BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033435
         (119 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutaredoxin C5
          From Arabidopsis Thaliana
 pdb|3RHC|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C5
          From Arabidopsis Thaliana
 pdb|3RHC|B Chain B, Crystal Structure Of The Holo Form Of Glutaredoxin C5
          From Arabidopsis Thaliana
          Length = 113

 Score = 26.6 bits (57), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 5/27 (18%)

Query: 53 LGPQEERLM-----LSGMHTVEDIFCC 74
          LGPQ  +L      L+G HTV ++F C
Sbjct: 54 LGPQGPQLQKVLERLTGQHTVPNVFVC 80


>pdb|1LSH|B Chain B, Lipid-Protein Interactions In Lipovitellin
          Length = 319

 Score = 26.2 bits (56), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 2/56 (3%)

Query: 2   GRIFLVELKGRSYYK--CRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGP 55
            +I  VEL   S +K   +F  S    A + + W  NC++ RA L +   N+   P
Sbjct: 87  AKIVAVELSDLSVWKLCAKFRLSAHMKAKAAIGWGKNCQQYRAMLEASTGNLQSHP 142


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.144    0.472 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,418,367
Number of Sequences: 62578
Number of extensions: 120027
Number of successful extensions: 254
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 253
Number of HSP's gapped (non-prelim): 3
length of query: 119
length of database: 14,973,337
effective HSP length: 81
effective length of query: 38
effective length of database: 9,904,519
effective search space: 376371722
effective search space used: 376371722
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)