Citrus Sinensis ID: 033439


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MGEGEECVELKFRIYDGTDICHGTYASSTTVATLKQQLVAEWPQGKTITPKSINDVKLIHAGKILENDRTLADSRITVGDLPSGVTTMHVVIQPLVAKKKTEKTKEEMQKQNSCACIIL
cccccEEEEEEEEECcccccccccccccccHHHHHHHHHHcccccccccccccccEEEEEccCEEccccccccccccccccccccEEEEEEEcccccccccHHHHHHcccccccEEEEc
*****ECVELKFRIYDGTDICHGTYASSTTVATLKQQLVAEWPQGKTITPKSINDVKLIHAGKILENDRTLADSRITVGDLPSGVTTMHVVIQPLV****************SCACIIL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEGEECVELKFRIYDGTDICHGTYASSTTVATLKQQLVAEWPQGKTITPKSINDVKLIHAGKILENDRTLADSRITVGDLPSGVTTMHVVIQPLVAKKKTEKTKEEMQKQNSCACIIL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Membrane-anchored ubiquitin-fold protein 3 May serve as docking site to facilitate the association of other proteins to the plasma membrane.probableQ6Z8K4
Membrane-anchored ubiquitin-fold protein 3 May serve as docking site to facilitate the association of other proteins to the plasma membrane.probableQ9SW27

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SE9, chain A
Confidence level:very confident
Coverage over the Query: 3-103
View the alignment between query and template
View the model in PyMOL