BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033451
         (119 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4EG9|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of Se-Methionine
           Hypothetical Protein Saouhsc_02783 From Staphylococcus
           Aureus
          Length = 260

 Score = 25.4 bits (54), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 22/55 (40%)

Query: 60  DSADWALGKQGVEKPKGPLEALRPKLQPTQQQTRYRKSPYAPAGGEDGGSAPPED 114
           D   W +  + V +PKG     R  +    + TR  K  Y  +   D  +  P+D
Sbjct: 66  DKGTWIVNSEXVIEPKGKDXETRGXVLYINRNTRTTKGYYFISEXTDDSNGRPKD 120


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.305    0.128    0.373 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,922,521
Number of Sequences: 62578
Number of extensions: 147286
Number of successful extensions: 96
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 95
Number of HSP's gapped (non-prelim): 1
length of query: 119
length of database: 14,973,337
effective HSP length: 81
effective length of query: 38
effective length of database: 9,904,519
effective search space: 376371722
effective search space used: 376371722
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 45 (21.9 bits)