Citrus Sinensis ID: 033530

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------

MKLVRFLMKLNNETVSIELKNGTIVHGTITGVDISMNTHLKTVKLTLKGKNPVNLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGIDIISQIKLHSCVHCFCVCFFS

ccHHHHHHHccccEEEEEEccccEEEEEEcEEcccccEEEEEEEEECcccccEEccEEEECccEEEEEEcccccccHHHHHccccccccccccccccHHHHHHHcccccccEEEEcc

MKLVRFLMKLNNETVSIELKNGTIVHGTITGVDISMNTHLKTVKLTLKGKNPVNLDHLSVRGNNIRYYILPDSLNLETLLVEETPRV*****TAGIDIISQIKLHSCVHCFCVCFFS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKLVRFLMKLNNETVSIELKNGTIVHGTITGVDISMNTHLKTVKLTLKGKNPVNLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGIDIISQIKLHSCVHCFCVCFFS

Annotation	Function Description	Confidence Level	Reference Protein
Small nuclear ribonucleoprotein Sm D1	May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.	probable	P62314
Small nuclear ribonucleoprotein Sm D1	May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.	probable	P62315
Probable small nuclear ribonucleoprotein Sm D1	Essential for pre-mRNA splicing. Implicated in the formation of stable, biologically active snRNP structures.	probable	Q9VU02

No EC number assigned to the protein, probably not an enzyme!

Template: 1B34, chain A
Confidence level:very confident
Coverage over the Query: 2-81
View the alignment between query and template
View the model in PyMOL