Query         033508
Match_columns 118
No_of_seqs    27 out of 29
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 03:05:46 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033508.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033508hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08507 COPI_assoc:  COPI asso  99.1 6.5E-10 1.4E-14   80.0   7.2   68   46-117     5-72  (136)
  2 PF06151 Trehalose_recp:  Treha  80.8      12 0.00025   32.3   8.1   36   75-110    90-126 (414)
  3 PRK14756 hypothetical protein;  53.3      23  0.0005   21.2   3.1   21   47-67      7-27  (29)
  4 PHA03281 envelope glycoprotein  42.3      86  0.0019   29.6   6.4   41   33-74    546-586 (642)
  5 TIGR00769 AAA ADP/ATP carrier   42.1 1.6E+02  0.0034   26.0   7.7   43   74-116    74-133 (472)
  6 COG3768 Predicted membrane pro  40.8 1.4E+02   0.003   26.5   7.1   61   49-109    67-130 (350)
  7 PF11163 DUF2947:  Protein of u  35.1      14 0.00031   28.9   0.3   18   94-111   108-125 (153)
  8 COG5074 t-SNARE complex subuni  33.0      25 0.00055   30.0   1.4   15   81-95    251-265 (280)
  9 KOG2412 Nuclear-export-signal   31.7      16 0.00035   34.0   0.1   26   75-100   468-498 (591)
 10 PF11712 Vma12:  Endoplasmic re  31.6 1.6E+02  0.0034   21.4   5.3   23   84-107   115-137 (142)
 11 PF07444 Ycf66_N:  Ycf66 protei  30.6   2E+02  0.0043   20.4   6.6   27   47-73      5-31  (84)
 12 PLN00039 photosystem II reacti  30.3      32 0.00069   25.8   1.4   18   90-107    81-98  (111)
 13 PF13705 TRC8_N:  TRC8 N-termin  29.9      52  0.0011   30.0   3.0   68   40-115   174-241 (508)
 14 PRK13610 photosystem II reacti  29.8      33 0.00071   25.9   1.4   17   91-107    88-104 (113)
 15 TIGR03047 PS_II_psb28 photosys  29.5      34 0.00073   25.6   1.4   19   89-107    79-97  (109)
 16 PRK13612 photosystem II reacti  29.0      35 0.00075   25.7   1.4   18   90-107    83-100 (113)
 17 PF05805 L6_membrane:  L6 membr  27.5      62  0.0014   26.1   2.7   24   44-67      7-30  (195)
 18 PF04588 HIG_1_N:  Hypoxia indu  27.1 1.7E+02  0.0036   18.4   4.9   40   55-94     10-52  (54)
 19 CHL00128 psbW photosystem II p  26.4      41 0.00089   25.3   1.4   19   89-107    82-100 (113)
 20 PRK13611 photosystem II reacti  25.6      44 0.00095   24.9   1.4   17   91-107    77-93  (104)
 21 PF03912 Psb28:  Psb28 protein;  24.1      45 0.00098   24.9   1.3   12   96-107    86-97  (108)
 22 PF11628 TCR_zetazeta:  T-cell   23.2      69  0.0015   19.7   1.7   18   75-92      6-23  (33)
 23 PF04750 Far-17a_AIG1:  FAR-17a  22.7 1.1E+02  0.0025   22.5   3.2   53   42-94     30-85  (201)
 24 PHA02815 hypothetical protein;  22.6 1.9E+02   0.004   20.1   4.0   25   86-110     7-31  (64)
 25 PHA01399 membrane protein P6    22.3   4E+02  0.0087   22.4   6.6   57   50-113    30-87  (242)
 26 KOG2675 Adenylate cyclase-asso  21.7      92   0.002   28.6   2.9   20   51-70    265-284 (480)
 27 KOG3419 Mitochondrial/chloropl  21.5      50  0.0011   25.0   1.1   10  109-118    59-68  (112)
 28 KOG1908 Ribonuclease inhibitor  21.5      86  0.0019   25.0   2.5   12   15-26      3-14  (165)
 29 PRK00040 rpsP 30S ribosomal pr  21.1      52  0.0011   22.6   1.0   11  108-118    56-66  (75)
 30 KOG3030 Lipid phosphate phosph  20.5 1.4E+02  0.0031   25.4   3.7   33   59-93    225-258 (317)
 31 PF08551 DUF1751:  Eukaryotic i  20.4   1E+02  0.0022   21.4   2.5   47   44-93     48-96  (99)
 32 PF06459 RR_TM4-6:  Ryanodine R  20.3      81  0.0017   26.3   2.2   19   43-61    246-264 (274)

No 1  
>PF08507 COPI_assoc:  COPI associated protein;  InterPro: IPR013714 Proteins in this family co-localise with COPI vesicle coat proteins []. In yeast it is a Golgi membrane protein involved in vesicular trafficking, interacting with TVP18 []. 
Probab=99.05  E-value=6.5e-10  Score=80.01  Aligned_cols=68  Identities=24%  Similarity=0.472  Sum_probs=56.1

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhhccCcccccchhhhhHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhccC
Q 033508           46 CYSVLTSLTALLCLAVNVLSAIRSFKNGSDIFDGIFRCYAVVIAFFVALAETEWQFVLKFTKVLEYWVARVL  117 (118)
Q Consensus        46 ~fs~vTa~~AlLCi~vNvlSavrsf~~~~dif~GI~RcYaV~iA~fVvlaETEW~~i~kF~kvLeyW~gRGm  117 (118)
                      .+.+++.++|+++++..+++.+.+    .++-+.++++|.++++++++++|.+|.++.|++++|+.|.|||+
T Consensus         5 ~~r~~~~~~~~~~i~~gi~~l~~~----~~~~~~i~~~Y~i~fg~ll~~~E~~~~~i~~~~~FL~~~~GRGl   72 (136)
T PF08507_consen    5 IFRILNIIAGILLILAGILSLFNS----FSFSSFILGVYCILFGLLLILAEFRWPFIRKYFGFLYSYIGRGL   72 (136)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhh----hhHHHHHHHHHHHHHHHHHHHHHhccHHHHHhHhHHHhHHHHHH
Confidence            455666666666777777777665    33447789999999999999999999999999999999999996


No 2  
>PF06151 Trehalose_recp:  Trehalose receptor;  InterPro: IPR009318 In Drosophila, taste is perceived by gustatory neurons located in sensilla distributed on several different appendages throughout the body of the animal. This family represents the taste receptor sensitive to trehalose [,].
Probab=80.79  E-value=12  Score=32.27  Aligned_cols=36  Identities=14%  Similarity=0.291  Sum_probs=30.5

Q ss_pred             cccch-hhhhHHHHHHHHHHHHhhhHHHHHHHHHHHH
Q 033508           75 DIFDG-IFRCYAVVIAFFVALAETEWQFVLKFTKVLE  110 (118)
Q Consensus        75 dif~G-I~RcYaV~iA~fVvlaETEW~~i~kF~kvLe  110 (118)
                      +-..+ +|-+...++.++....=.+|..+|+-|.-.|
T Consensus        90 ~~~~~liFy~~~~~~~i~Fl~LAr~Wp~lm~~W~~vE  126 (414)
T PF06151_consen   90 NNIASLIFYVVCLLISILFLRLARRWPQLMREWSRVE  126 (414)
T ss_pred             eehhhhHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHH
Confidence            44455 6889999999888889999999999998876


No 3  
>PRK14756 hypothetical protein; Provisional
Probab=53.28  E-value=23  Score=21.24  Aligned_cols=21  Identities=24%  Similarity=0.317  Sum_probs=17.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHHh
Q 033508           47 YSVLTSLTALLCLAVNVLSAI   67 (118)
Q Consensus        47 fs~vTa~~AlLCi~vNvlSav   67 (118)
                      ||.+|.+.||..|++..+.|+
T Consensus         7 ~SL~tTvvaL~~Iva~~~ta~   27 (29)
T PRK14756          7 FSLVTTIIVLGLIVAVGLTAA   27 (29)
T ss_pred             hhHHHHHHHHHHHHHHHHHHh
Confidence            789999999998888766553


No 4  
>PHA03281 envelope glycoprotein E; Provisional
Probab=42.34  E-value=86  Score=29.65  Aligned_cols=41  Identities=20%  Similarity=0.302  Sum_probs=28.0

Q ss_pred             CCCCCCceEEehhhhHHHHHHHHHHHHHHHHHHHhhhccCcc
Q 033508           33 LRNRADPLLVVCRCYSVLTSLTALLCLAVNVLSAIRSFKNGS   74 (118)
Q Consensus        33 ~~~~~DplL~vcr~fs~vTa~~AlLCi~vNvlSavrsf~~~~   74 (118)
                      ...+.-|+++---..+-+ ++.||||+++..+-..+.|++..
T Consensus       546 s~~~~~p~~~y~~l~~~~-a~~~ll~l~~~~~c~~~~~~~~~  586 (642)
T PHA03281        546 SEPGTFPFKRYAAITGGF-AALALLCLAIALICTAKKFGHKA  586 (642)
T ss_pred             cccCCCCeEeehhhhhhh-HHHHHHHHHHHHHHHHHHhhhhe
Confidence            345567777654433322 46789999999998888887653


No 5  
>TIGR00769 AAA ADP/ATP carrier protein family. These proteins are members of the ATP:ADP Antiporter (AAA) Family (TC 2.A.12), which consists of nucleotide transporters that have 12 GES predicted transmembrane regions. One protein from Rickettsia prowazekii functions to take up ATP from the eukaryotic cell cytoplasm into the bacterium in exchange for ADP. Five AAA family paralogues are encoded within the genome of R. prowazekii. This organism transports UMP and GMP but not CMP, and it seems likely that one or more of the AAA family paralogues are responsible. The genome of Chlamydia trachomatis encodes two AAA family members, Npt1 and Npt2, which catalyse ATP/ADP exchange and GTP, CTP, ATP and UTP uptake probably employing a proton symport mechanism. Two homologous adenylate translocators of Arabidopsis thaliana are postulated to be localized to the intracellular plastid membrane where they function as ATP importers.
Probab=42.09  E-value=1.6e+02  Score=25.97  Aligned_cols=43  Identities=14%  Similarity=0.241  Sum_probs=32.3

Q ss_pred             ccccchhhhhHHHHHHHHHHHH---h--------------hhHHHHHHHHHHHHHHHhcc
Q 033508           74 SDIFDGIFRCYAVVIAFFVALA---E--------------TEWQFVLKFTKVLEYWVARV  116 (118)
Q Consensus        74 ~dif~GI~RcYaV~iA~fVvla---E--------------TEW~~i~kF~kvLeyW~gRG  116 (118)
                      +++|.-+.+.+...+.+|-.+.   +              +=-..+..++.++.+|..+.
T Consensus        74 ~~lf~~~~~~F~~~f~lF~~vl~p~~~~~~p~~~~~~~~~~~~~~~~~~i~~~~~W~~~~  133 (472)
T TIGR00769        74 EALFYTVISPFLGFFALFAFVIYPLSDLLHPTALADKLLSLLPPGFMGFIAILRIWSFAL  133 (472)
T ss_pred             HHhHHHHHHHHHHHHHHHHHHHhcchhhcCCcHHHHHHHhhcchhhHHHHHHHhhhhHHH
Confidence            6899999999999999888772   1              11223667888999998764


No 6  
>COG3768 Predicted membrane protein [Function unknown]
Probab=40.77  E-value=1.4e+02  Score=26.49  Aligned_cols=61  Identities=20%  Similarity=0.188  Sum_probs=44.5

Q ss_pred             HHHHHHHHHHHHHHHHH---HhhhccCcccccchhhhhHHHHHHHHHHHHhhhHHHHHHHHHHH
Q 033508           49 VLTSLTALLCLAVNVLS---AIRSFKNGSDIFDGIFRCYAVVIAFFVALAETEWQFVLKFTKVL  109 (118)
Q Consensus        49 ~vTa~~AlLCi~vNvlS---avrsf~~~~dif~GI~RcYaV~iA~fVvlaETEW~~i~kF~kvL  109 (118)
                      .+++...|+|.+|-.-|   ..+.|....-++=|..=+-++++.++|..+=|||-.++|+-++.
T Consensus        67 ~~~a~~vLf~~Av~~q~~qwi~d~~qr~dWl~~~a~~v~~l~vlagv~~v~rEw~rl~rL~~r~  130 (350)
T COG3768          67 MLGAGGVLFSLAVGLQSVQWIRDLFQRADWLGLGAAAVGALIVLAGVGSVVREWRRLVRLRQRQ  130 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            36677777887775544   34556444456666666778888999999999999999987764


No 7  
>PF11163 DUF2947:  Protein of unknown function (DUF2947);  InterPro: IPR021334  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=35.05  E-value=14  Score=28.86  Aligned_cols=18  Identities=22%  Similarity=0.429  Sum_probs=15.7

Q ss_pred             HHhhhHHHHHHHHHHHHH
Q 033508           94 LAETEWQFVLKFTKVLEY  111 (118)
Q Consensus        94 laETEW~~i~kF~kvLey  111 (118)
                      ++||.|+-|.|-||-+-|
T Consensus       108 iiET~W~vFkr~WknFLF  125 (153)
T PF11163_consen  108 IIETRWDVFKRNWKNFLF  125 (153)
T ss_pred             EEEeehHHHHHHHHHHhc
Confidence            579999999999997755


No 8  
>COG5074 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion]
Probab=33.05  E-value=25  Score=30.04  Aligned_cols=15  Identities=20%  Similarity=0.820  Sum_probs=12.0

Q ss_pred             hhhHHHHHHHHHHHH
Q 033508           81 FRCYAVVIAFFVALA   95 (118)
Q Consensus        81 ~RcYaV~iA~fVvla   95 (118)
                      .|||+|+|.++++++
T Consensus       251 i~c~gI~~iii~viv  265 (280)
T COG5074         251 IRCYGICFIIIIVIV  265 (280)
T ss_pred             eehhhhHHHHHHHHH
Confidence            589999988877654


No 9  
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=31.71  E-value=16  Score=34.01  Aligned_cols=26  Identities=35%  Similarity=0.569  Sum_probs=23.3

Q ss_pred             ccc----chhhhhHHHHHHHHH-HHHhhhHH
Q 033508           75 DIF----DGIFRCYAVVIAFFV-ALAETEWQ  100 (118)
Q Consensus        75 dif----~GI~RcYaV~iA~fV-vlaETEW~  100 (118)
                      |.|    +||+|.||.+|.+=. +.+=|+|+
T Consensus       468 d~YleRm~Gi~rLYAAIi~l~~p~~~~~~~h  498 (591)
T KOG2412|consen  468 DAYLERMDGIMRLYAAIIQLDIPVGNATNVH  498 (591)
T ss_pred             chHHHHhHhHHHHHHHHHHhcccccCCCCCC
Confidence            788    899999999999888 88888888


No 10 
>PF11712 Vma12:  Endoplasmic reticulum-based factor for assembly of V-ATPase;  InterPro: IPR021013 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [].  The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum []. 
Probab=31.62  E-value=1.6e+02  Score=21.39  Aligned_cols=23  Identities=22%  Similarity=0.277  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHhhhHHHHHHHHH
Q 033508           84 YAVVIAFFVALAETEWQFVLKFTK  107 (118)
Q Consensus        84 YaV~iA~fVvlaETEW~~i~kF~k  107 (118)
                      -+++.|++|.+||+ |=++.+++|
T Consensus       115 lgl~~al~vlvAEv-~l~~~y~~k  137 (142)
T PF11712_consen  115 LGLFGALLVLVAEV-VLYIRYLRK  137 (142)
T ss_pred             HHHHHHHHHHHHHH-HHHHHHHhh
Confidence            46778889999997 333444433


No 11 
>PF07444 Ycf66_N:  Ycf66 protein N-terminus;  InterPro: IPR010004 This entry represents Ycf66, a protein that is restricted to the chloroplasts of simple plants and algae. It is also found in the cyanobacteria. The function is unknown. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=30.57  E-value=2e+02  Score=20.35  Aligned_cols=27  Identities=22%  Similarity=0.205  Sum_probs=22.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhhccCc
Q 033508           47 YSVLTSLTALLCLAVNVLSAIRSFKNG   73 (118)
Q Consensus        47 fs~vTa~~AlLCi~vNvlSavrsf~~~   73 (118)
                      |+.-+.++.++-++...+-..|.++..
T Consensus         5 ~~~~~iLgi~l~~~~~~Ly~lr~~~Pe   31 (84)
T PF07444_consen    5 FGPSYILGIILILGGLALYFLRFFRPE   31 (84)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHCcc
Confidence            456677888888889999999999877


No 12 
>PLN00039 photosystem II reaction center Psb28 protein; Provisional
Probab=30.28  E-value=32  Score=25.80  Aligned_cols=18  Identities=22%  Similarity=0.582  Sum_probs=13.4

Q ss_pred             HHHHHHhhhHHHHHHHHH
Q 033508           90 FFVALAETEWQFVLKFTK  107 (118)
Q Consensus        90 ~fVvlaETEW~~i~kF~k  107 (118)
                      .++.=-|.||+++|+|-.
T Consensus        81 ~y~m~s~~~WdRFMRFMe   98 (111)
T PLN00039         81 KYVMRSPREWDRFMRFME   98 (111)
T ss_pred             EEEECCHHHHHHHHHHHH
Confidence            344456889999999964


No 13 
>PF13705 TRC8_N:  TRC8 N-terminal domain
Probab=29.87  E-value=52  Score=30.05  Aligned_cols=68  Identities=25%  Similarity=0.378  Sum_probs=36.1

Q ss_pred             eEEehhhhHHHHHHHHHHHHHHHHHHHhhhccCcccccchhhhhHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHhc
Q 033508           40 LLVVCRCYSVLTSLTALLCLAVNVLSAIRSFKNGSDIFDGIFRCYAVVIAFFVALAETEWQFVLKFTKVLEYWVAR  115 (118)
Q Consensus        40 lL~vcr~fs~vTa~~AlLCi~vNvlSavrsf~~~~dif~GI~RcYaV~iA~fVvlaETEW~~i~kF~kvLeyW~gR  115 (118)
                      ++.++.+-...|++..+--+.-|.....+.-|   .-+.-+.|.||.     ..++|+||.++-==.-..-||..|
T Consensus       174 l~~~~~~a~~~~~~~v~~~~~~~~~~~~~~v~---~~~~~~~~~~Gl-----~~l~~~~W~rL~vP~vl~vFWl~~  241 (508)
T PF13705_consen  174 LLIVHNFALWLTILEVLYFILSNYPVPYRFVK---TAYRHMYENYGL-----QALVESLWNRLRVPEVLRVFWLTR  241 (508)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCccchHHHHH---HHHHHHHHHhhH-----HHHHHHHHhhhcchhhHHHHHHHH
Confidence            34444444444444444444444444333321   222445666764     578999999875444444567654


No 14 
>PRK13610 photosystem II reaction center protein Psb28; Provisional
Probab=29.77  E-value=33  Score=25.91  Aligned_cols=17  Identities=12%  Similarity=0.321  Sum_probs=12.7

Q ss_pred             HHHHHhhhHHHHHHHHH
Q 033508           91 FVALAETEWQFVLKFTK  107 (118)
Q Consensus        91 fVvlaETEW~~i~kF~k  107 (118)
                      ++.=-|.||++||+|-.
T Consensus        88 y~m~s~~~WdRFMRFMe  104 (113)
T PRK13610         88 YNWNSEEAFERFMRFAS  104 (113)
T ss_pred             EEECCHHHHHHHHHHHH
Confidence            34446889999999964


No 15 
>TIGR03047 PS_II_psb28 photosystem II reaction center protein Psb28. Members of this protein family are the Psb28 protein of photosystem II. Two different protein families, apparently without homology between them, have been designated PsbW. Cyanobacterial proteins previously designated PsbW are members of the family described here. However, while members of the plant PsbW family are not found (so far) in Cyanobacteria, members of the present family do occur in plants. We therefore support the alternative designation that has emerged for this protein family, Psp28, rather than PsbW.
Probab=29.53  E-value=34  Score=25.61  Aligned_cols=19  Identities=26%  Similarity=0.725  Sum_probs=14.1

Q ss_pred             HHHHHHHhhhHHHHHHHHH
Q 033508           89 AFFVALAETEWQFVLKFTK  107 (118)
Q Consensus        89 A~fVvlaETEW~~i~kF~k  107 (118)
                      |.++.=-|.||+++|+|-.
T Consensus        79 a~y~m~s~~~WdRFMRFme   97 (109)
T TIGR03047        79 AVYIMKSEDEWDRFMRFME   97 (109)
T ss_pred             EEEEECCHHHHHHHHHHHH
Confidence            3444556889999999965


No 16 
>PRK13612 photosystem II reaction center protein Psb28; Provisional
Probab=28.98  E-value=35  Score=25.68  Aligned_cols=18  Identities=22%  Similarity=0.624  Sum_probs=13.2

Q ss_pred             HHHHHHhhhHHHHHHHHH
Q 033508           90 FFVALAETEWQFVLKFTK  107 (118)
Q Consensus        90 ~fVvlaETEW~~i~kF~k  107 (118)
                      .++.=-|.||+++|+|-.
T Consensus        83 ~y~m~s~~~WdRFMRFMe  100 (113)
T PRK13612         83 TYIWKSEQEWDRFMRFME  100 (113)
T ss_pred             EEEECCHHHHHHHHHHHH
Confidence            344446889999999964


No 17 
>PF05805 L6_membrane:  L6 membrane protein;  InterPro: IPR008661 This family consists of several eukaryotic L6 membrane proteins. L6, IL-TMP, and TM4SF5 are cell surface proteins predicted to have four transmembrane domains. Previous sequence analysis led to their assignment as members of the tetraspanin superfamily it has now been found that that they are not significantly related to genuine tetraspanins, but instead constitute their own L6 family []. Several members of this family have been implicated in Homo sapiens cancer [, ].; GO: 0016021 integral to membrane
Probab=27.47  E-value=62  Score=26.06  Aligned_cols=24  Identities=33%  Similarity=0.551  Sum_probs=20.1

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHh
Q 033508           44 CRCYSVLTSLTALLCLAVNVLSAI   67 (118)
Q Consensus        44 cr~fs~vTa~~AlLCi~vNvlSav   67 (118)
                      -||..+.-...|++|+++|.+=-+
T Consensus         7 arclG~sLl~Lal~~iiaNilL~F   30 (195)
T PF05805_consen    7 ARCLGFSLLPLALLCIIANILLFF   30 (195)
T ss_pred             hhhhhhHHHHHHHHHHHHHHheec
Confidence            378888888999999999999433


No 18 
>PF04588 HIG_1_N:  Hypoxia induced protein conserved region;  InterPro: IPR007667 The hypoxia induced gene 1 (HIG1) or hypoglycemia/hypoxia inducible mitochondrial protein (HIMP1) is up-regulated by stresses of the microenvironment such as low oxygen or low glucose conditions. HIG1 is a mitochondrial inner membrane protein, which is ubiquitously expressed. It is predicted to be an integral membrane protein consisting of two hydrophobic helices, 21-23 residues in length that might tend to form a hairpin-like loop across the bilayer. HIG1 could be implied in apoptotic or cytoprotective signals. HIG1 is a member of a well conserved eukaryote protein family. The predicted transmembrane helice (TMH) and loop regions represent the most highly conserved regions in these proteins [, ]. The profile we developed covers the predicted TMH and loop regions. This domain is found in proteins thought to be involved in the response to hypoxia []. It is also found in altered inheritance of mitochondria proteins.; PDB: 2LOM_A 2LON_A.
Probab=27.07  E-value=1.7e+02  Score=18.41  Aligned_cols=40  Identities=15%  Similarity=0.221  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHhhhccCcccccch-h--hhhHHHHHHHHHHH
Q 033508           55 ALLCLAVNVLSAIRSFKNGSDIFDG-I--FRCYAVVIAFFVAL   94 (118)
Q Consensus        55 AlLCi~vNvlSavrsf~~~~dif~G-I--~RcYaV~iA~fVvl   94 (118)
                      +++.++.=+....++|+.++..-.- +  .|+|+=.+++...+
T Consensus        10 g~~~~~~~l~~g~~~~~~g~~~~s~klmr~RV~aQ~~tv~~l~   52 (54)
T PF04588_consen   10 GMLATVGALAYGLYNFRRGNMKTSQKLMRARVYAQGLTVAALV   52 (54)
T ss_dssp             HHHHHHHHHHHHHHHHTSSS----SSSSS-SHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444477788888877433333 3  69998877777655


No 19 
>CHL00128 psbW photosystem II protein W; Reviewed
Probab=26.43  E-value=41  Score=25.30  Aligned_cols=19  Identities=16%  Similarity=0.579  Sum_probs=13.9

Q ss_pred             HHHHHHHhhhHHHHHHHHH
Q 033508           89 AFFVALAETEWQFVLKFTK  107 (118)
Q Consensus        89 A~fVvlaETEW~~i~kF~k  107 (118)
                      |.++.=-|.||+++|+|-.
T Consensus        82 a~y~m~s~~~WdRFMRFMe  100 (113)
T CHL00128         82 AIYIMKNPEAWDRFMRFME  100 (113)
T ss_pred             EEEEECCHHHHHHHHHHHH
Confidence            3444556889999999964


No 20 
>PRK13611 photosystem II reaction center protein Psb28; Provisional
Probab=25.64  E-value=44  Score=24.86  Aligned_cols=17  Identities=29%  Similarity=0.655  Sum_probs=12.9

Q ss_pred             HHHHHhhhHHHHHHHHH
Q 033508           91 FVALAETEWQFVLKFTK  107 (118)
Q Consensus        91 fVvlaETEW~~i~kF~k  107 (118)
                      ++.--|.||+++|+|-.
T Consensus        77 y~m~s~~~wdRFMRFme   93 (104)
T PRK13611         77 YDMETEAEWDRFLRFME   93 (104)
T ss_pred             EEECCHHHHHHHHHHHH
Confidence            44446889999999964


No 21 
>PF03912 Psb28:  Psb28 protein;  InterPro: IPR005610 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein Psb28 (PsbW) found in PSII, where it is a subunit of the oxygen-evolving complex. Psb28 appears to have several roles, including guiding PSII biogenesis and assembly, stabilising dimeric PSII [], and facilitating PSII repair after photo-inhibition []. There appears to be two classes of Psb28, class 1 being found predominantly in algae and cyanobacteria, and class 2 being found predominantly in plants. This entry represents class 1 Psb28.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0016020 membrane; PDB: 2KVO_A.
Probab=24.07  E-value=45  Score=24.88  Aligned_cols=12  Identities=33%  Similarity=0.894  Sum_probs=10.2

Q ss_pred             hhhHHHHHHHHH
Q 033508           96 ETEWQFVLKFTK  107 (118)
Q Consensus        96 ETEW~~i~kF~k  107 (118)
                      +-||+++|+|-.
T Consensus        86 ~~~WdRFMRFMe   97 (108)
T PF03912_consen   86 EEEWDRFMRFME   97 (108)
T ss_dssp             SHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            679999999964


No 22 
>PF11628 TCR_zetazeta:  T-cell surface glycoprotein CD3 zeta chain;  InterPro: IPR021663 The TCR complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer co-expressed at the cell surface with the invariant subunits of CD3 labelled gamma, delta, epsilon, zeta, and eta []. The zeta subunit forms either homodimers or heterodimers with eta [], but eta homodimers have not been observed. The structure of the zetazeta transmembrane dimer consists of a left-handed coiled coil with polar contacts. Two aspartic acids are critical for zetazeta dimerisation and assembly with TCR [].  The high affinity immunoglobulin epsilon receptor (IgE Fc receptor) subunit gamma associates with a variety of FcR alpha chains to form a functional signaling complex. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface and regulates several aspects of the immune response []. This family includes both CD3 zeta subunits and IgE Fc receptor gamma subunits. The gamma chain of the high affinity Fc receptor for IgE has significant structural homology to CD3 zeta and the related CD3 eta subunit and can facilitate T cell receptor expression and signaling in the absence of CD3 zeta and CD3 eta [].; PDB: 2HAC_B.
Probab=23.16  E-value=69  Score=19.65  Aligned_cols=18  Identities=33%  Similarity=0.628  Sum_probs=15.0

Q ss_pred             cccchhhhhHHHHHHHHH
Q 033508           75 DIFDGIFRCYAVVIAFFV   92 (118)
Q Consensus        75 dif~GI~RcYaV~iA~fV   92 (118)
                      +|-|||+=.|||++-.+.
T Consensus         6 YiLDgiL~iYgiiiT~L~   23 (33)
T PF11628_consen    6 YILDGILFIYGIIITALY   23 (33)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             eeHHHHHHHHHHHHHHHH
Confidence            577999999999987654


No 23 
>PF04750 Far-17a_AIG1:  FAR-17a/AIG1-like protein;  InterPro: IPR006838 This entry includes the hamster androgen-induced FAR-17a protein (Q60534 from SWISSPROT) []. The function of these proteins is unknown but it is thought to have a central role in the fusion process during myogenesis, within the somatic mesoderm. This entry also includes homologous regions from a number of other metazoan proteins.; GO: 0016021 integral to membrane
Probab=22.75  E-value=1.1e+02  Score=22.52  Aligned_cols=53  Identities=17%  Similarity=0.226  Sum_probs=36.4

Q ss_pred             EehhhhHHHHHHHHHHHHHHHHHHHhhhccCcc--ccc-chhhhhHHHHHHHHHHH
Q 033508           42 VVCRCYSVLTSLTALLCLAVNVLSAIRSFKNGS--DIF-DGIFRCYAVVIAFFVAL   94 (118)
Q Consensus        42 ~vcr~fs~vTa~~AlLCi~vNvlSavrsf~~~~--dif-~GI~RcYaV~iA~fVvl   94 (118)
                      ....-|.++|-++..++++...++.+..++..+  ..+ +-++..-+.-++++|.+
T Consensus        30 ~~gg~~~fLT~~~~~~~~~~~~~~~~~d~~~~~~l~~~~~~~~~~~~~pl~~~V~~   85 (201)
T PF04750_consen   30 SYGGRFKFLTNWSLVLQTIYFILALLCDLFSSRKLRKLRDWLFYSLAFPLEFIVTV   85 (201)
T ss_pred             hhcCcceehhHHHHHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHHHhcchh
Confidence            344678999999999999999999999774442  222 44555555555555443


No 24 
>PHA02815 hypothetical protein; Provisional
Probab=22.56  E-value=1.9e+02  Score=20.12  Aligned_cols=25  Identities=12%  Similarity=0.409  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHhhhHHHHHHHHHHHH
Q 033508           86 VVIAFFVALAETEWQFVLKFTKVLE  110 (118)
Q Consensus        86 V~iA~fVvlaETEW~~i~kF~kvLe  110 (118)
                      |+|.+|..+-=-.|+++++||.-++
T Consensus         7 I~~~~ylLl~Lv~wsyv~~~~~~iK   31 (64)
T PHA02815          7 IVISLYLLFQLVNCFYLFKLFNKIK   31 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5677777777789999999997654


No 25 
>PHA01399 membrane protein P6
Probab=22.34  E-value=4e+02  Score=22.43  Aligned_cols=57  Identities=23%  Similarity=0.556  Sum_probs=28.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhhccCcccccchhhhhHHHHHHHHHHHHhhhHHHHHHHHHHHHH-HH
Q 033508           50 LTSLTALLCLAVNVLSAIRSFKNGSDIFDGIFRCYAVVIAFFVALAETEWQFVLKFTKVLEY-WV  113 (118)
Q Consensus        50 vTa~~AlLCi~vNvlSavrsf~~~~dif~GI~RcYaV~iA~fVvlaETEW~~i~kF~kvLey-W~  113 (118)
                      +.++-|++-+.-...|.+-+|  -+.||+-|    +|+. +++.++--.|-++-.|.-++++ |.
T Consensus        30 v~~ika~vk~ikkivsvi~~f--iskifs~i----g~il-~~il~~~~awf~fpa~IAIIKNLWE   87 (242)
T PHA01399         30 VKAIKAIVKIIKKIVSVILDF--ISKIFSKI----GIIL-IIILIIIAAWFFFPAFAAFLQSAWA   87 (242)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH--HHHHHHhc----cHHH-HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344445555555566666666  34455433    2221 1122222356666667666666 63


No 26 
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=21.68  E-value=92  Score=28.57  Aligned_cols=20  Identities=20%  Similarity=0.209  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHhhhc
Q 033508           51 TSLTALLCLAVNVLSAIRSF   70 (118)
Q Consensus        51 Ta~~AlLCi~vNvlSavrsf   70 (118)
                      .||.|=|--.-++-|.+|+-
T Consensus       265 ~AlFaqlNqGe~iTsgLkkV  284 (480)
T KOG2675|consen  265 GALFAQLNQGEGITSGLKKV  284 (480)
T ss_pred             HHHHHHHhccchhhhhhhhC
Confidence            34555555555666666654


No 27 
>KOG3419 consensus Mitochondrial/chloroplast ribosomal protein S16 [Translation, ribosomal structure and biogenesis]
Probab=21.47  E-value=50  Score=25.02  Aligned_cols=10  Identities=30%  Similarity=0.817  Sum_probs=8.1

Q ss_pred             HHHHHhccCC
Q 033508          109 LEYWVARVLQ  118 (118)
Q Consensus       109 LeyW~gRGm~  118 (118)
                      ++||+|.|-|
T Consensus        59 ikyWl~~GAq   68 (112)
T KOG3419|consen   59 IKYWLGVGAQ   68 (112)
T ss_pred             HHHHHhcCCc
Confidence            5799999865


No 28 
>KOG1908 consensus Ribonuclease inhibitor type leucine-rich repeat proteins [RNA processing and modification]
Probab=21.47  E-value=86  Score=24.99  Aligned_cols=12  Identities=33%  Similarity=0.603  Sum_probs=7.5

Q ss_pred             CCCCCCCCCCCC
Q 033508           15 PPQPQPPPPPAR   26 (118)
Q Consensus        15 ~~~p~~~~~~~~   26 (118)
                      +|+||||++++.
T Consensus         3 A~p~~~~sh~Aa   14 (165)
T KOG1908|consen    3 APPEAPPSHGAA   14 (165)
T ss_pred             CCCCCCCCCCCc
Confidence            356677776664


No 29 
>PRK00040 rpsP 30S ribosomal protein S16; Reviewed
Probab=21.10  E-value=52  Score=22.63  Aligned_cols=11  Identities=27%  Similarity=0.637  Sum_probs=8.0

Q ss_pred             HHHHHHhccCC
Q 033508          108 VLEYWVARVLQ  118 (118)
Q Consensus       108 vLeyW~gRGm~  118 (118)
                      -++||++.|-|
T Consensus        56 ri~~Wl~~GAq   66 (75)
T PRK00040         56 RVLYWLGQGAQ   66 (75)
T ss_pred             HHHHHHHCCCc
Confidence            35788888865


No 30 
>KOG3030 consensus Lipid phosphate phosphatase and related enzymes of the PAP2 family [Lipid transport and metabolism]
Probab=20.54  E-value=1.4e+02  Score=25.35  Aligned_cols=33  Identities=24%  Similarity=0.483  Sum_probs=22.8

Q ss_pred             HHHHHHHHhhhccCc-ccccchhhhhHHHHHHHHHH
Q 033508           59 LAVNVLSAIRSFKNG-SDIFDGIFRCYAVVIAFFVA   93 (118)
Q Consensus        59 i~vNvlSavrsf~~~-~dif~GI~RcYaV~iA~fVv   93 (118)
                      .++=.+|=|..|||. +|++.|.+  -|+++|.++.
T Consensus       225 A~~v~lSRV~DYkHHwsDV~aG~l--iG~~~A~~~~  258 (317)
T KOG3030|consen  225 ALLVGLSRVSDYKHHWSDVLAGAL--IGAFVAYFLY  258 (317)
T ss_pred             HHHHeeehhcccccccHHHHHHHH--HHHHHHHHHH
Confidence            334457888899999 89999964  2555555543


No 31 
>PF08551 DUF1751:  Eukaryotic integral membrane protein (DUF1751);  InterPro: IPR013861  This entry is found in eukaryotic integral membrane proteins. Q12239 from SWISSPROT, a Saccharomyces cerevisiae (Baker's yeast) protein, has been shown to localise COP II vesicles []. 
Probab=20.44  E-value=1e+02  Score=21.39  Aligned_cols=47  Identities=21%  Similarity=0.239  Sum_probs=28.5

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHHhhhccCc--ccccchhhhhHHHHHHHHHH
Q 033508           44 CRCYSVLTSLTALLCLAVNVLSAIRSFKNG--SDIFDGIFRCYAVVIAFFVA   93 (118)
Q Consensus        44 cr~fs~vTa~~AlLCi~vNvlSavrsf~~~--~dif~GI~RcYaV~iA~fVv   93 (118)
                      .+++.+++.++.++..++..+.-.-+.+..  .-.++|-   ++++.+++|+
T Consensus        48 lkFi~vv~~~tnl~~~~~~~~~y~i~~~~~~l~~~i~G~---~~~~~g~lVa   96 (99)
T PF08551_consen   48 LKFILVVNVITNLLTFLLYLLLYAITGNESYLFVPISGF---MGVLAGFLVA   96 (99)
T ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHhCCCceeEEEecCc---HHhHhheEEE
Confidence            567777777777777666665555444333  1234443   6777776664


No 32 
>PF06459 RR_TM4-6:  Ryanodine Receptor TM 4-6;  InterPro: IPR009460  The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity []. This region covers TM regions 4-6 of the ryanodine receptor 1 family.; GO: 0005219 ryanodine-sensitive calcium-release channel activity, 0006874 cellular calcium ion homeostasis, 0016021 integral to membrane
Probab=20.28  E-value=81  Score=26.27  Aligned_cols=19  Identities=26%  Similarity=0.481  Sum_probs=16.6

Q ss_pred             ehhhhHHHHHHHHHHHHHH
Q 033508           43 VCRCYSVLTSLTALLCLAV   61 (118)
Q Consensus        43 vcr~fs~vTa~~AlLCi~v   61 (118)
                      +.|||+++=.+.+++|++-
T Consensus       246 ~Lr~lAvlHtiiSf~clIg  264 (274)
T PF06459_consen  246 ALRILAVLHTIISFACLIG  264 (274)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3699999999999999863


Done!