Citrus Sinensis ID: 033478


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MTTTWWSVARVNSLSQESFWLTLTCYHQEMAQMVCGSCRRLLAYPRGARHVKCSCCQTVNFVLEAHQVGQVKCASCAVLLMYPYGAPSVRCSSCCFVTEIGVCGLSLFLCMCDLANQI
ccccccHHHHcccccccEEEEEccccHHccccEEccccccEEEECccccEEEcccccccccccccccEEEEEcccccEEEEECccccEEEcccccccccccccccccccccccccccc
*TTTWWSVARVNSLSQESFWLTLTCYHQEMAQMVCGSCRRLLAYPRGARHVKCSCCQTVNFVLEAHQVGQVKCASCAVLLMYPYGAPSVRCSSCCFVTEIGVCGLSLFLCMCDL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTTWWSVARVNSLSQESFWLTLTCYHQEMAQMVCGSCRRLLAYPRGARHVKCSCCQTVNFVLEAHQVGQVKCASCAVLLMYPYGAPSVRCSSCCFVTEIGVCGLSLFLCMCDLANQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein LOL2 Putative zinc finger that may be involved in programmed cell death and defense response.probableO65426

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5C, chain b
Confidence level:probable
Coverage over the Query: 50-91
View the alignment between query and template
View the model in PyMOL