Query         033435
Match_columns 119
No_of_seqs    115 out of 326
Neff          4.9 
Searched_HMMs 46136
Date          Fri Mar 29 13:51:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033435.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033435hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3399 Predicted Yippee-type  100.0 1.9E-52 4.1E-57  304.4  -3.7  115    1-116     1-118 (122)
  2 PF03226 Yippee-Mis18:  Yippee  100.0 4.9E-33 1.1E-37  191.8   5.8   88   15-108     3-94  (96)
  3 PF11648 RIG-I_C-RD:  C-termina  96.4  0.0019 4.1E-08   46.9   1.7   89   14-104     4-94  (123)
  4 PF01641 SelR:  SelR domain;  I  94.3   0.041   9E-07   40.5   2.8   70   12-89     36-105 (124)
  5 TIGR00357 methionine-R-sulfoxi  94.2   0.052 1.1E-06   40.5   3.2   67   12-86     39-105 (134)
  6 PRK00222 methionine sulfoxide   93.8   0.053 1.2E-06   40.9   2.6   67   12-86     42-108 (142)
  7 PRK05508 methionine sulfoxide   93.0    0.11 2.3E-06   38.2   3.0   63   12-85     32-94  (119)
  8 PRK05550 bifunctional methioni  91.1    0.18 3.9E-06   41.7   2.7   63   12-85     35-97  (283)
  9 PF14976 FAM72:  FAM72 protein   90.6    0.67 1.5E-05   35.3   5.1   61   15-87     16-88  (150)
 10 PRK14018 trifunctional thiored  89.4    0.36 7.8E-06   42.9   3.2   82   12-101   417-500 (521)
 11 COG0229 Conserved domain frequ  85.1     1.2 2.6E-05   33.6   3.5   65   12-84     41-105 (140)
 12 KOG0856 Predicted pilin-like t  81.8     1.6 3.4E-05   33.2   2.9   67   10-85     51-118 (146)
 13 PF09814 HECT_2:  HECT-like Ubi  70.6     6.6 0.00014   32.0   4.0   17   14-30    106-122 (354)
 14 PRK02935 hypothetical protein;  56.5       8 0.00017   28.1   1.8   25   11-36     84-108 (110)
 15 PF04828 GFA:  Glutathione-depe  49.4      17 0.00037   23.1   2.3   47   54-108    32-78  (92)
 16 TIGR02820 formald_GSH S-(hydro  48.9      21 0.00045   27.8   3.1   31   53-84     73-103 (182)
 17 PF11023 DUF2614:  Protein of u  43.9     9.9 0.00022   27.8   0.6   26   11-37     83-108 (114)
 18 PF03811 Zn_Tnp_IS1:  InsA N-te  41.3      15 0.00033   21.4   1.0   27   69-95      4-31  (36)
 19 PRK05417 glutathione-dependent  40.6      29 0.00064   27.1   2.8   40   66-109    89-128 (191)
 20 TIGR01053 LSD1 zinc finger dom  38.9      26 0.00056   19.8   1.7   19    4-23      9-28  (31)
 21 PF10955 DUF2757:  Protein of u  35.0      20 0.00044   24.4   1.0   17   13-29      3-19  (76)
 22 PF06943 zf-LSD1:  LSD1 zinc fi  32.6      35 0.00076   18.6   1.5   19    3-22      5-24  (25)
 23 COG1996 RPC10 DNA-directed RNA  31.4      37  0.0008   21.3   1.7   10   15-24      7-16  (49)
 24 PF00412 LIM:  LIM domain;  Int  30.4      30 0.00064   20.5   1.1   14   15-28     27-40  (58)
 25 PF00096 zf-C2H2:  Zinc finger,  28.2      12 0.00025   18.5  -0.8   16   15-30      1-16  (23)
 26 PF14803 Nudix_N_2:  Nudix N-te  27.1      28  0.0006   20.1   0.5   14   72-85      2-15  (34)
 27 PF10058 DUF2296:  Predicted in  27.0      19 0.00042   22.6  -0.2   39   45-88      2-40  (54)
 28 COG4187 RocB Arginine degradat  25.3      50  0.0011   29.8   2.0   43   24-84    200-244 (553)
 29 COG3791 Uncharacterized conser  25.3      56  0.0012   23.5   2.0   22   66-87     65-86  (133)
 30 TIGR00037 eIF_5A translation i  25.0      85  0.0018   22.8   2.9   30   36-65     35-64  (130)
 31 smart00132 LIM Zinc-binding do  23.6      32  0.0007   18.2   0.4   11   15-25     28-38  (39)
 32 PF02945 Endonuclease_7:  Recom  23.5     9.2  0.0002   26.0  -2.3   16   68-83     50-65  (81)
 33 PF13842 Tnp_zf-ribbon_2:  DDE_  23.2      61  0.0013   18.2   1.5   15   13-27     15-29  (32)
 34 PF10246 MRP-S35:  Mitochondria  23.2      48   0.001   23.9   1.2   51   44-99     10-66  (104)
 35 PLN03107 eukaryotic translatio  22.0   1E+02  0.0022   23.4   2.9   36   36-71     49-85  (159)
 36 PF13248 zf-ribbon_3:  zinc-rib  22.0      26 0.00057   18.6  -0.2   11   70-80     16-26  (26)
 37 PF04246 RseC_MucC:  Positive r  21.0 1.3E+02  0.0028   21.3   3.1   43   15-58     17-59  (135)
 38 smart00714 LITAF Possible memb  20.3      52  0.0011   20.8   0.9   12   72-83     54-65  (67)
 39 PRK11586 napB nitrate reductas  20.3      66  0.0014   24.6   1.6   32    7-39    114-145 (149)
 40 PRK03999 translation initiatio  20.1 1.2E+02  0.0026   22.0   2.9   31   35-65     33-63  (129)

No 1  
>KOG3399 consensus Predicted Yippee-type zinc-binding protein [General function prediction only]
Probab=100.00  E-value=1.9e-52  Score=304.42  Aligned_cols=115  Identities=53%  Similarity=0.929  Sum_probs=110.2

Q ss_pred             Ccceeeeeecc--eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCC
Q 033435            1 MGRIFLVELKG--RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQ   78 (119)
Q Consensus         1 MGr~f~~yl~g--~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~   78 (119)
                      |||+|.++|++  +. |+|++|+||||+++||||++|+|++|+||||++|+||..|+.|+|.|+||+|+|+||+|+.|++
T Consensus         1 mgR~F~~~l~~~~~~-y~C~~C~thla~~~dliSksf~gr~G~AyLf~~vvNv~~ge~e~R~mlTG~h~V~di~C~~C~~   79 (122)
T KOG3399|consen    1 MGRLFEAMLEANHRL-YSCAHCKTHLARHDDLISKSFRGRTGRAYLFNRVVNVIIGETEQRVMLTGLHTVADIFCVLCGT   79 (122)
T ss_pred             CcchHHHHhccCCce-EeccCCcccccchhhccccccccCCCcchhhhhhhhheechHHHHHHHHhHHhhcchhhhhcCC
Confidence            99999999999  58 9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeEEEEeccCCcceecCeEEEEeehhhhh-hhheeee
Q 033435           79 IVGWKYVAAHDKNQKYKEGKFVLERYRIGKY-VFELLVS  116 (119)
Q Consensus        79 ~lGWkY~~A~e~sqkYKEGkfILE~~~i~k~-~~~~~~~  116 (119)
                      .|||||+.|||+||||||||||||+++|.+. -+++.++
T Consensus        80 ~~GWkYe~a~e~sQkyKEGk~ilE~~~i~~~~g~~~~~~  118 (122)
T KOG3399|consen   80 GLGWKYEHAYEKSQKYKEGKFILELAEIFKPEGWDLEVG  118 (122)
T ss_pred             CcceeeeeccCchhhhcCcchHHHHHHhcCCCCchhhcC
Confidence            9999999999999999999999999999986 4666554


No 2  
>PF03226 Yippee-Mis18:  Yippee zinc-binding/DNA-binding /Mis18, centromere assembly;  InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes. The first protein in this family to be characterised, the Yippee protein from Drosophila, was identified by yeast interaction trap screen as a protein that physically interacts with moth hemolin []. It was subsequently found to be a member of a highly conserved family of proteins found in diverse eukaryotes including plants, animals and fungi []. Mammals contain five members of this family, YPEL1 to YPEL5, while other organisms tend to contain only two or three members. The mammalian proteins all appear to localise in the nucleus. YPEL1-4 are located in an unknown structure located on or close to the mitotic apparatus in the mitotic phase, whereas in the interphase they are located in the nuclei and nucleoli. In contrast, YPEL5 is localised to the centrosome and nucleus during interphase and at the mitotic spindle during mitosis, suggesting a function distinct from that of YPEL1-4. The localisation of the YPEL proteins suggests a novel, thopugh still unknown, function involved in cell division.
Probab=99.98  E-value=4.9e-33  Score=191.85  Aligned_cols=88  Identities=45%  Similarity=0.940  Sum_probs=84.6

Q ss_pred             EecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeec----EEEeeeeeeeCCCeeeeEEEEeccC
Q 033435           15 YKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGM----HTVEDIFCCCCGQIVGWKYVAAHDK   90 (119)
Q Consensus        15 y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~----H~V~DI~C~~C~~~lGWkY~~A~e~   90 (119)
                      |.|++|++||+++++|+|  |+|+.|+||||+   ||..+++++|.|+||.    |+|+||+|++|++.|||||+.|+++
T Consensus         3 f~C~~C~t~l~ds~~lvs--~~g~~~~a~l~~---~v~~~~~~~~~~~t~~~~~~~~~~~l~C~~C~~~lGwkY~~a~~~   77 (96)
T PF03226_consen    3 FQCKNCKTILADSNELVS--FHGREGKAYLFN---NVSNGVPVDRELMTGETGGDHTVRDLFCSGCNTILGWKYESAPEE   77 (96)
T ss_pred             EECCCCCCCcCCHHHhee--cCCCCccEEEEe---eeeecccccceEEEeeCCCCEEEEEeEcccCChhHCcEEEEcCHh
Confidence            999999999999999999  999999999998   8888889999999999    9999999999999999999999999


Q ss_pred             CcceecCeEEEEeehhhh
Q 033435           91 NQKYKEGKFVLERYRIGK  108 (119)
Q Consensus        91 sqkYKEGkfILE~~~i~k  108 (119)
                       |+||||+||||++.|..
T Consensus        78 -~~~k~g~file~~~i~~   94 (96)
T PF03226_consen   78 -QKYKEGKFILEKASISS   94 (96)
T ss_pred             -HhhhCCEEEEEhhHEEE
Confidence             99999999999998853


No 3  
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=96.38  E-value=0.0019  Score=46.95  Aligned_cols=89  Identities=17%  Similarity=0.143  Sum_probs=61.5

Q ss_pred             EEecCCCCccccCCCCeeeecccc--CCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEEEeccCC
Q 033435           14 YYKCRFCNSHLALADSVLSWSFNC--RRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKN   91 (119)
Q Consensus        14 ~y~C~~C~thLa~~~~lISk~F~G--~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~e~s   91 (119)
                      .+.|++|.+.++..+||-.-.-+.  --.+.  |...+.+...|.+.....-+.+....|+|.+|++.+|-.+..---+=
T Consensus         4 ~llC~kC~~~~C~~~DIr~ie~~hhv~v~p~--F~~~~~~~~~~~~~~~~~~d~~~~~~I~C~~C~~~wG~~m~yk~~~L   81 (123)
T PF11648_consen    4 KLLCRKCKKFACSGSDIRKIENSHHVVVDPE--FWERYIVRPHPKPLQKSFGDWEPNGKIHCKNCGQDWGIMMKYKGVEL   81 (123)
T ss_dssp             EEEETTTTCEEEEGGGEEEETTTEEEE-SHH--HHCTEEEEECSSCTSEEESSSEEEEEEEETSTSBEEEEEEEETTEEE
T ss_pred             EEECCCCCceeEchhheEEecCCcEEEcCcc--ceeeEEeccCCccccceecceEeCCEEEcCCCChHhhhheEECCccc
Confidence            388999999999999987652110  01122  33555566665554445568889999999999999999887665556


Q ss_pred             cceecCeEEEEee
Q 033435           92 QKYKEGKFVLERY  104 (119)
Q Consensus        92 qkYKEGkfILE~~  104 (119)
                      +-.|.-.|+++..
T Consensus        82 P~L~iksfvv~~~   94 (123)
T PF11648_consen   82 PCLKIKSFVVELE   94 (123)
T ss_dssp             EEE-GGGEEEEET
T ss_pred             cEEEeeeeeeeec
Confidence            6777777875543


No 4  
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=94.31  E-value=0.041  Score=40.51  Aligned_cols=70  Identities=20%  Similarity=0.423  Sum_probs=42.8

Q ss_pred             eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEEEecc
Q 033435           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHD   89 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~e   89 (119)
                      -+ |.|+.|+++|=+++.    .|....|=.-.++.+..-.+....|..+  |+. -..|.|.+|+.+||--......
T Consensus        36 G~-Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~v~~~~D~s~--g~~-R~Ev~C~~Cg~HLGHVF~DGp~  105 (124)
T PF01641_consen   36 GI-YVCAVCGTPLFSSDT----KFDSGCGWPSFWQPIPGDAVKEREDFSH--GMV-RTEVRCARCGSHLGHVFDDGPP  105 (124)
T ss_dssp             EE-EEETTTS-EEEEGGG----EETSSSSSSEESSCSSTTSEEEEEEECT--SSE-EEEEEETTTCCEEEEEESTSST
T ss_pred             EE-EEcCCCCCccccCcc----cccCCcCCccccCcCChHHEEEeccccC--Cce-EEEEEecCCCCccccEeCCCCC
Confidence            45 999999999976653    4665566443344333323333333321  443 4579999999999977765544


No 5  
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=94.20  E-value=0.052  Score=40.53  Aligned_cols=67  Identities=15%  Similarity=0.330  Sum_probs=41.5

Q ss_pred             eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEEE
Q 033435           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVA   86 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~   86 (119)
                      -+ |.|+.|+++|=++++    .|....|=.-.++.+-.-.+...+|..  -|+.. ..|.|.+|+.+||--...
T Consensus        39 G~-Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~~V~~~~D~s--~gm~R-tEv~C~~Cg~HLGHVF~D  105 (134)
T TIGR00357        39 GI-YVDITCGEPLFSSED----KFDSGCGWPSFYKPISEEVVAYERDES--HGMIR-TEVRCRNCDAHLGHVFDD  105 (134)
T ss_pred             eE-EEccCCCCccccccc----hhcCCCCCcCcCcccCCCceEEeecCC--CCcEE-EEEEecCCCCccCcccCC
Confidence            45 999999999987765    355555543333444111223333322  24433 589999999999976543


No 6  
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=93.80  E-value=0.053  Score=40.85  Aligned_cols=67  Identities=18%  Similarity=0.376  Sum_probs=41.4

Q ss_pred             eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEEE
Q 033435           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVA   86 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~   86 (119)
                      -+ |.|+.|+++|=++++    .|....|=.-.++.+-.-.+...+|+.  -|+. =..|.|..|+.+||--...
T Consensus        42 G~-Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~V~~~~D~s--~gm~-RtEv~C~~Cg~HLGHVF~D  108 (142)
T PRK00222         42 GI-YVCIVCGEPLFSSDT----KFDSGCGWPSFTKPIDEEAIRELRDTS--HGMV-RTEVRCANCDSHLGHVFPD  108 (142)
T ss_pred             eE-EEecCCCchhcCCcc----cccCCCCCcCcCcccCCCceEEeeccC--CCce-EEEEEeCCCCCccCcccCC
Confidence            45 999999999987743    466666644434443222222223321  1222 2579999999999977654


No 7  
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=92.97  E-value=0.11  Score=38.21  Aligned_cols=63  Identities=19%  Similarity=0.450  Sum_probs=41.8

Q ss_pred             eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEE
Q 033435           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYV   85 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~   85 (119)
                      -+ |.|+.|+++|=++++    .|....|=.-.+..+-| .+...+|..   |  .=..|.|++|+.+||--..
T Consensus        32 G~-Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~-~v~~~~D~~---~--~RtEv~C~~C~~HLGHVF~   94 (119)
T PRK05508         32 GT-YVCKQCGAPLYRSED----KFKSGCGWPSFDDEIKG-AVKRIPDAD---G--RRTEIVCANCGGHLGHVFE   94 (119)
T ss_pred             eE-EEecCCCCccccccc----cccCCCCCcccCccccc-ceEEEecCC---C--cEEEEEeCCCCCccCcccC
Confidence            45 999999999987764    46666664443444433 233344443   2  2467999999999996654


No 8  
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=91.13  E-value=0.18  Score=41.71  Aligned_cols=63  Identities=22%  Similarity=0.453  Sum_probs=41.6

Q ss_pred             eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEE
Q 033435           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYV   85 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~   85 (119)
                      -+ |.|+.|+++|=++++    .|....|=.-.++.+-|-. -..++..   |+  =..|.|.+|+++||--..
T Consensus        35 G~-y~c~~c~~~LF~s~~----Kf~sg~GWPsF~~~~~~~~-~~~~d~~---~~--R~Ev~c~~c~~HLGHvF~   97 (283)
T PRK05550         35 GV-YLCRRCGAPLFRSED----KFNSGCGWPSFDDEIPGAV-KRLPDAD---GR--RTEIVCANCGAHLGHVFE   97 (283)
T ss_pred             cE-EEcCCCCchhcCChh----hccCCCCCcCcCcccCCcc-EEEEcCC---Cc--eEEEEecCCCCccCcccC
Confidence            45 999999999988654    4666666444455554432 2222222   33  488999999999997664


No 9  
>PF14976 FAM72:  FAM72 protein
Probab=90.56  E-value=0.67  Score=35.33  Aligned_cols=61  Identities=34%  Similarity=0.646  Sum_probs=40.8

Q ss_pred             EecCCCCccccCCCCeeeeccccCCceEEEeeccccccc----Cccceeeeeeec--------EEEeeeeeeeCCCeeee
Q 033435           15 YKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIML----GPQEERLMLSGM--------HTVEDIFCCCCGQIVGW   82 (119)
Q Consensus        15 y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~----g~~e~r~m~TG~--------H~V~DI~C~~C~~~lGW   82 (119)
                      ..|+.|.+-|+...           =||.|..+ +|+.+    -||....-.+|.        =.++|+-|..|+..||+
T Consensus        16 L~C~~C~~~l~~Rg-----------MkAvLLad-t~ieLySTD~~P~~~v~~vg~~y~t~~C~C~~~d~aC~~CGn~vGY   83 (150)
T PF14976_consen   16 LCCKFCDQVLCNRG-----------MKAVLLAD-TNIELYSTDIPPTNCVDFVGSCYFTRTCKCKIQDIACLGCGNIVGY   83 (150)
T ss_pred             EECCCCCchhccch-----------hhheeecC-CccEEEecCCCCcccccccccceecccCceEeeeeeeecCCCeeee
Confidence            78999999887643           24666555 44443    123333333343        26999999999999999


Q ss_pred             EEEEe
Q 033435           83 KYVAA   87 (119)
Q Consensus        83 kY~~A   87 (119)
                      -++..
T Consensus        84 hV~~P   88 (150)
T PF14976_consen   84 HVVVP   88 (150)
T ss_pred             EEEEE
Confidence            88754


No 10 
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=89.37  E-value=0.36  Score=42.90  Aligned_cols=82  Identities=9%  Similarity=0.059  Sum_probs=48.7

Q ss_pred             eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEEEecc--
Q 033435           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHD--   89 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~e--   89 (119)
                      -+ |.|+.|+++|=+++    ..|....|=.-.++.+-+-.+...+|..  -|++. ..|.|++|+++||-.......  
T Consensus       417 G~-y~c~~c~~pLf~s~----~Kf~sg~GWPsF~~~i~~~~v~~~~d~s--~g~~R-~Ev~c~~c~~HLGHvf~dgp~~~  488 (521)
T PRK14018        417 GI-YVDVVSGEPLFSSA----DKYDSGCGWPSFTRPIDAKVVTEHDDFS--YNMRR-TEVRSRAADSHLGHVFPDGPRDK  488 (521)
T ss_pred             EE-EEecCCCCccccCc----ccccCCCCCcccCcccCcCceEEeeccC--CCceE-EEEEECCCCCcCCcccCCCCCCC
Confidence            55 99999999998875    3466666643333333222223333322  24443 489999999999987755331  


Q ss_pred             CCcceecCeEEE
Q 033435           90 KNQKYKEGKFVL  101 (119)
Q Consensus        90 ~sqkYKEGkfIL  101 (119)
                      ..++|=.+---|
T Consensus       489 ~g~RyCiNs~~l  500 (521)
T PRK14018        489 GGLRYCINGASL  500 (521)
T ss_pred             CCCEeeeceeEE
Confidence            234554444333


No 11 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=85.06  E-value=1.2  Score=33.60  Aligned_cols=65  Identities=20%  Similarity=0.430  Sum_probs=41.3

Q ss_pred             eeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEE
Q 033435           12 RSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKY   84 (119)
Q Consensus        12 ~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY   84 (119)
                      -+ |.|..|+.+|=++++    .|....|=--.+.-+.+-.+...+|+  .-|++. ..|.|.+|+++||--.
T Consensus        41 Gi-Y~c~~cg~pLF~S~~----KfdSgcGWPSF~~pi~~~~I~~~~D~--S~gM~R-tEVrc~~c~sHLGHVF  105 (140)
T COG0229          41 GI-YVCIVCGEPLFSSED----KFDSGCGWPSFTKPISPDAITYKEDR--SHGMVR-TEVRCANCDSHLGHVF  105 (140)
T ss_pred             ce-EEeecCCCccccccc----cccCCCCCccccccCCcccceEeecc--CCCcEE-EEEEecCCCCcccccc
Confidence            56 999999999977764    45555553333444433334444443  234443 4789999999999543


No 12 
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=81.82  E-value=1.6  Score=33.18  Aligned_cols=67  Identities=19%  Similarity=0.384  Sum_probs=39.1

Q ss_pred             cceeEEecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccceeee-eeecEEEeeeeeeeCCCeeeeEEE
Q 033435           10 KGRSYYKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLM-LSGMHTVEDIFCCCCGQIVGWKYV   85 (119)
Q Consensus        10 ~g~~~y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m-~TG~H~V~DI~C~~C~~~lGWkY~   85 (119)
                      +.-+ |.|..|+++|-+++    ..|....|=--.|+.+ +  .|....+.. .-|.| =.+|.|..|+.+||--.+
T Consensus        51 e~Gv-Y~C~~C~~pLykS~----tKfdsgcGWPAF~e~i-~--~gaI~r~~d~s~~~~-R~Ev~Ca~C~~HLGHVF~  118 (146)
T KOG0856|consen   51 EEGV-YVCAGCGTPLYKST----TKFDSGCGWPAFFEAI-G--PGAITRTPDNSRGGR-RTEVSCATCGGHLGHVFK  118 (146)
T ss_pred             CCce-EEEeecCCcccccc----ccccCCCCCchhhhcc-C--CCceeeccccCCCCc-ceEEEEeecCCceeeeec
Confidence            3366 99999999997764    3466555542223332 1  222111111 11122 458999999999997654


No 13 
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=70.56  E-value=6.6  Score=31.98  Aligned_cols=17  Identities=24%  Similarity=0.456  Sum_probs=13.5

Q ss_pred             EEecCCCCccccCCCCe
Q 033435           14 YYKCRFCNSHLALADSV   30 (119)
Q Consensus        14 ~y~C~~C~thLa~~~~l   30 (119)
                      .+.|++|++.|.....+
T Consensus       106 ~~~C~~C~~~li~~~~~  122 (354)
T PF09814_consen  106 SLCCRNCKNPLIPSRNF  122 (354)
T ss_pred             EEECCCCCCcccCcccc
Confidence            39999999999766543


No 14 
>PRK02935 hypothetical protein; Provisional
Probab=56.51  E-value=8  Score=28.14  Aligned_cols=25  Identities=36%  Similarity=0.623  Sum_probs=21.1

Q ss_pred             ceeEEecCCCCccccCCCCeeeeccc
Q 033435           11 GRSYYKCRFCNSHLALADSVLSWSFN   36 (119)
Q Consensus        11 g~~~y~C~~C~thLa~~~~lISk~F~   36 (119)
                      |++ ..|-+|++||+...++--|.|+
T Consensus        84 Grv-D~CM~C~~PLTLd~~legkefd  108 (110)
T PRK02935         84 GRV-DACMHCNQPLTLDRSLEGKEFD  108 (110)
T ss_pred             cce-eecCcCCCcCCcCccccccCcC
Confidence            477 8999999999999888777664


No 15 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=49.42  E-value=17  Score=23.15  Aligned_cols=47  Identities=15%  Similarity=0.138  Sum_probs=24.7

Q ss_pred             CccceeeeeeecEEEeeeeeeeCCCeeeeEEEEeccCCcceecCeEEEEeehhhh
Q 033435           54 GPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERYRIGK  108 (119)
Q Consensus        54 g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~e~sqkYKEGkfILE~~~i~k  108 (119)
                      |+..-+........+.-.+|.+|++.|.+...        -..+.+.|-...|..
T Consensus        32 g~~~l~~y~~s~~~~~r~FC~~CGs~l~~~~~--------~~~~~~~V~~g~ld~   78 (92)
T PF04828_consen   32 GSENLKEYQFSGKGVERYFCPTCGSPLFSEDE--------RDPDLVGVNAGTLDD   78 (92)
T ss_dssp             -GGGEEEC--TTSSCEEEEETTT--EEEEEES--------STTTEEEEEGGGBTT
T ss_pred             ccccceEEEeCCCcCcCcccCCCCCeeecccC--------CCCCEEEEEeEeeCC
Confidence            44433333323444666999999999997621        123456666555544


No 16 
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=48.91  E-value=21  Score=27.81  Aligned_cols=31  Identities=10%  Similarity=0.153  Sum_probs=18.6

Q ss_pred             cCccceeeeeeecEEEeeeeeeeCCCeeeeEE
Q 033435           53 LGPQEERLMLSGMHTVEDIFCCCCGQIVGWKY   84 (119)
Q Consensus        53 ~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY   84 (119)
                      .|+...+....|.+. .--+|..|++.|-+..
T Consensus        73 ~G~~~l~~Y~ss~~~-~R~FC~~CGS~L~~~~  103 (182)
T TIGR02820        73 ANGDKLKVVDASATI-QRHACKGCGTHMYGRI  103 (182)
T ss_pred             cCCcceEEEeCCCCE-EeecCCCCCCcccccc
Confidence            354443333334444 4449999999996654


No 17 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=43.86  E-value=9.9  Score=27.83  Aligned_cols=26  Identities=31%  Similarity=0.518  Sum_probs=21.5

Q ss_pred             ceeEEecCCCCccccCCCCeeeecccc
Q 033435           11 GRSYYKCRFCNSHLALADSVLSWSFNC   37 (119)
Q Consensus        11 g~~~y~C~~C~thLa~~~~lISk~F~G   37 (119)
                      |+. ..|-+|++||+...++--|.|+-
T Consensus        83 Gr~-D~CM~C~~pLTLd~~legkef~~  108 (114)
T PF11023_consen   83 GRV-DACMHCKEPLTLDPSLEGKEFDE  108 (114)
T ss_pred             chh-hccCcCCCcCccCchhhcchhhH
Confidence            366 78999999999999988777753


No 18 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=41.28  E-value=15  Score=21.39  Aligned_cols=27  Identities=22%  Similarity=0.337  Sum_probs=22.3

Q ss_pred             eeeeeeeCCCee-eeEEEEeccCCccee
Q 033435           69 EDIFCCCCGQIV-GWKYVAAHDKNQKYK   95 (119)
Q Consensus        69 ~DI~C~~C~~~l-GWkY~~A~e~sqkYK   95 (119)
                      .||.|..|++.- --|.-+.-.-.|+|.
T Consensus         4 i~v~CP~C~s~~~v~k~G~~~~G~qryr   31 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGKSPSGHQRYR   31 (36)
T ss_pred             EeeeCCCCCCCCcceeCCCCCCCCEeEe
Confidence            489999999988 778877777788875


No 19 
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=40.59  E-value=29  Score=27.13  Aligned_cols=40  Identities=13%  Similarity=0.027  Sum_probs=26.0

Q ss_pred             EEEeeeeeeeCCCeeeeEEEEeccCCcceecCeEEEEeehhhhh
Q 033435           66 HTVEDIFCCCCGQIVGWKYVAAHDKNQKYKEGKFVLERYRIGKY  109 (119)
Q Consensus        66 H~V~DI~C~~C~~~lGWkY~~A~e~sqkYKEGkfILE~~~i~k~  109 (119)
                      ..+.--+|..|++.|-+..+..-.+    -.|..+|-...+...
T Consensus        89 ~~i~R~FC~~CGS~L~~~~e~~~~~----~pgl~fV~~gllDd~  128 (191)
T PRK05417         89 ATIQRHACKECGVHMYGRIENKDHP----FYGLDFVHTELSQEQ  128 (191)
T ss_pred             CCeEeeeCCCCCCccccccccccCC----CCCeEEEehhhcCCC
Confidence            3355569999999998887632111    237777776666544


No 20 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=38.87  E-value=26  Score=19.80  Aligned_cols=19  Identities=26%  Similarity=0.693  Sum_probs=12.7

Q ss_pred             eeeeeecc-eeEEecCCCCcc
Q 033435            4 IFLVELKG-RSYYKCRFCNSH   23 (119)
Q Consensus         4 ~f~~yl~g-~~~y~C~~C~th   23 (119)
                      .-+.|..| +. +.|+.|++.
T Consensus         9 t~L~yP~gA~~-vrCs~C~~v   28 (31)
T TIGR01053         9 TLLMYPRGASS-VRCALCQTV   28 (31)
T ss_pred             cEeecCCCCCe-EECCCCCeE
Confidence            34567777 55 888888764


No 21 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=34.97  E-value=20  Score=24.38  Aligned_cols=17  Identities=29%  Similarity=0.761  Sum_probs=13.7

Q ss_pred             eEEecCCCCccccCCCC
Q 033435           13 SYYKCRFCNSHLALADS   29 (119)
Q Consensus        13 ~~y~C~~C~thLa~~~~   29 (119)
                      +.|.|++|++.+..-+.
T Consensus         3 i~Y~CRHCg~~IG~i~~   19 (76)
T PF10955_consen    3 IHYYCRHCGTKIGTIDA   19 (76)
T ss_pred             eEEEecCCCCEEEEeec
Confidence            35999999999876554


No 22 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=32.60  E-value=35  Score=18.58  Aligned_cols=19  Identities=32%  Similarity=0.758  Sum_probs=13.5

Q ss_pred             ceeeeeecc-eeEEecCCCCc
Q 033435            3 RIFLVELKG-RSYYKCRFCNS   22 (119)
Q Consensus         3 r~f~~yl~g-~~~y~C~~C~t   22 (119)
                      |..+.|..| +. -.|+.|++
T Consensus         5 r~~L~yp~GA~s-VrCa~C~~   24 (25)
T PF06943_consen    5 RTLLMYPRGAPS-VRCACCHT   24 (25)
T ss_pred             CceEEcCCCCCC-eECCccCc
Confidence            455677777 65 78888875


No 23 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=31.40  E-value=37  Score=21.29  Aligned_cols=10  Identities=40%  Similarity=1.085  Sum_probs=9.2

Q ss_pred             EecCCCCccc
Q 033435           15 YKCRFCNSHL   24 (119)
Q Consensus        15 y~C~~C~thL   24 (119)
                      |.|..|+..+
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            9999999888


No 24 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=30.43  E-value=30  Score=20.47  Aligned_cols=14  Identities=36%  Similarity=0.764  Sum_probs=12.0

Q ss_pred             EecCCCCccccCCC
Q 033435           15 YKCRFCNSHLALAD   28 (119)
Q Consensus        15 y~C~~C~thLa~~~   28 (119)
                      |.|..|+.+|...+
T Consensus        27 f~C~~C~~~l~~~~   40 (58)
T PF00412_consen   27 FKCSKCGKPLNDGD   40 (58)
T ss_dssp             SBETTTTCBTTTSS
T ss_pred             cccCCCCCccCCCe
Confidence            88999999987766


No 25 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=28.19  E-value=12  Score=18.51  Aligned_cols=16  Identities=25%  Similarity=0.796  Sum_probs=12.2

Q ss_pred             EecCCCCccccCCCCe
Q 033435           15 YKCRFCNSHLALADSV   30 (119)
Q Consensus        15 y~C~~C~thLa~~~~l   30 (119)
                      |.|..|+....+.++|
T Consensus         1 y~C~~C~~~f~~~~~l   16 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNL   16 (23)
T ss_dssp             EEETTTTEEESSHHHH
T ss_pred             CCCCCCCCccCCHHHH
Confidence            7899998887766554


No 26 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=27.05  E-value=28  Score=20.05  Aligned_cols=14  Identities=29%  Similarity=0.646  Sum_probs=7.2

Q ss_pred             eeeeCCCeeeeEEE
Q 033435           72 FCCCCGQIVGWKYV   85 (119)
Q Consensus        72 ~C~~C~~~lGWkY~   85 (119)
                      ||.+|++.|-++..
T Consensus         2 fC~~CG~~l~~~ip   15 (34)
T PF14803_consen    2 FCPQCGGPLERRIP   15 (34)
T ss_dssp             B-TTT--B-EEE--
T ss_pred             ccccccChhhhhcC
Confidence            79999999988876


No 27 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=26.99  E-value=19  Score=22.63  Aligned_cols=39  Identities=15%  Similarity=0.355  Sum_probs=25.9

Q ss_pred             eecccccccCccceeeeeeecEEEeeeeeeeCCCeeeeEEEEec
Q 033435           45 FSDVVNIMLGPQEERLMLSGMHTVEDIFCCCCGQIVGWKYVAAH   88 (119)
Q Consensus        45 f~~vvNv~~g~~e~r~m~TG~H~V~DI~C~~C~~~lGWkY~~A~   88 (119)
                      |++++++..|..+     |+...--.+-|++|.++=|---..++
T Consensus         2 ~Dki~d~L~G~d~-----~~~~~r~aLIC~~C~~hNGla~~~~~   40 (54)
T PF10058_consen    2 FDKILDVLLGDDP-----TSPSNRYALICSKCFSHNGLAPKEEF   40 (54)
T ss_pred             hHHHHHHHhCCCC-----ccccCceeEECcccchhhcccccccC
Confidence            5678888888766     33333444569999999887543333


No 28 
>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism]
Probab=25.33  E-value=50  Score=29.85  Aligned_cols=43  Identities=23%  Similarity=0.315  Sum_probs=32.6

Q ss_pred             ccCCCCeeeeccccCCceEEEeecccccccCccceeeeeeec--EEEeeeeeeeCCCeeeeEE
Q 033435           24 LALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEERLMLSGM--HTVEDIFCCCCGQIVGWKY   84 (119)
Q Consensus        24 La~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~--H~V~DI~C~~C~~~lGWkY   84 (119)
                      ++-..|.+++.|.|..||++                  .||.  -.+.--+|.+|.+++|.-.
T Consensus       200 ~~IN~D~~~~~~dGd~~ryv------------------YtGtiGKLLp~f~vvG~etHvG~~f  244 (553)
T COG4187         200 AAINLDVTSDQGDGDQGRYV------------------YTGTIGKLLPFFFVVGCETHVGYPF  244 (553)
T ss_pred             EEeccccccCCCCCccceEE------------------EeccchhhcceeEEEeeccccCCcc
Confidence            34567888999999999875                  4554  4567788999999999654


No 29 
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=25.25  E-value=56  Score=23.53  Aligned_cols=22  Identities=23%  Similarity=0.495  Sum_probs=16.8

Q ss_pred             EEEeeeeeeeCCCeeeeEEEEe
Q 033435           66 HTVEDIFCCCCGQIVGWKYVAA   87 (119)
Q Consensus        66 H~V~DI~C~~C~~~lGWkY~~A   87 (119)
                      +.+.-.+|..|+++|-|+....
T Consensus        65 ~~~~r~FC~~CGs~l~~~~~~~   86 (133)
T COG3791          65 GSAGRGFCPTCGSPLFWRGPDE   86 (133)
T ss_pred             CCCCCeecccCCCceEEecCCC
Confidence            3444459999999999997554


No 30 
>TIGR00037 eIF_5A translation initiation factor eIF-5A. Observed in eukaryotes and archaea.
Probab=24.98  E-value=85  Score=22.84  Aligned_cols=30  Identities=20%  Similarity=0.118  Sum_probs=25.3

Q ss_pred             ccCCceEEEeecccccccCccceeeeeeec
Q 033435           36 NCRRGRAYLFSDVVNIMLGPQEERLMLSGM   65 (119)
Q Consensus        36 ~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~   65 (119)
                      +|+||.|+.--.+.|+..|...+..+.++-
T Consensus        35 pGkhG~A~vr~k~knl~tG~~~e~~f~s~~   64 (130)
T TIGR00037        35 PGKHGHAKARVVAIGIFTGKKLEFVSPSTS   64 (130)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEECCCC
Confidence            799999999889999999998777666554


No 31 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=23.63  E-value=32  Score=18.25  Aligned_cols=11  Identities=36%  Similarity=0.960  Sum_probs=9.8

Q ss_pred             EecCCCCcccc
Q 033435           15 YKCRFCNSHLA   25 (119)
Q Consensus        15 y~C~~C~thLa   25 (119)
                      |.|..|+..|+
T Consensus        28 f~C~~C~~~L~   38 (39)
T smart00132       28 FKCSKCGKPLG   38 (39)
T ss_pred             CCCcccCCcCc
Confidence            89999999886


No 32 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=23.48  E-value=9.2  Score=26.00  Aligned_cols=16  Identities=25%  Similarity=0.675  Sum_probs=14.8

Q ss_pred             EeeeeeeeCCCeeeeE
Q 033435           68 VEDIFCCCCGQIVGWK   83 (119)
Q Consensus        68 V~DI~C~~C~~~lGWk   83 (119)
                      ||-+-|..|++.+|+-
T Consensus        50 vRGlLC~~CN~~lG~~   65 (81)
T PF02945_consen   50 VRGLLCRSCNTALGKV   65 (81)
T ss_dssp             EEEEEEHHHHHHHHHC
T ss_pred             chhhhhhHHhhhhccc
Confidence            9999999999999975


No 33 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=23.22  E-value=61  Score=18.16  Aligned_cols=15  Identities=27%  Similarity=0.711  Sum_probs=12.2

Q ss_pred             eEEecCCCCccccCC
Q 033435           13 SYYKCRFCNSHLALA   27 (119)
Q Consensus        13 ~~y~C~~C~thLa~~   27 (119)
                      +.|.|..|..+|...
T Consensus        15 T~~~C~~C~v~lC~~   29 (32)
T PF13842_consen   15 TRYMCSKCDVPLCVE   29 (32)
T ss_pred             eEEEccCCCCcccCC
Confidence            449999999988764


No 34 
>PF10246 MRP-S35:  Mitochondrial ribosomal protein MRP-S35;  InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This is a family of short mitochondrial ribosomal proteins, less than 200 amino acids long. MRP-S35 was proposed as a more appropriate name to this group of proteins [].
Probab=23.22  E-value=48  Score=23.93  Aligned_cols=51  Identities=27%  Similarity=0.382  Sum_probs=31.7

Q ss_pred             EeecccccccCccceeeeeeec--EEEeeeeeeeCCCeeeeEEE----EeccCCcceecCeE
Q 033435           44 LFSDVVNIMLGPQEERLMLSGM--HTVEDIFCCCCGQIVGWKYV----AAHDKNQKYKEGKF   99 (119)
Q Consensus        44 Lf~~vvNv~~g~~e~r~m~TG~--H~V~DI~C~~C~~~lGWkY~----~A~e~sqkYKEGkf   99 (119)
                      |+++--=+..|+++++. ++|.  |+|.|--=    --.|||..    +.-.++++|.+|-=
T Consensus        10 lLR~S~fi~lG~~~gk~-V~G~I~hvv~ddLY----IDfG~KFhcVc~rp~~~~~~y~~G~r   66 (104)
T PF10246_consen   10 LLRNSPFIQLGDPEGKI-VIGKIFHVVDDDLY----IDFGGKFHCVCKRPAVNGEKYVRGSR   66 (104)
T ss_pred             HhcCChhhhcCCccCCE-EEEEEEEEecCceE----EEeCCceeEEEecccccccccccCCE
Confidence            34444445679988865 6666  87776211    23588864    34457788999853


No 35 
>PLN03107 eukaryotic translation initiation factor 5A; Provisional
Probab=22.05  E-value=1e+02  Score=23.40  Aligned_cols=36  Identities=19%  Similarity=0.281  Sum_probs=28.3

Q ss_pred             ccCCceEEEeecccccccCccceeeeeeecEE-Eeee
Q 033435           36 NCRRGRAYLFSDVVNIMLGPQEERLMLSGMHT-VEDI   71 (119)
Q Consensus        36 ~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~H~-V~DI   71 (119)
                      +|+||.|+.--.+.|+..|...+....++--. +.+|
T Consensus        49 pGKHG~A~vr~k~knl~TG~k~e~~f~s~~~ve~~~v   85 (159)
T PLN03107         49 TGKHGHAKCHFVAIDIFTGKKLEDIVPSSHNCDVPHV   85 (159)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCCEEEEEEE
Confidence            79999999988999999999888777665532 4444


No 36 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=22.04  E-value=26  Score=18.55  Aligned_cols=11  Identities=36%  Similarity=0.872  Sum_probs=6.2

Q ss_pred             eeeeeeCCCee
Q 033435           70 DIFCCCCGQIV   80 (119)
Q Consensus        70 DI~C~~C~~~l   80 (119)
                      +-+|.+|++.|
T Consensus        16 ~~fC~~CG~~L   26 (26)
T PF13248_consen   16 AKFCPNCGAKL   26 (26)
T ss_pred             cccChhhCCCC
Confidence            45566666543


No 37 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=20.96  E-value=1.3e+02  Score=21.32  Aligned_cols=43  Identities=14%  Similarity=0.273  Sum_probs=32.0

Q ss_pred             EecCCCCccccCCCCeeeeccccCCceEEEeecccccccCccce
Q 033435           15 YKCRFCNSHLALADSVLSWSFNCRRGRAYLFSDVVNIMLGPQEE   58 (119)
Q Consensus        15 y~C~~C~thLa~~~~lISk~F~G~~G~AyLf~~vvNv~~g~~e~   58 (119)
                      =.|.+|+..=.-...++++.+.++. ..+...+-.|...|+..+
T Consensus        17 saC~~C~~~~~Cg~~~~~~~~~~~~-~~~~~~~~~~~~~GD~V~   59 (135)
T PF04246_consen   17 SACGSCSASGGCGTGLLAKLFSGKP-ITFRAPNPIGAKVGDRVE   59 (135)
T ss_pred             CcCcccCCCCCCCcchhhhhcCCCc-EEEEecCCCCCCCCCEEE
Confidence            4688888766667778888888877 566667777888887644


No 38 
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=20.33  E-value=52  Score=20.79  Aligned_cols=12  Identities=33%  Similarity=0.927  Sum_probs=10.0

Q ss_pred             eeeeCCCeeeeE
Q 033435           72 FCCCCGQIVGWK   83 (119)
Q Consensus        72 ~C~~C~~~lGWk   83 (119)
                      +|.+|+..||-+
T Consensus        54 ~Cp~C~~~lg~~   65 (67)
T smart00714       54 YCPNCGAFLGTY   65 (67)
T ss_pred             ECCCCCCEeEEe
Confidence            599999999853


No 39 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=20.29  E-value=66  Score=24.58  Aligned_cols=32  Identities=22%  Similarity=0.391  Sum_probs=25.9

Q ss_pred             eeecceeEEecCCCCccccCCCCeeeeccccCC
Q 033435            7 VELKGRSYYKCRFCNSHLALADSVLSWSFNCRR   39 (119)
Q Consensus         7 ~yl~g~~~y~C~~C~thLa~~~~lISk~F~G~~   39 (119)
                      .-++.+. |-|..|+.+=+...-|+.-.|....
T Consensus       114 ~~vsprR-YfCtQCHVPQada~PLV~N~F~~~~  145 (149)
T PRK11586        114 AEVAPRR-YFCLQCHVPQADTAPIVGNTFTPSK  145 (149)
T ss_pred             cccCccc-eeeccccCccccCccCCCCCccchh
Confidence            3344566 9999999999999999999887544


No 40 
>PRK03999 translation initiation factor IF-5A; Provisional
Probab=20.13  E-value=1.2e+02  Score=22.01  Aligned_cols=31  Identities=13%  Similarity=0.036  Sum_probs=24.7

Q ss_pred             cccCCceEEEeecccccccCccceeeeeeec
Q 033435           35 FNCRRGRAYLFSDVVNIMLGPQEERLMLSGM   65 (119)
Q Consensus        35 F~G~~G~AyLf~~vvNv~~g~~e~r~m~TG~   65 (119)
                      =+|+||.|+.--.+.|+..|...++...++-
T Consensus        33 kpGkhg~a~vr~k~knL~tG~~~e~~~~s~d   63 (129)
T PRK03999         33 KPGKHGSAKARIVAIGIFDGQKRSLVQPVDA   63 (129)
T ss_pred             cCCCCCcEEEEEEEEECCCCCEEEEEecCCC
Confidence            3788899998889999999987766665554


Done!