Query         033495
Match_columns 118
No_of_seqs    144 out of 209
Neff          3.3 
Searched_HMMs 46136
Date          Fri Mar 29 02:56:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033495.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033495hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02704 GASA:  Gibberellin reg 100.0 1.1E-36 2.4E-41  202.8   5.3   60   59-118     1-60  (60)
  2 PF07172 GRP:  Glycine rich pro  96.6  0.0045 9.7E-08   44.1   4.9   26    1-26      1-27  (95)
  3 PF03058 Sar8_2:  Sar8.2 family  76.8     4.7  0.0001   29.4   3.9   32    1-32      1-34  (93)
  4 PF07127 Nodulin_late:  Late no  65.2     6.3 0.00014   24.8   2.2   21    1-21      1-21  (54)
  5 PF04202 Mfp-3:  Foot protein 3  64.3     3.7   8E-05   28.6   1.1   25    1-25      1-25  (71)
  6 PHA02637 TNF-alpha-receptor-li  62.5     6.6 0.00014   29.9   2.3   12   82-96     41-52  (127)
  7 PRK09040 hypothetical protein;  61.7     7.8 0.00017   30.5   2.6   18    1-18     22-39  (214)
  8 PF09257 BCMA-Tall_bind:  BCMA,  61.4       7 0.00015   24.4   1.8   21   63-83     16-36  (39)
  9 PRK10523 lipoprotein involved   60.9     7.5 0.00016   31.9   2.5   13   50-62     44-56  (234)
 10 PF10731 Anophelin:  Thrombin i  58.3     9.3  0.0002   26.2   2.2   16    1-16      1-17  (65)
 11 PF10717 ODV-E18:  Occlusion-de  57.9      24 0.00051   25.4   4.3   15    7-21     29-43  (85)
 12 PF13956 Ibs_toxin:  Toxin Ibs,  50.1     8.2 0.00018   20.9   0.7    9    1-9       1-9   (19)
 13 PF15284 PAGK:  Phage-encoded v  49.2      35 0.00075   23.2   3.8   15    1-15      1-15  (61)
 14 PF00879 Defensin_propep:  Defe  47.3      49  0.0011   21.7   4.2   12   15-26     10-21  (52)
 15 TIGR03656 IsdC heme uptake pro  43.0      16 0.00034   30.0   1.6   19    1-19      1-19  (217)
 16 PF04277 OAD_gamma:  Oxaloaceta  42.9      48   0.001   21.5   3.7    7    8-14     15-21  (79)
 17 TIGR02804 ExbD_2 TonB system t  39.6      50  0.0011   23.3   3.6   13    9-21     13-25  (121)
 18 PLN03207 stomagen; Provisional  38.3      51  0.0011   24.7   3.6   19    3-21      9-27  (113)
 19 PRK10081 entericidin B membran  38.1      44 0.00094   21.7   2.8   19    3-21      4-22  (48)
 20 TIGR02052 MerP mercuric transp  36.3      26 0.00057   21.1   1.6   17    1-18      1-17  (92)
 21 TIGR00247 conserved hypothetic  36.1      43 0.00093   28.0   3.3   18    1-18      1-18  (342)
 22 PF05984 Cytomega_UL20A:  Cytom  34.8      48   0.001   24.3   3.0   18    1-18      1-18  (100)
 23 PF13677 MotB_plug:  Membrane M  29.4      60  0.0013   20.8   2.5   14    7-20     26-39  (58)
 24 TIGR01614 PME_inhib pectineste  27.8      33 0.00073   24.8   1.2   14   66-79     34-47  (178)
 25 PF12276 DUF3617:  Protein of u  27.6      76  0.0016   22.8   3.0    6    1-6       1-6   (162)
 26 PF07699 GCC2_GCC3:  GCC2 and G  27.1      82  0.0018   18.9   2.7   27   87-113    10-40  (48)
 27 PLN02745 Putative pectinestera  27.0 2.3E+02  0.0049   26.2   6.5   17   64-80     82-98  (596)
 28 PF01826 TIL:  Trypsin Inhibito  26.4       3 6.6E-05   25.6  -3.9   39   58-100     8-46  (55)
 29 PF04999 FtsL:  Cell division p  25.3      93   0.002   20.9   3.0   13    4-16     14-26  (97)
 30 PRK07718 fliL flagellar basal   25.1      98  0.0021   22.8   3.2   16    1-16      1-16  (142)
 31 PF02402 Lysis_col:  Lysis prot  25.1      48   0.001   21.4   1.4   13    1-13      1-13  (46)
 32 PF15079 DUF4546:  Domain of un  24.2      26 0.00056   28.6   0.0   21   76-96    168-189 (205)
 33 PRK09125 DNA ligase; Provision  23.9      86  0.0019   25.6   3.0    9   30-38     27-35  (282)
 34 PRK13697 cytochrome c6; Provis  23.5      64  0.0014   21.7   1.9   11    1-11      1-11  (111)
 35 PF06692 MNSV_P7B:  Melon necro  23.2      87  0.0019   21.3   2.4   16    6-21     14-29  (61)
 36 PRK11024 colicin uptake protei  23.2      53  0.0011   23.8   1.5   12    9-20     24-35  (141)
 37 PF10969 DUF2771:  Protein of u  23.1      83  0.0018   24.1   2.6    8   31-38     30-37  (161)
 38 COG5487 Small integral membran  23.1   1E+02  0.0022   20.6   2.6   18    2-19     31-48  (54)
 39 PRK10780 periplasmic chaperone  22.7 1.1E+02  0.0024   22.8   3.2   14    1-14      1-14  (165)
 40 TIGR03659 IsdE heme ABC transp  22.3      72  0.0016   25.0   2.2   16    3-18      2-17  (289)
 41 PRK13618 psbV cytochrome c-550  22.0      87  0.0019   24.4   2.6    6    1-6       1-6   (163)
 42 PRK08457 motB flagellar motor   21.8      86  0.0019   25.3   2.6   19    6-24     24-42  (257)
 43 TIGR02600 Verrucomicrobium spi  21.6      85  0.0018   31.8   2.9   21    1-21      1-21  (1265)
 44 PRK11267 biopolymer transport   21.4      70  0.0015   23.2   1.9   12    9-20     27-38  (141)
 45 PF00322 Endothelin:  Endotheli  21.2      38 0.00082   20.3   0.3   17   66-82      4-21  (31)
 46 TIGR01655 yxeA_fam conserved h  21.0      87  0.0019   22.4   2.2   12    1-12      1-12  (114)
 47 TIGR02801 tolR TolR protein. T  20.8      77  0.0017   22.3   1.9   11   10-20     15-25  (129)
 48 PF05399 EVI2A:  Ectropic viral  20.4 1.2E+02  0.0027   25.2   3.3   18    7-24    137-154 (227)
 49 PF02472 ExbD:  Biopolymer tran  20.2      34 0.00074   23.4   0.0    9   10-18     18-26  (130)

No 1  
>PF02704 GASA:  Gibberellin regulated protein;  InterPro: IPR003854 This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds.
Probab=100.00  E-value=1.1e-36  Score=202.85  Aligned_cols=60  Identities=57%  Similarity=1.363  Sum_probs=59.4

Q ss_pred             CChHHhhHHhhhCCCcchHHHHHHHhcccccccCCCCCCCCCCCCcccccccCCCCCCCC
Q 033495           59 ECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQSCPCYNNWKTKRGGPKCP  118 (118)
Q Consensus        59 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GtyGnk~~CPCY~~~~t~~g~pKCP  118 (118)
                      ||+++|++|||+++++++||++||+||++|+|||||||||+|+||||+||+||+|+||||
T Consensus         1 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~gn~~~CpCY~~m~t~~g~pKCP   60 (60)
T PF02704_consen    1 DCGGACSVRCSKASRKKRCMRACGTCCAKCKCVPPGTYGNKEECPCYRDMKTHGGKPKCP   60 (60)
T ss_pred             CcchHHHHHHhccCCchHHHHHHHHHhccCcccCCCCCCCCccCCChhhhhccCCCCCCc
Confidence            799999999999999999999999999999999999999999999999999999999999


No 2  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=96.62  E-value=0.0045  Score=44.06  Aligned_cols=26  Identities=31%  Similarity=0.327  Sum_probs=15.5

Q ss_pred             CchhH-HHHHHHHHHHHHHHHHHhhhc
Q 033495            1 MASKL-SVVAFSLVLIFLFLVENHATS   26 (118)
Q Consensus         1 Mak~~-~~~ll~l~~~~l~~~~v~a~~   26 (118)
                      ||.|. .+|.|+|+++||+.++|+|..
T Consensus         1 MaSK~~llL~l~LA~lLlisSevaa~~   27 (95)
T PF07172_consen    1 MASKAFLLLGLLLAALLLISSEVAARE   27 (95)
T ss_pred             CchhHHHHHHHHHHHHHHHHhhhhhHH
Confidence            88554 444455556666666666643


No 3  
>PF03058 Sar8_2:  Sar8.2 family;  InterPro: IPR004297 Members of this family are found in Solanaceae spp. plants, a taxonomic group (family) that includes pepper and tobacco plant species. Synthesis of these proteins is induced by Tobacco mosaic virus and salicylic acid []; indeed they are thought to be involved in the development of systemic acquired resistance (SAR) after an initial hypersensitive response to microbial infection [, ]. SAR is characterised by long-lasting resistance to infection by a wide range of pathogens, extending to plant tissues distant from the initial infection site [].
Probab=76.79  E-value=4.7  Score=29.40  Aligned_cols=32  Identities=25%  Similarity=0.424  Sum_probs=14.9

Q ss_pred             CchhHHHH-HHHH-HHHHHHHHHHhhhccccCCC
Q 033495            1 MASKLSVV-AFSL-VLIFLFLVENHATSIVEAPT   32 (118)
Q Consensus         1 Mak~~~~~-ll~l-~~~~l~~~~v~a~~~~~~~~   32 (118)
                      |+-+..+| .|.| |+++++.++|.|-..+++++
T Consensus         1 M~~Ktnlfl~lSLailLmIISSqv~AREms~A~a   34 (93)
T PF03058_consen    1 MVSKTNLFLCLSLAILLMIISSQVDAREMSKASA   34 (93)
T ss_pred             CcchhhhHHHHHHHHHHHHHhhHHHHHHHhcccc
Confidence            56444444 3333 23334445555555555543


No 4  
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=65.22  E-value=6.3  Score=24.83  Aligned_cols=21  Identities=38%  Similarity=0.490  Sum_probs=11.9

Q ss_pred             CchhHHHHHHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIFLFLVE   21 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~~~~   21 (118)
                      ||+.+=.+..+.+.++|+++.
T Consensus         1 Ma~ilKFvY~mIiflslflv~   21 (54)
T PF07127_consen    1 MAKILKFVYAMIIFLSLFLVV   21 (54)
T ss_pred             CccchhhHHHHHHHHHHHHhh
Confidence            786666555555555555443


No 5  
>PF04202 Mfp-3:  Foot protein 3;  InterPro: IPR007328 Mytilus foot protein-3 (Mfp-3) is a highly polymorphic protein family located in the byssal adhesive plaques of blue mussels.
Probab=64.31  E-value=3.7  Score=28.61  Aligned_cols=25  Identities=36%  Similarity=0.347  Sum_probs=16.8

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHhhh
Q 033495            1 MASKLSVVAFSLVLIFLFLVENHAT   25 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~~~~v~a~   25 (118)
                      |-++-..+||+||+|-++.+|..|.
T Consensus         1 mnn~Si~VLlaLvLIg~fAVqSdag   25 (71)
T PF04202_consen    1 MNNLSIAVLLALVLIGSFAVQSDAG   25 (71)
T ss_pred             CCchhHHHHHHHHHHhhheeeecCc
Confidence            5556667778888777776665554


No 6  
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=62.52  E-value=6.6  Score=29.86  Aligned_cols=12  Identities=50%  Similarity=1.445  Sum_probs=6.2

Q ss_pred             HHhcccccccCCCCC
Q 033495           82 QKCCAKCLCVPAGFY   96 (118)
Q Consensus        82 ~~CC~~C~CVP~Gty   96 (118)
                      +.||.+|   |||||
T Consensus        41 ~~CC~kC---PPGt~   52 (127)
T PHA02637         41 NLCCLSC---PPGTY   52 (127)
T ss_pred             CeEcCCC---CCCCE
Confidence            4455555   45554


No 7  
>PRK09040 hypothetical protein; Provisional
Probab=61.70  E-value=7.8  Score=30.49  Aligned_cols=18  Identities=22%  Similarity=0.187  Sum_probs=10.7

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIFLF   18 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~   18 (118)
                      |+-++.+|||++|.++++
T Consensus        22 Ms~Lm~iFlli~v~~~~~   39 (214)
T PRK09040         22 MSVLLGAFVLILVGVIGV   39 (214)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566666777776644433


No 8  
>PF09257 BCMA-Tall_bind:  BCMA, TALL-1 binding;  InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 2KN1_A 1OQD_R 1XU2_T.
Probab=61.36  E-value=7  Score=24.42  Aligned_cols=21  Identities=33%  Similarity=0.853  Sum_probs=16.6

Q ss_pred             HhhHHhhhCCCcchHHHHHHH
Q 033495           63 RCTTRCSKTQYRKPCLFFCQK   83 (118)
Q Consensus        63 ~C~~RCs~~~~~~~C~~~C~~   83 (118)
                      -|--|||+..-+-.|.+||+.
T Consensus        16 PChLRCsn~tPP~~Cq~YCna   36 (39)
T PF09257_consen   16 PCHLRCSNNTPPLPCQRYCNA   36 (39)
T ss_dssp             EHHHHHTSSS--TTTHHHHHH
T ss_pred             cceeecCCCCCCccchhhccc
Confidence            388999998788899999984


No 9  
>PRK10523 lipoprotein involved with copper homeostasis and adhesion; Provisional
Probab=60.86  E-value=7.5  Score=31.90  Aligned_cols=13  Identities=23%  Similarity=0.447  Sum_probs=8.2

Q ss_pred             CCCCCCCCCCChH
Q 033495           50 TTQGSLQPQECGP   62 (118)
Q Consensus        50 ~~~g~l~~~~C~~   62 (118)
                      .=+|-|+-.||++
T Consensus        44 tY~G~LPCADC~G   56 (234)
T PRK10523         44 SWRGVLPCADCEG   56 (234)
T ss_pred             EEeEEEECCCCCC
Confidence            3456677777764


No 10 
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=58.27  E-value=9.3  Score=26.23  Aligned_cols=16  Identities=31%  Similarity=0.515  Sum_probs=8.5

Q ss_pred             Cchh-HHHHHHHHHHHH
Q 033495            1 MASK-LSVVAFSLVLIF   16 (118)
Q Consensus         1 Mak~-~~~~ll~l~~~~   16 (118)
                      ||.+ ++|.||+++++.
T Consensus         1 MA~Kl~vialLC~aLva   17 (65)
T PF10731_consen    1 MASKLIVIALLCVALVA   17 (65)
T ss_pred             CcchhhHHHHHHHHHHH
Confidence            8844 445555554444


No 11 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=57.88  E-value=24  Score=25.39  Aligned_cols=15  Identities=27%  Similarity=0.549  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHHHHH
Q 033495            7 VVAFSLVLIFLFLVE   21 (118)
Q Consensus         7 ~~ll~l~~~~l~~~~   21 (118)
                      .+|.+||||+|+.-.
T Consensus        29 tILivLVIIiLlIml   43 (85)
T PF10717_consen   29 TILIVLVIIILLIML   43 (85)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344444444444333


No 12 
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=50.07  E-value=8.2  Score=20.86  Aligned_cols=9  Identities=11%  Similarity=0.246  Sum_probs=3.6

Q ss_pred             CchhHHHHH
Q 033495            1 MASKLSVVA    9 (118)
Q Consensus         1 Mak~~~~~l    9 (118)
                      |.|.+.|++
T Consensus         1 MMk~vIIlv    9 (19)
T PF13956_consen    1 MMKLVIILV    9 (19)
T ss_pred             CceehHHHH
Confidence            344443333


No 13 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=49.18  E-value=35  Score=23.20  Aligned_cols=15  Identities=13%  Similarity=0.133  Sum_probs=7.6

Q ss_pred             CchhHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLI   15 (118)
Q Consensus         1 Mak~~~~~ll~l~~~   15 (118)
                      |.|+-+|||.+++++
T Consensus         1 Mkk~ksifL~l~~~L   15 (61)
T PF15284_consen    1 MKKFKSIFLALVFIL   15 (61)
T ss_pred             ChHHHHHHHHHHHHH
Confidence            565555555444333


No 14 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=47.33  E-value=49  Score=21.70  Aligned_cols=12  Identities=17%  Similarity=0.465  Sum_probs=5.3

Q ss_pred             HHHHHHHHhhhc
Q 033495           15 IFLFLVENHATS   26 (118)
Q Consensus        15 ~~l~~~~v~a~~   26 (118)
                      ++|+..++.|+.
T Consensus        10 lLLlAlqaQAep   21 (52)
T PF00879_consen   10 LLLLALQAQAEP   21 (52)
T ss_pred             HHHHHHHHhccc
Confidence            333334455553


No 15 
>TIGR03656 IsdC heme uptake protein IsdC. Isd proteins are iron-regulated surface proteins found in Bacillus, Staphylococcus and Listeria species and are responsible for heme scavenging from hemoproteins. The IsdC protein consists of an N-terminal hydrophobic signal sequence, a central NEAT (NEAr Transporter, pfam05031) domain which confers the ability to bind heme and a C-terminal SrtB processing signal which targets the protein to the cell wall. IsdC is believed to make a direct contact with, and transfer heme to, the heme-binding component (IsdE) of an ABC transporter in the cytoplasmic membrane, and to receive heme from other NEAT-containing heme-binding proteins also localized in the cell wall.
Probab=43.02  E-value=16  Score=29.96  Aligned_cols=19  Identities=32%  Similarity=0.546  Sum_probs=11.3

Q ss_pred             CchhHHHHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIFLFL   19 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~~   19 (118)
                      |.+++++++|++++.|+++
T Consensus         1 mk~~~~~~~~~~~~~f~~~   19 (217)
T TIGR03656         1 MKKILVFAFFTTILAFIIL   19 (217)
T ss_pred             CcchhhHHHHHHHHHHhcc
Confidence            7777776555555555543


No 16 
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=42.92  E-value=48  Score=21.54  Aligned_cols=7  Identities=43%  Similarity=0.629  Sum_probs=2.5

Q ss_pred             HHHHHHH
Q 033495            8 VAFSLVL   14 (118)
Q Consensus         8 ~ll~l~~   14 (118)
                      ++++|++
T Consensus        15 VF~~L~l   21 (79)
T PF04277_consen   15 VFLVLIL   21 (79)
T ss_pred             HHHHHHH
Confidence            3333333


No 17 
>TIGR02804 ExbD_2 TonB system transport protein ExbD, group 2. Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Probab=39.57  E-value=50  Score=23.30  Aligned_cols=13  Identities=23%  Similarity=0.404  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHHH
Q 033495            9 AFSLVLIFLFLVE   21 (118)
Q Consensus         9 ll~l~~~~l~~~~   21 (118)
                      +|+|+++||+.+.
T Consensus        13 vflLLiFFmvtt~   25 (121)
T TIGR02804        13 MLVLLAIVLIIST   25 (121)
T ss_pred             HHHHHHHHHHHHH
Confidence            3444445554443


No 18 
>PLN03207 stomagen; Provisional
Probab=38.28  E-value=51  Score=24.74  Aligned_cols=19  Identities=16%  Similarity=0.249  Sum_probs=9.3

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q 033495            3 SKLSVVAFSLVLIFLFLVE   21 (118)
Q Consensus         3 k~~~~~ll~l~~~~l~~~~   21 (118)
                      +..+..||+|+..|||.+.
T Consensus         9 tt~~~~lffLl~~llla~~   27 (113)
T PLN03207          9 TTRCLTLFFLLFFLLLGAY   27 (113)
T ss_pred             cchhHHHHHHHHHHHHHHH
Confidence            4445555555555554433


No 19 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=38.14  E-value=44  Score=21.67  Aligned_cols=19  Identities=16%  Similarity=0.146  Sum_probs=9.2

Q ss_pred             hhHHHHHHHHHHHHHHHHH
Q 033495            3 SKLSVVAFSLVLIFLFLVE   21 (118)
Q Consensus         3 k~~~~~ll~l~~~~l~~~~   21 (118)
                      |++.+++++|++++++..-
T Consensus         4 k~i~~i~~~l~~~~~l~~C   22 (48)
T PRK10081          4 KTIAAIFSVLVLSTVLTAC   22 (48)
T ss_pred             HHHHHHHHHHHHHHHHhhh
Confidence            4444445555555544433


No 20 
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=36.32  E-value=26  Score=21.12  Aligned_cols=17  Identities=24%  Similarity=0.108  Sum_probs=7.6

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIFLF   18 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~   18 (118)
                      |.|+ ..+|++||+.|+.
T Consensus         1 ~~~~-~~~~~~~~~~~~~   17 (92)
T TIGR02052         1 MKKL-ATLLALFVLTSLP   17 (92)
T ss_pred             ChhH-HHHHHHHHHhcch
Confidence            4443 4444444444443


No 21 
>TIGR00247 conserved hypothetical protein, YceG family. This uncharacterized protein family, found in three of four microbial genomes, virtually always once per genome, includes YceG from Escherichia coli. This protein is encoded next to PabC, 4-amino-4-deoxychorismate lyase, in E. coli and numerous other proteobacteria, but that proximity is not conserved in other lineages. Numerous members of this family have been misannotated as aminodeoxychorismate lyase, apparently because of promiximty to PabC.
Probab=36.15  E-value=43  Score=28.02  Aligned_cols=18  Identities=28%  Similarity=0.556  Sum_probs=9.7

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIFLF   18 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~   18 (118)
                      |.|++.++++++++++++
T Consensus         1 ~~~~~~~i~~~~vl~~~~   18 (342)
T TIGR00247         1 MKKFLIIILLLFVLFFIL   18 (342)
T ss_pred             ChhHHHHHHHHHHHHHHH
Confidence            666765555544444443


No 22 
>PF05984 Cytomega_UL20A:  Cytomegalovirus UL20A protein;  InterPro: IPR009245 This family consists of several Cytomegalovirus UL20A proteins. UL20A is thought to be a glycoprotein [].
Probab=34.85  E-value=48  Score=24.29  Aligned_cols=18  Identities=22%  Similarity=0.312  Sum_probs=9.5

Q ss_pred             CchhHHHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIFLF   18 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~   18 (118)
                      ||+.+-|+-|..|.+-++
T Consensus         1 MaRRlwiLslLAVtLtVA   18 (100)
T PF05984_consen    1 MARRLWILSLLAVTLTVA   18 (100)
T ss_pred             CchhhHHHHHHHHHHHHH
Confidence            787765554444443333


No 23 
>PF13677 MotB_plug:  Membrane MotB of proton-channel complex MotA/MotB 
Probab=29.37  E-value=60  Score=20.79  Aligned_cols=14  Identities=0%  Similarity=0.320  Sum_probs=5.8

Q ss_pred             HHHHHHHHHHHHHH
Q 033495            7 VVAFSLVLIFLFLV   20 (118)
Q Consensus         7 ~~ll~l~~~~l~~~   20 (118)
                      ++||+|++++...+
T Consensus        26 TLLl~fFVlL~s~s   39 (58)
T PF13677_consen   26 TLLLAFFVLLFSMS   39 (58)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34444444444333


No 24 
>TIGR01614 PME_inhib pectinesterase inhibitor domain. This model describes a plant domain of about 200 amino acids, characterized by four conserved Cys residues, shown in a pectinesterase inhibitor from Kiwi to form two disulfide bonds: first to second and third to fourth. Roughly half the members of this family have the region described by this model followed immediately by a pectinesterase domain, pfam01095. This suggests that the pairing of the enzymatic domain and its inhibitor reflects a conserved regulatory mechanism for this enzyme family.
Probab=27.82  E-value=33  Score=24.80  Aligned_cols=14  Identities=36%  Similarity=0.757  Sum_probs=7.8

Q ss_pred             HHhhhCCCcchHHH
Q 033495           66 TRCSKTQYRKPCLF   79 (118)
Q Consensus        66 ~RCs~~~~~~~C~~   79 (118)
                      .-|..+.+++.|..
T Consensus        34 ~~C~~t~~~~~C~~   47 (178)
T TIGR01614        34 RICKKTEYPNFCIS   47 (178)
T ss_pred             HHHcCCCChHHHHH
Confidence            34556666666654


No 25 
>PF12276 DUF3617:  Protein of unknown function (DUF3617);  InterPro: IPR022061  This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important. 
Probab=27.62  E-value=76  Score=22.84  Aligned_cols=6  Identities=33%  Similarity=0.462  Sum_probs=2.3

Q ss_pred             CchhHH
Q 033495            1 MASKLS    6 (118)
Q Consensus         1 Mak~~~    6 (118)
                      |-+.++
T Consensus         1 M~~~~~    6 (162)
T PF12276_consen    1 MKRRLL    6 (162)
T ss_pred             CchHHH
Confidence            333333


No 26 
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=27.09  E-value=82  Score=18.89  Aligned_cols=27  Identities=37%  Similarity=0.733  Sum_probs=19.6

Q ss_pred             cccccCCCCCCCC---CCC-CcccccccCCC
Q 033495           87 KCLCVPAGFYGNK---QSC-PCYNNWKTKRG  113 (118)
Q Consensus        87 ~C~CVP~GtyGnk---~~C-PCY~~~~t~~g  113 (118)
                      .|.=.|.|||-+.   .+| +|-.+..|..-
T Consensus        10 ~C~~Cp~GtYq~~~g~~~C~~Cp~g~~T~~~   40 (48)
T PF07699_consen   10 KCQPCPKGTYQDEEGQTSCTPCPPGSTTSSE   40 (48)
T ss_pred             ccCCCCCCccCCccCCccCccCcCCCccCCc
Confidence            4555689999854   579 89999877543


No 27 
>PLN02745 Putative pectinesterase/pectinesterase inhibitor
Probab=27.03  E-value=2.3e+02  Score=26.23  Aligned_cols=17  Identities=29%  Similarity=0.546  Sum_probs=12.4

Q ss_pred             hhHHhhhCCCcchHHHH
Q 033495           64 CTTRCSKTQYRKPCLFF   80 (118)
Q Consensus        64 C~~RCs~~~~~~~C~~~   80 (118)
                      =..-|+.+.+++.|...
T Consensus        82 Ik~~C~~T~YP~~C~sS   98 (596)
T PLN02745         82 IQTVCNATLYKQTCENT   98 (596)
T ss_pred             HHHhcCCCCChHHHHHH
Confidence            34558888888888753


No 28 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=26.42  E-value=3  Score=25.56  Aligned_cols=39  Identities=33%  Similarity=0.959  Sum_probs=26.5

Q ss_pred             CCChHHhhHHhhhCCCcchHHHHHHHhcccccccCCCCCCCCC
Q 033495           58 QECGPRCTTRCSKTQYRKPCLFFCQKCCAKCLCVPAGFYGNKQ  100 (118)
Q Consensus        58 ~~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GtyGnk~  100 (118)
                      .+|++.|...|+.......|...   |=.-|.| |+|++-|.+
T Consensus         8 ~~C~~~C~~tC~~~~~~~~C~~~---C~~gC~C-~~G~v~~~~   46 (55)
T PF01826_consen    8 SECGSPCPRTCDNPNNPEPCSEP---CVEGCFC-PPGYVRNDN   46 (55)
T ss_dssp             ESSETSTTCBSSCTTTSSSCSSS----ESEEEE-TTTEEEETT
T ss_pred             CcccCCcCCcCCCCCCCcCcCCC---CCccCCC-CCCeeEcCC
Confidence            37889999999987777666633   3344667 567776554


No 29 
>PF04999 FtsL:  Cell division protein FtsL;  InterPro: IPR007082 In Escherichia coli, nine gene products are known to be essential for assembly of the division septum. One of these, FtsL, is a bitopic membrane protein whose precise function is not understood. It has been proposed that FtsL interacts with the DivIC protein IPR007060 from INTERPRO [], however this interaction may be indirect [].; GO: 0007049 cell cycle, 0016021 integral to membrane
Probab=25.29  E-value=93  Score=20.93  Aligned_cols=13  Identities=38%  Similarity=0.457  Sum_probs=5.3

Q ss_pred             hHHHHHHHHHHHH
Q 033495            4 KLSVVAFSLVLIF   16 (118)
Q Consensus         4 ~~~~~ll~l~~~~   16 (118)
                      ++.++++++++++
T Consensus        14 ~l~i~l~~~v~~~   26 (97)
T PF04999_consen   14 KLIILLVIVVLIS   26 (97)
T ss_pred             HHHHHHHHHHHHH
Confidence            3444444444333


No 30 
>PRK07718 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=25.08  E-value=98  Score=22.81  Aligned_cols=16  Identities=19%  Similarity=0.472  Sum_probs=8.3

Q ss_pred             CchhHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIF   16 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~   16 (118)
                      |.|++.+++++.++++
T Consensus         1 ~kkkl~~i~~i~l~~l   16 (142)
T PRK07718          1 MKNKLIKIMLIILIVI   16 (142)
T ss_pred             CcchHHHHHHHHHHHH
Confidence            6666665554444333


No 31 
>PF02402 Lysis_col:  Lysis protein;  InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively [].  Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=25.06  E-value=48  Score=21.45  Aligned_cols=13  Identities=23%  Similarity=0.253  Sum_probs=6.8

Q ss_pred             CchhHHHHHHHHH
Q 033495            1 MASKLSVVAFSLV   13 (118)
Q Consensus         1 Mak~~~~~ll~l~   13 (118)
                      |.|++.+++|++.
T Consensus         1 MkKi~~~~i~~~~   13 (46)
T PF02402_consen    1 MKKIIFIGIFLLT   13 (46)
T ss_pred             CcEEEEeHHHHHH
Confidence            5555555554444


No 32 
>PF15079 DUF4546:  Domain of unknown function (DUF4546)
Probab=24.19  E-value=26  Score=28.56  Aligned_cols=21  Identities=43%  Similarity=1.102  Sum_probs=16.4

Q ss_pred             hHHHHHHHhccccc-ccCCCCC
Q 033495           76 PCLFFCQKCCAKCL-CVPAGFY   96 (118)
Q Consensus        76 ~C~~~C~~CC~~C~-CVP~Gty   96 (118)
                      ..+-.|++||++|. |..--+|
T Consensus       168 d~lH~C~tCcekcllCalk~n~  189 (205)
T PF15079_consen  168 DSLHQCRTCCEKCLLCALKNNY  189 (205)
T ss_pred             cchhhchhhhhhhhhhhccccc
Confidence            46778999999998 7766554


No 33 
>PRK09125 DNA ligase; Provisional
Probab=23.92  E-value=86  Score=25.61  Aligned_cols=9  Identities=44%  Similarity=0.350  Sum_probs=5.0

Q ss_pred             CCCCCCCcc
Q 033495           30 APTPQPAES   38 (118)
Q Consensus        30 ~~~~q~~~~   38 (118)
                      .+.||++..
T Consensus        27 ~~~~~LA~~   35 (282)
T PRK09125         27 APDLQLATV   35 (282)
T ss_pred             CCCceechh
Confidence            456666553


No 34 
>PRK13697 cytochrome c6; Provisional
Probab=23.52  E-value=64  Score=21.74  Aligned_cols=11  Identities=36%  Similarity=0.440  Sum_probs=5.3

Q ss_pred             CchhHHHHHHH
Q 033495            1 MASKLSVVAFS   11 (118)
Q Consensus         1 Mak~~~~~ll~   11 (118)
                      |.|++..+++.
T Consensus         1 m~~~~~~~~~~   11 (111)
T PRK13697          1 MKKILSLVLLG   11 (111)
T ss_pred             ChhHHHHHHHH
Confidence            65555443333


No 35 
>PF06692 MNSV_P7B:  Melon necrotic spot virus P7B protein;  InterPro: IPR009575 This family consists of several Melon necrotic spot virus (MNSV) P7B proteins. The function of this family is unknown.
Probab=23.24  E-value=87  Score=21.27  Aligned_cols=16  Identities=25%  Similarity=0.440  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHHHH
Q 033495            6 SVVAFSLVLIFLFLVE   21 (118)
Q Consensus         6 ~~~ll~l~~~~l~~~~   21 (118)
                      +..||+|++.|+|...
T Consensus        14 ~~~lLiliis~~f~lI   29 (61)
T PF06692_consen   14 SGPLLILIISFVFFLI   29 (61)
T ss_pred             hhHHHHHHHHHHHHHH
Confidence            4556666666665444


No 36 
>PRK11024 colicin uptake protein TolR; Provisional
Probab=23.17  E-value=53  Score=23.85  Aligned_cols=12  Identities=33%  Similarity=0.553  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHHH
Q 033495            9 AFSLVLIFLFLV   20 (118)
Q Consensus         9 ll~l~~~~l~~~   20 (118)
                      +|+|+++||+.+
T Consensus        24 vfvLLiFFmvts   35 (141)
T PRK11024         24 LLVLLLIFMATA   35 (141)
T ss_pred             HHHHHHHHHhcc
Confidence            444445555433


No 37 
>PF10969 DUF2771:  Protein of unknown function (DUF2771);  InterPro: IPR024495 This bacterial family of proteins has no known function.
Probab=23.10  E-value=83  Score=24.07  Aligned_cols=8  Identities=38%  Similarity=0.505  Sum_probs=3.6

Q ss_pred             CCCCCCcc
Q 033495           31 PTPQPAES   38 (118)
Q Consensus        31 ~~~q~~~~   38 (118)
                      +.|++..+
T Consensus        30 ~~p~~p~I   37 (161)
T PF10969_consen   30 SDPQDPEI   37 (161)
T ss_pred             CCCCCcEE
Confidence            34454444


No 38 
>COG5487 Small integral membrane protein [Function unknown]
Probab=23.10  E-value=1e+02  Score=20.58  Aligned_cols=18  Identities=33%  Similarity=0.403  Sum_probs=9.8

Q ss_pred             chhHHHHHHHHHHHHHHH
Q 033495            2 ASKLSVVAFSLVLIFLFL   19 (118)
Q Consensus         2 ak~~~~~ll~l~~~~l~~   19 (118)
                      ||.+-.+.+++++++|+.
T Consensus        31 AkIlF~i~~vlf~vsL~~   48 (54)
T COG5487          31 AKILFFIFLVLFLVSLFA   48 (54)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            455555555555555553


No 39 
>PRK10780 periplasmic chaperone; Provisional
Probab=22.67  E-value=1.1e+02  Score=22.76  Aligned_cols=14  Identities=29%  Similarity=0.325  Sum_probs=7.8

Q ss_pred             CchhHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVL   14 (118)
Q Consensus         1 Mak~~~~~ll~l~~   14 (118)
                      |.|++.+++|.|++
T Consensus         1 Mkk~~~~~~l~l~~   14 (165)
T PRK10780          1 MKKWLLAAGLGLAL   14 (165)
T ss_pred             ChHHHHHHHHHHHH
Confidence            66666555554443


No 40 
>TIGR03659 IsdE heme ABC transporter, heme-binding protein isdE. This family of ABC substrate-binding proteins is observed primarily in close proximity with proteins localized to the cell wall and bearing the NEAT (NEAr Transporter, pfam05031) heme-binding domain. IsdE has been shown to bind heme and is involved in the process of scavenging heme for the purpose of obtaining iron.
Probab=22.31  E-value=72  Score=24.97  Aligned_cols=16  Identities=25%  Similarity=0.295  Sum_probs=12.9

Q ss_pred             hhHHHHHHHHHHHHHH
Q 033495            3 SKLSVVAFSLVLIFLF   18 (118)
Q Consensus         3 k~~~~~ll~l~~~~l~   18 (118)
                      |+++|+|+++++++|.
T Consensus         2 ~~~~~~~~~~~~~~~~   17 (289)
T TIGR03659         2 KILSLILLALLSLGLT   17 (289)
T ss_pred             chhHHHHHHHHHHHHH
Confidence            6788888888887776


No 41 
>PRK13618 psbV cytochrome c-550; Provisional
Probab=21.97  E-value=87  Score=24.41  Aligned_cols=6  Identities=33%  Similarity=0.373  Sum_probs=2.7

Q ss_pred             CchhHH
Q 033495            1 MASKLS    6 (118)
Q Consensus         1 Mak~~~    6 (118)
                      |.|+..
T Consensus         1 ~~~~~~    6 (163)
T PRK13618          1 MFRRLI    6 (163)
T ss_pred             ChHHHH
Confidence            444443


No 42 
>PRK08457 motB flagellar motor protein MotB; Reviewed
Probab=21.81  E-value=86  Score=25.27  Aligned_cols=19  Identities=5%  Similarity=0.121  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q 033495            6 SVVAFSLVLIFLFLVENHA   24 (118)
Q Consensus         6 ~~~ll~l~~~~l~~~~v~a   24 (118)
                      ..+||+||++++..+.+.+
T Consensus        24 ~TLLL~FFVlL~smS~vd~   42 (257)
T PRK08457         24 LSLLLALFIALYAISAVNK   42 (257)
T ss_pred             HHHHHHHHHHHHHHHhcCH
Confidence            3455555555555555443


No 43 
>TIGR02600 Verrucomicrobium spinosum paralogous protein TIGR02600. In Verrucomicrobium spinosum, a five-gene operon that includes proteins with an N-terminal signal sequence for cleavage and methylation recurs over twenty times. Each operon is likely to encode a membrane complex, the function of which is unknown. This model represents a long paralogous protein from this putative membrame complex, with members averaging about 1300 amino acids. The N-terminal region includes an apparent signal sequence. The function is unknown.
Probab=21.64  E-value=85  Score=31.83  Aligned_cols=21  Identities=19%  Similarity=0.319  Sum_probs=13.1

Q ss_pred             CchhHHHHHHHHHHHHHHHHH
Q 033495            1 MASKLSVVAFSLVLIFLFLVE   21 (118)
Q Consensus         1 Mak~~~~~ll~l~~~~l~~~~   21 (118)
                      ||.++++++|+||.++++.-.
T Consensus         1 ~ALi~VL~iLaLItiLvvaFl   21 (1265)
T TIGR02600         1 MALIMVLIILALITILVLGFL   21 (1265)
T ss_pred             ChHHHHHHHHHHHHHHHHHHH
Confidence            677777666666666555433


No 44 
>PRK11267 biopolymer transport protein ExbD; Provisional
Probab=21.36  E-value=70  Score=23.24  Aligned_cols=12  Identities=25%  Similarity=0.603  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHHH
Q 033495            9 AFSLVLIFLFLV   20 (118)
Q Consensus         9 ll~l~~~~l~~~   20 (118)
                      +|+|+++||+.+
T Consensus        27 vf~LLiFFmvts   38 (141)
T PRK11267         27 MLVLLIIFMVAA   38 (141)
T ss_pred             HHHHHHHHHhhh
Confidence            444445555433


No 45 
>PF00322 Endothelin:  Endothelin family;  InterPro: IPR001928 Endothelins (ET's) are the most potent vasoconstrictors known [, , ]. They stimulate cardiac contraction, regulate release of vasoactive substances, and stimulate mitogenesis in blood vessels in primary culture. They also stimulate contraction in almost all other smooth muscles (e.g., uterus, bronchus, vas deferensa and stomach) and stimulate secretion in several tissues (e.g., kidney, liver and adrenals). Endothelin receptors have also been found in the brain, e.g. cerebral cortex, cerebellum and glial cells. Endothelins have been implicated in a variety of pathophysiological conditions associated with stress, including hypertension, myocardial infarction, subarachnoid haemorrhage and renal failure. Endothelins are synthesised by proteolysis of large preproendothelins, which are cleaved to 'big endothelins' before being processed to the mature peptide. Sarafotoxins (SRTX) and bibrotoxin (BTX) are cardiotoxins from the venom of snakes of the Atractaspis family, structurally and functionally [, ] similar to endothelin. As shown in the following schematic representation, these peptides which are 21 residues long contain two intramolecular disulphide bonds.  +-------------+ | | CxCxxxxxxxCxxxCxxxxxx | | +-------+ 'C': conserved cysteine involved in a disulphide bond.  ; GO: 0019229 regulation of vasoconstriction, 0005576 extracellular region; PDB: 1V6R_A 1T7H_A 1EDP_A 1EDN_A 3CMH_A 6CMH_A 1SRB_A 2LDF_A.
Probab=21.20  E-value=38  Score=20.30  Aligned_cols=17  Identities=41%  Similarity=1.083  Sum_probs=11.6

Q ss_pred             HHhh-hCCCcchHHHHHH
Q 033495           66 TRCS-KTQYRKPCLFFCQ   82 (118)
Q Consensus        66 ~RCs-~~~~~~~C~~~C~   82 (118)
                      .||| .+..-+.|+-||-
T Consensus         4 pRCsC~s~~DkeC~yFCh   21 (31)
T PF00322_consen    4 PRCSCASWKDKECVYFCH   21 (31)
T ss_dssp             --ECCSSSTHHHHHHHHH
T ss_pred             cceecCCCcchhhheeec
Confidence            3888 4566778999985


No 46 
>TIGR01655 yxeA_fam conserved hypothetical protein TIGR01655. This model represents a family of small (about 115 amino acids) uncharacterized proteins with N-terminal signal sequences, found exclusively in Gram-positive organisms. Most genomes that have any members of this family have at least two members.
Probab=21.01  E-value=87  Score=22.45  Aligned_cols=12  Identities=17%  Similarity=0.282  Sum_probs=5.7

Q ss_pred             CchhHHHHHHHH
Q 033495            1 MASKLSVVAFSL   12 (118)
Q Consensus         1 Mak~~~~~ll~l   12 (118)
                      |.|.+.+++.++
T Consensus         1 mKK~li~li~~i   12 (114)
T TIGR01655         1 MKKGLAILLALI   12 (114)
T ss_pred             CceehHHHHHHH
Confidence            565555443333


No 47 
>TIGR02801 tolR TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score.
Probab=20.79  E-value=77  Score=22.25  Aligned_cols=11  Identities=27%  Similarity=0.676  Sum_probs=4.8

Q ss_pred             HHHHHHHHHHH
Q 033495           10 FSLVLIFLFLV   20 (118)
Q Consensus        10 l~l~~~~l~~~   20 (118)
                      |+|+++||+.+
T Consensus        15 FlLLiFFmvts   25 (129)
T TIGR02801        15 LVLLIIFMVTA   25 (129)
T ss_pred             HHHHHHHHhhh
Confidence            33444444433


No 48 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=20.40  E-value=1.2e+02  Score=25.20  Aligned_cols=18  Identities=22%  Similarity=0.335  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 033495            7 VVAFSLVLIFLFLVENHA   24 (118)
Q Consensus         7 ~~ll~l~~~~l~~~~v~a   24 (118)
                      |.+||||-.|||+..|..
T Consensus       137 IAVLfLICT~LfLSTVVL  154 (227)
T PF05399_consen  137 IAVLFLICTLLFLSTVVL  154 (227)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            445555555666655443


No 49 
>PF02472 ExbD:  Biopolymer transport protein ExbD/TolR;  InterPro: IPR003400 This group of proteins are membrane bound transport proteins essential for ferric ion uptake in bacteria []. The family consists of ExbD, and TolR which are involved in TonB-dependent transport of various receptor bound substrates including colicins [].; GO: 0005215 transporter activity, 0006810 transport, 0016020 membrane; PDB: 2JWL_A 2JWK_A 2PFU_A.
Probab=20.19  E-value=34  Score=23.38  Aligned_cols=9  Identities=33%  Similarity=0.903  Sum_probs=0.0

Q ss_pred             HHHHHHHHH
Q 033495           10 FSLVLIFLF   18 (118)
Q Consensus        10 l~l~~~~l~   18 (118)
                      |+|+++||+
T Consensus        18 flLLiFfm~   26 (130)
T PF02472_consen   18 FLLLIFFMV   26 (130)
T ss_dssp             ---------
T ss_pred             HHHHHHHHH
Confidence            333444443


Done!