Citrus Sinensis ID: 033433


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFLEATT
cccccccccHHcccccccccccccEEEEEEccEEEEEEEccccHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHcccECccccEEEECcccccccccccccccccccc
*******DRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSCAGADRLQTGMRGAFGKPQGTCARVAIGQVLLSVRCKDSNSHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFSRADYLRWKSENRIVPDGVNAKLLGCHGPLAQRQPGRAFLEATT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L10 (Fragment) probableQ40592
60S ribosomal protein L10-2 probableQ08770
60S ribosomal protein L10-1 Involved in defense response to geminivirus infection.probableQ93VT9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain h
Confidence level:very confident
Coverage over the Query: 1-68
View the alignment between query and template
View the model in PyMOL