Query 033451
Match_columns 119
No_of_seqs 105 out of 200
Neff 3.6
Searched_HMMs 46136
Date Fri Mar 29 14:02:41 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033451.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033451hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF04667 Endosulfine: cAMP-reg 99.9 2E-26 4.3E-31 161.5 6.4 81 22-102 1-85 (86)
2 KOG4076 Regulator of ATP-sensi 99.9 7.9E-24 1.7E-28 157.0 4.7 80 23-102 26-112 (121)
3 COG3733 TynA Cu2+-containing a 32.8 14 0.0003 34.6 -0.1 15 56-70 316-330 (654)
4 PF10802 DUF2540: Protein of u 27.2 33 0.00072 24.0 1.0 16 27-42 46-61 (75)
5 PF01179 Cu_amine_oxid: Copper 23.1 25 0.00053 30.8 -0.3 17 56-72 73-89 (413)
6 PF00524 PPV_E1_N: E1 Protein, 21.7 83 0.0018 23.5 2.3 12 34-45 77-88 (130)
7 cd07756 CYTH-like_Pase_CHAD Un 21.6 42 0.00091 26.1 0.7 17 56-72 37-53 (197)
8 TIGR03373 VI_minor_4 type VI s 19.5 53 0.0011 24.5 0.9 15 39-53 3-17 (136)
9 cd07374 CYTH-like_Pase CYTH-li 17.5 52 0.0011 24.0 0.4 17 56-72 36-52 (174)
10 PF09867 DUF2094: Uncharacteri 16.9 45 0.00098 24.6 -0.0 15 39-53 3-17 (138)
No 1
>PF04667 Endosulfine: cAMP-regulated phosphoprotein/endosulfine conserved region; InterPro: IPR006760 This endosulphine family includes cAMP-regulated phosphoprotein 19 (ARPP-19), alpha endosulphine and protein Igo1. No function has yet been assigned to ARPP-19 []. Endosulphine is the endogenous ligand for the ATP-dependent potassium channels which occupy a key position in the control of insulin release from the pancreatic beta cell by coupling cell polarity to metabolism []. Igo1 is required for initiation of G0 program. In the absence of stimulatory signals, cells may enter into a reversible quiescence (or G0) state that is typically characterised by low metabolic activity, including low rates of protein synthesis and transcription. Igo proteins associate with the mRNA decapping activator Dhh1, sheltering newly expressed mRNAs from degradation via the 5'-3' mRNA decay pathway, and thereby enabling their proper translation during initiation of the G0 program [].
Probab=99.93 E-value=2e-26 Score=161.50 Aligned_cols=81 Identities=40% Similarity=0.573 Sum_probs=71.5
Q ss_pred CCCCCCcHHHHHHHHHHhCCCCCCCCccccccccCccccchhhhhhhcCCCCCCC--CcccCCCCCCCCC--CcCCCCCC
Q 033451 22 QKTMPSSEEEEAALKKKYGGIVPKKPPLISKDHERAYFDSADWALGKQGVEKPKG--PLEALRPKLQPTQ--QQTRYRKS 97 (119)
Q Consensus 22 ~~~~~~~~~eE~kL~~KYG~L~~Kk~~L~~k~keRKYFDSgDyam~Kag~~~~~~--pie~L~pkl~PTp--q~lp~Rk~ 97 (119)
+++++++++||++|++|||+|++++.+|++|+++|||||||||||+||++.+... ++..+.+.+.+|+ .+++.|++
T Consensus 1 ~~~~~~~~~eE~kl~~kYG~l~~~~~~L~kkl~~rKYFDSgDyam~Ka~~~~~~~~~~~~~~~~~~~~p~~v~~~~~~~~ 80 (86)
T PF04667_consen 1 QVDISSLSEEEAKLKAKYGKLPPKKKLLQKKLQKRKYFDSGDYAMAKAGKKSSQGPGPTGKLPPPLPNPPHVSQSIPRRP 80 (86)
T ss_pred CcccccccHHHHHHHHHcCCCCCCchhhhhhhccccccchHHHHHHHhhcccccCcCcCcCCCCCCCCCcccccccCCCC
Confidence 3688999999999999999999999899999999999999999999999986554 5677888888888 58888988
Q ss_pred CcccC
Q 033451 98 PYAPA 102 (119)
Q Consensus 98 s~~~~ 102 (119)
.|.+.
T Consensus 81 ~~~s~ 85 (86)
T PF04667_consen 81 TTTSP 85 (86)
T ss_pred CCCCC
Confidence 88764
No 2
>KOG4076 consensus Regulator of ATP-sensitive K+ channels Alpha-endosulfine/ARPP-19 and related cAMP-regulated phosphoproteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=99.89 E-value=7.9e-24 Score=157.00 Aligned_cols=80 Identities=23% Similarity=0.285 Sum_probs=65.4
Q ss_pred CCCCCcHHHHHHHHHHhCCCCCCCCcccccc-ccCccccchhhhhhhcCCCCCCCCc----c-cC-CCCCCCCCCcCCCC
Q 033451 23 KTMPSSEEEEAALKKKYGGIVPKKPPLISKD-HERAYFDSADWALGKQGVEKPKGPL----E-AL-RPKLQPTQQQTRYR 95 (119)
Q Consensus 23 ~~~~~~~~eE~kL~~KYG~L~~Kk~~L~~k~-keRKYFDSgDyam~Kag~~~~~~pi----e-~L-~pkl~PTpq~lp~R 95 (119)
.+...+.++|.+++..||+||.+++||.||+ ++|||||||||||+||++.+..++. . .+ ++.+|||++++|.|
T Consensus 26 ~~ek~~epkl~~ky~~~GklP~~sd~l~krlQkgrKyFDSGDYam~KAk~~~~~~~~~~~~k~~~~t~~~~~~~e~~p~r 105 (121)
T KOG4076|consen 26 SPEKKEEPKLKKKYPSYGKLPGGSDFLRKRLQKGRKYFDSGDYAMAKAKMKNKQLPTANPDKNNLPTGDHIPTPEDLPAR 105 (121)
T ss_pred ChhhhhCHHHHHHHHHhCCCCcccHHHHHHHHhcccccccchHHHHHhhcccccCCccccccCCCCCCCCCcCccccccc
Confidence 3444455555566666899999999999998 5699999999999999999877654 1 34 78999999999999
Q ss_pred CCCcccC
Q 033451 96 KSPYAPA 102 (119)
Q Consensus 96 k~s~~~~ 102 (119)
++|+++.
T Consensus 106 k~S~~s~ 112 (121)
T KOG4076|consen 106 KPSLVSP 112 (121)
T ss_pred cccccCC
Confidence 9998885
No 3
>COG3733 TynA Cu2+-containing amine oxidase [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=32.82 E-value=14 Score=34.56 Aligned_cols=15 Identities=33% Similarity=0.665 Sum_probs=12.0
Q ss_pred CccccchhhhhhhcC
Q 033451 56 RAYFDSADWALGKQG 70 (119)
Q Consensus 56 RKYFDSgDyam~Kag 70 (119)
+.+||+|||.|+.-.
T Consensus 316 K~~fD~GeYglG~l~ 330 (654)
T COG3733 316 KNAFDSGEYGLGTLT 330 (654)
T ss_pred hhcccccccCccccc
Confidence 359999999888743
No 4
>PF10802 DUF2540: Protein of unknown function (DUF2540); InterPro: IPR024254 This family of proteins with unknown function appears to be restricted to Methanococcus.; PDB: 2EFV_A.
Probab=27.15 E-value=33 Score=24.01 Aligned_cols=16 Identities=31% Similarity=0.557 Sum_probs=12.2
Q ss_pred CcHHHHHHHHHHhCCC
Q 033451 27 SSEEEEAALKKKYGGI 42 (119)
Q Consensus 27 ~~~~eE~kL~~KYG~L 42 (119)
..+.+|+++..|||+.
T Consensus 46 tLs~~E~~IieKyGKa 61 (75)
T PF10802_consen 46 TLSDEEEKIIEKYGKA 61 (75)
T ss_dssp E--HHHHHHHHHHGGG
T ss_pred EecHHHHHHHHHHhHH
Confidence 4678999999999963
No 5
>PF01179 Cu_amine_oxid: Copper amine oxidase, enzyme domain; InterPro: IPR015798 Amine oxidases (AO) are enzymes that catalyse the oxidation of a wide range of biogenic amines including many neurotransmitters, histamine and xenobiotic amines. There are two classes of amine oxidases: flavin-containing (1.4.3.4 from EC) and copper-containing (1.4.3.6 from EC). Copper-containing AO act as a disulphide-linked homodimer. They catalyse the oxidation of primary amines to aldehydes, with the subsequent release of ammonia and hydrogen peroxide, which requires one copper ion per subunit and topaquinone as cofactor []: RCH2NH2 + H2O + O2 = RCHO + NH3 + H2O2 Copper-containing amine oxidases are found in bacteria, fungi, plants and animals. In prokaryotes, the enzyme enables various amine substrates to be used as sources of carbon and nitrogen [, ]. In eukaryotes they have a broader range of functions, including cell differentiation and growth, wound healing, detoxification and cell signalling []. The copper amine oxidases occur as mushroom-shaped homodimers of 70-95 kDa, each monomer containing a copper ion and a covalently bound redox cofactor, topaquinone (TPQ). TPQ is formed by post-translational modification of a conserved tyrosine residue. The copper ion is coordinated with three histidine residues and two water molecules in a distorted square pyramidal geometry, and has a dual function in catalysis and TPQ biogenesis. The catalytic domain is the largest of the 3-4 domains found in copper amine oxidases, and consists of a beta sandwich of 18 strands in two sheets. The active site is buried and requires a conformational change to allow the substrate access. The two N-terminal domains share a common structural fold, its core consisting of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the stalk, of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other [, ]. This entry represents the C-terminal catalytic domain of copper amine oxidases, and has a super-sandwich fold consisting of 18 beta-strands in 2 sheets []. A domain with a similar structural fold can be found as the third domain in lysyl oxidase PplO [].; GO: 0005507 copper ion binding, 0008131 primary amine oxidase activity, 0048038 quinone binding, 0009308 amine metabolic process, 0055114 oxidation-reduction process; PDB: 1US1_A 2C11_B 3ALA_E 2Y73_B 2C10_B 1PU4_B 2Y74_B 1W2Z_D 1KSI_B 1RKY_A ....
Probab=23.14 E-value=25 Score=30.76 Aligned_cols=17 Identities=29% Similarity=0.591 Sum_probs=12.6
Q ss_pred CccccchhhhhhhcCCC
Q 033451 56 RAYFDSADWALGKQGVE 72 (119)
Q Consensus 56 RKYFDSgDyam~Kag~~ 72 (119)
+.|||+|||-|+.....
T Consensus 73 ~~~~D~geyG~G~~~~~ 89 (413)
T PF01179_consen 73 KNAFDSGEYGLGSMANS 89 (413)
T ss_dssp -EEEHHHHTTTTTTBE-
T ss_pred cccccccccccCccccc
Confidence 57999999988876543
No 6
>PF00524 PPV_E1_N: E1 Protein, N terminal domain; InterPro: IPR014000 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species. The helicase E1 protein is an ATP-dependent DNA helicase required for initiation of viral DNA replication []. It forms a complex with the viral E2 protein, which is a site-specific DNA-binding transcriptional activator. The E1-E2 complex binds to the replication origin which contains binding sites for both proteins []. The E1 protein is a 70 kDa polypeptide with a centrally-located DNA-binding domain and a C-terminal ATPase/helicase domain. It binds specific 18 bp DNA sequences at the origin of replication, melts the DNA duplex and functions as a 3' to 5' helicase []. In addition to E2 it also interacts with DNA polymerase alpha and replication protein A to effect DNA replication. The DNA-binding domain forms a five-stranded antiparallel beta sheet bordered by four loosely packed alpha helices on one side and two tightly packed helices on the other []. Two structural modules within this domain, an extended loop and a helix, contain conserved residues and are critical for DNA binding. In solution E1 is a monomer, but binds DNA as a dimer. Recruitment of more E1 subunits to the complex leads to melting of the origin and ultimately to the formation of an E1 hexamer with helicase activity []. This entry represents the N-terminal region of E1, which contains the nuclear localisation signal.; GO: 0016817 hydrolase activity, acting on acid anhydrides
Probab=21.67 E-value=83 Score=23.55 Aligned_cols=12 Identities=50% Similarity=0.595 Sum_probs=8.3
Q ss_pred HHHHHhCCCCCC
Q 033451 34 ALKKKYGGIVPK 45 (119)
Q Consensus 34 kL~~KYG~L~~K 45 (119)
.||+||-.=|..
T Consensus 77 ~LKRK~~~SP~~ 88 (130)
T PF00524_consen 77 ALKRKYLGSPKS 88 (130)
T ss_pred HHHHHHcCCccc
Confidence 499999764433
No 7
>cd07756 CYTH-like_Pase_CHAD Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain. This subgroup belongs to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily. Members of this superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). A number of proteins in this subgroup also contain a C-terminal CHAD (Conserved Histidine Alpha-helical Domain) domain which may participate in metal chelation or act as a phosphor-acceptor. The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosp
Probab=21.56 E-value=42 Score=26.06 Aligned_cols=17 Identities=41% Similarity=0.858 Sum_probs=15.1
Q ss_pred CccccchhhhhhhcCCC
Q 033451 56 RAYFDSADWALGKQGVE 72 (119)
Q Consensus 56 RKYFDSgDyam~Kag~~ 72 (119)
--|||..|+.|.+++..
T Consensus 37 ~~YfDTpd~~L~~~~~a 53 (197)
T cd07756 37 NTYFDTPDLALRRAGIA 53 (197)
T ss_pred eeeeeCcChHHHhCCCE
Confidence 47999999999999875
No 8
>TIGR03373 VI_minor_4 type VI secretion-associated protein, BMA_A0400 family. Members of this protein family are found exclusively, although not universally, in bacterial species that possess a type VI secretion system. Genes are found in type VI secretion-associated gene clusters. The specific function is unknown. This model represents the rather well-conserved amino-terminal domain of a protein family in which carboxy-terminal regions, when present, show little conservation.
Probab=19.46 E-value=53 Score=24.49 Aligned_cols=15 Identities=7% Similarity=0.093 Sum_probs=13.1
Q ss_pred hCCCCCCCCcccccc
Q 033451 39 YGGIVPKKPPLISKD 53 (119)
Q Consensus 39 YG~L~~Kk~~L~~k~ 53 (119)
||+||.+.+|+..++
T Consensus 3 fGKlPa~GDFv~~~l 17 (136)
T TIGR03373 3 FGKLPARGDFVKRAL 17 (136)
T ss_pred cCCCCCCcchhhcCC
Confidence 999999999887666
No 9
>cd07374 CYTH-like_Pase CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases. CYTH-like superfamily enzymes hydrolyze triphosphate-containing substrates and require metal cations as cofactors. They have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB), and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions.
Probab=17.45 E-value=52 Score=24.00 Aligned_cols=17 Identities=35% Similarity=0.767 Sum_probs=13.7
Q ss_pred CccccchhhhhhhcCCC
Q 033451 56 RAYFDSADWALGKQGVE 72 (119)
Q Consensus 56 RKYFDSgDyam~Kag~~ 72 (119)
--|||..|+++.+.+..
T Consensus 36 ~~YfDT~d~~l~~~~lr 52 (174)
T cd07374 36 AIYFDTPDLRLARAGLR 52 (174)
T ss_pred eeEecCccchhhhCCcE
Confidence 36999999988887653
No 10
>PF09867 DUF2094: Uncharacterized protein conserved in bacteria (DUF2094); InterPro: IPR017748 These proteins are found exclusively, although not universally, in bacterial species that possess a type VI secretion system and are encoded in type VI secretion-associated gene clusters. Their specific function is not yet known. Occasionally a domain is found C-terminal to this entry, but it shows little if any conservation between sequences.; PDB: 2QNU_B.
Probab=16.90 E-value=45 Score=24.61 Aligned_cols=15 Identities=7% Similarity=0.113 Sum_probs=8.6
Q ss_pred hCCCCCCCCcccccc
Q 033451 39 YGGIVPKKPPLISKD 53 (119)
Q Consensus 39 YG~L~~Kk~~L~~k~ 53 (119)
||+||.+.+|+..++
T Consensus 3 fGKlP~~GDFV~~~l 17 (138)
T PF09867_consen 3 FGKLPARGDFVRRNL 17 (138)
T ss_dssp EE--TT-SS-EEES-
T ss_pred ccCCCCCcCcccCCC
Confidence 899999999887776
Done!