   1.6   18   46-64     13-30  (40)
  9 2k9j_B Integrin beta-3; transm  15.7 1.6E+02  0.0055   16.1   4.7   13   41-53      9-21  (43)
 10 3e1r_A Centrosomal protein of   15.6 1.7E+02  0.0058   17.4   3.2   36   21-56     12-47  (58)

No 1  
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens}
Probab=40.70  E-value=20  Score=20.34  Aligned_cols=13  Identities=38%  Similarity=0.531  Sum_probs=7.9

Q ss_pred             HHHHHHHHhhhhc
Q 033432           42 LSIIGGVIAGILG   54 (119)
Q Consensus        42 ~al~~Gi~aGiLg   54 (119)
                      .++..|++.|++.
T Consensus        10 ~aIA~gVVgGv~~   22 (44)
T 2l2t_A           10 PLIAAGVIGGLFI   22 (44)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             ceEEEeehHHHHH
Confidence            4566666666654


No 2  
>1afo_A Glycophorin A; integral membrane protein, transmembrane helix interactions, membrane protein folding; NMR {Homo sapiens} SCOP: j.35.1.1 PDB: 2kpf_A
Probab=40.11  E-value=15  Score=20.52  Aligned_cols=14  Identities=50%  Similarity=0.819  Sum_probs=11.1

Q ss_pred             HHHHHHHHHhhhhc
Q 033432           41 FLSIIGGVIAGILG   54 (119)
Q Consensus        41 ~~al~~Gi~aGiLg   54 (119)
                      ++.++.|+.||++|
T Consensus        12 i~lII~~vmaGiIG   25 (40)
T 1afo_A           12 ITLIIFGVMAGVIG   25 (40)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHH
Confidence            56788899998876


No 3  
>1q90_G Cytochrome B6F complex subunit PETG; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: f.23.26.1
Probab=32.81  E-value=16  Score=20.07  Aligned_cols=14  Identities=21%  Similarity=0.662  Sum_probs=10.9

Q ss_pred             HHHHHHHhhhhccc
Q 033432           43 SIIGGVIAGILGFT   56 (119)
Q Consensus        43 al~~Gi~aGiLgLt   56 (119)
                      .+++|++-|.++.|
T Consensus         4 ~lL~GIVlGlipvt   17 (37)
T 1q90_G            4 PLLCGIVLGLVPVT   17 (37)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             hhhhhHHHhhHHHH
Confidence            46788888888776


No 4  
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens}
Probab=31.51  E-value=12  Score=21.19  Aligned_cols=12  Identities=33%  Similarity=0.528  Sum_probs=6.3

Q ss_pred             HHHHHHHhhhhc
Q 033432           43 SIIGGVIAGILG   54 (119)
Q Consensus        43 al~~Gi~aGiLg   54 (119)
                      ++.+|++.|++.
T Consensus        12 ~IA~gVVgGv~~   23 (44)
T 2ks1_B           12 SIATGMVGALLL   23 (44)
T ss_dssp             SSTHHHHHHHHH
T ss_pred             eEEeehhHHHHH
Confidence            445556555543


No 5  
>2l34_A TYRO protein tyrosine kinase-binding protein; immunoreceptor, transmembrane assembly, DAP12, protein bindi; NMR {Homo sapiens} PDB: 2l35_B
Probab=23.16  E-value=65  Score=16.97  Aligned_cols=23  Identities=30%  Similarity=0.702  Sum_probs=14.1

Q ss_pred             HHHHHHHhhhhcccchHHHHHHH
Q 033432           43 SIIGGVIAGILGFTGLMGFVFYF   65 (119)
Q Consensus        43 al~~Gi~aGiLgLtg~~Gf~~f~   65 (119)
                      ..++|++-|-+-.|.+-+.+.|+
T Consensus         7 gaIaGIVvgdi~~t~~i~~~vy~   29 (33)
T 2l34_A            7 GVLAGIVVGDLVLTVLIALAVYF   29 (33)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceEEeEeHHHHHHHHHHHHHHhh
Confidence            34667776666666666665554


No 6  
>1vf5_G Protein PET G; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: f.23.26.1 PDB: 2d2c_G* 2e74_G* 2e75_G* 2e76_G* 2zt9_G*
Probab=19.55  E-value=19  Score=19.83  Aligned_cols=14  Identities=21%  Similarity=0.539  Sum_probs=7.0

Q ss_pred             HHHHHHHhhhhccc
Q 033432           43 SIIGGVIAGILGFT   56 (119)
Q Consensus        43 al~~Gi~aGiLgLt   56 (119)
                      .+++||+-|.++.|
T Consensus         4 plL~GIVlGlipvt   17 (37)
T 1vf5_G            4 PLLDGLVLGLVFAT   17 (37)
T ss_dssp             -----CHHHHHHHH
T ss_pred             hhhhhHHHhhHHHH
Confidence            46788888887765


No 7  
>2e8o_A SAM domain and HD domain-containing protein 1; cell-free protein synthesis, protein regulation, structural genomics, NPPSFA; NMR {Homo sapiens}
Probab=18.02  E-value=1.6e+02  Score=18.61  Aligned_cols=20  Identities=10%  Similarity=-0.042  Sum_probs=15.3

Q ss_pred             ccChhhhhhhhhHHHHHHHH
Q 033432           22 IFNAENLQSNMKVIYYSRTF   41 (119)
Q Consensus        22 ~~~~~~~~~N~~~l~~~r~~   41 (119)
                      .-.+..-|...+|..|++++
T Consensus        23 ~~~~v~~Ws~~~V~~WL~~l   42 (103)
T 2e8o_A           23 LHPDYKTWGPEQVCSFLRRG   42 (103)
T ss_dssp             CCSCGGGCHHHHHHHHHHHH
T ss_pred             cccChhhCCHHHHHHHHHHc
Confidence            34556678888999999975


No 8  
>3arc_J Photosystem II reaction center protein J; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 1s5l_J* 3a0b_J* 3a0h_J* 2axt_J* 3bz1_J* 3bz2_J* 3kzi_J* 3prq_J* 3prr_J*
Probab=16.65  E-value=70  Score=17.76  Aligned_cols=18  Identities=28%  Similarity=0.584  Sum_probs=8.8

Q ss_pred             HHHHhhhhcccchHHHHHH
Q 033432           46 GGVIAGILGFTGLMGFVFY   64 (119)
Q Consensus        46 ~Gi~aGiLgLtg~~Gf~~f   64 (119)
                      .|.++|+. .-++.|+.||
T Consensus        13 vgtv~G~~-vi~~~giFfy   30 (40)
T 3arc_J           13 VATVAGMG-VIVIVGLFFY   30 (40)
T ss_dssp             HHHHHHHH-HHHHHHHHHH
T ss_pred             eeeehhhh-hhheeeEEEe
Confidence            45555532 2445555555


No 9  
>2k9j_B Integrin beta-3; transmembrane complex, cell adhesion, cleavage on basic residues, disease mutation, glycoprotein, pyrrolidone carboxylic acid; NMR {Homo sapiens} PDB: 2rmz_A 2rn0_A 2l91_A
Probab=15.73  E-value=1.6e+02  Score=16.13  Aligned_cols=13  Identities=31%  Similarity=0.534  Sum_probs=8.9

Q ss_pred             HHHHHHHHHhhhh
Q 033432           41 FLSIIGGVIAGIL   53 (119)
Q Consensus        41 ~~al~~Gi~aGiL   53 (119)
                      +.+++.|+++|++
T Consensus         9 ~~~Iv~gvi~~iv   21 (43)
T 2k9j_B            9 ILVVLLSVMGAIL   21 (43)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             EeehHHHHHHHHH
Confidence            4567777777765


No 10 
>3e1r_A Centrosomal protein of 55 kDa; CEP55, ALIX, cytokinesis, ESCRT, alternative splicing, cell cycle, cell division, coiled coil, mitosis; 2.00A {Homo sapiens}
Probab=15.61  E-value=1.7e+02  Score=17.42  Aligned_cols=36  Identities=19%  Similarity=0.325  Sum_probs=29.8

Q ss_pred             cccChhhhhhhhhHHHHHHHHHHHHHHHHhhhhccc
Q 033432           21 QIFNAENLQSNMKVIYYSRTFLSIIGGVIAGILGFT   56 (119)
Q Consensus        21 ~~~~~~~~~~N~~~l~~~r~~~al~~Gi~aGiLgLt   56 (119)
                      +.--.|+..+|..=+-|-+|=-+-+=|+.++|+-|+
T Consensus        12 e~qLkDaleknqqWlvydqqReayV~gll~~i~ele   47 (58)
T 3e1r_A           12 EIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELE   47 (58)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcchhhhhHHHHHHHHHHHHHHHHHHH
Confidence            444567889999888999999999999999998765


Done!