Query         033540
Match_columns 117
No_of_seqs    33 out of 35
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 03:28:26 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033540.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033540hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG3630 OadG Na+-transporting   71.4     2.5 5.4E-05   30.3   1.4   18    5-22     17-34  (84)
  2 PF04995 CcmD:  Heme exporter p  58.9     5.9 0.00013   24.3   1.2   19    2-20      9-27  (46)
  3 TIGR03141 cytochro_ccmD heme e  55.7     7.1 0.00015   24.0   1.2   17    2-18     10-26  (45)
  4 cd06918 ChtBD1_like Domain obs  50.9     7.8 0.00017   25.1   0.9   22   85-115    27-48  (51)
  5 PF11478 Tachystatin_B:  Antimi  40.1      20 0.00043   22.9   1.4   21   85-105    17-39  (42)
  6 smart00765 MANEC The MANEC dom  35.9      24 0.00053   25.0   1.5   22   86-109    67-88  (93)
  7 PF07502 MANEC:  MANEC domain;   34.0      34 0.00073   24.0   2.0   20   88-109    68-87  (92)
  8 PF11837 DUF3357:  Domain of un  33.7      14  0.0003   26.2   0.0   12    9-20     37-48  (106)
  9 PF02950 Conotoxin:  Conotoxin;  33.4      37 0.00081   21.5   2.0   14   77-90     52-67  (75)
 10 KOG4623 Uncharacterized conser  26.6      20 0.00044   33.3  -0.2   35   39-73    116-151 (611)
 11 PF10960 DUF2762:  Protein of u  24.1      42 0.00092   22.9   1.1   18    7-24     14-31  (71)
 12 PF11674 DUF3270:  Protein of u  21.7      62  0.0014   23.2   1.6   17    6-22     53-70  (90)
 13 PF06783 UPF0239:  Uncharacteri  21.5      96  0.0021   22.3   2.5   19    4-22     24-44  (85)
 14 PF09451 ATG27:  Autophagy-rela  21.4 1.7E+02  0.0037   23.3   4.2   55    6-67    205-262 (268)

No 1  
>COG3630 OadG Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, gamma subunit [Energy production and conversion]
Probab=71.42  E-value=2.5  Score=30.32  Aligned_cols=18  Identities=39%  Similarity=0.669  Sum_probs=11.7

Q ss_pred             hhHHHHHHHHHHHhhccC
Q 033540            5 GVSFSLLFLLILANVISP   22 (117)
Q Consensus         5 ~~~~~~~fl~~~a~v~~~   22 (117)
                      |+.|-++||+||+-+|-.
T Consensus        17 Gmg~VflfL~iLi~~~~~   34 (84)
T COG3630          17 GMGFVFLFLSILIYAMRG   34 (84)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            566667777777765543


No 2  
>PF04995 CcmD:  Heme exporter protein D (CcmD);  InterPro: IPR007078 The CcmD protein is part of a C-type cytochrome biogenesis operon []. The exact function of this protein is uncertain. It has been proposed that CcmC, CcmD and CcmE interact directly with each other, establishing a cytoplasm to periplasm haem delivery pathway for cytochrome c maturation []. This protein is found fused to CcmE in P52224 from SWISSPROT. These proteins contain a predicted transmembrane helix.; GO: 0006810 transport, 0016021 integral to membrane
Probab=58.86  E-value=5.9  Score=24.32  Aligned_cols=19  Identities=37%  Similarity=0.418  Sum_probs=13.5

Q ss_pred             CCchhHHHHHHHHHHHhhc
Q 033540            2 SAYGVSFSLLFLLILANVI   20 (117)
Q Consensus         2 ~~~~~~~~~~fl~~~a~v~   20 (117)
                      +|||+++.+|...++.++.
T Consensus         9 ~sYg~t~~~l~~l~~~~~~   27 (46)
T PF04995_consen    9 SSYGVTALVLAGLIVWSLR   27 (46)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            5899998777766666543


No 3  
>TIGR03141 cytochro_ccmD heme exporter protein CcmD. The model for this protein family describes a small, hydrophobic, and only moderately well-conserved protein, tricky to identify accurately for all of these reasons. However, members are found as part of large operons involved in heme export across the inner membrane for assembly of c-type cytochromes in a large number of bacteria. The gray zone between the trusted cutoff (13.0) and noise cutoff (4.75) includes both low-scoring examples and false-positive matches to hydrophobic domains of longer proteins.
Probab=55.73  E-value=7.1  Score=23.97  Aligned_cols=17  Identities=41%  Similarity=0.458  Sum_probs=11.4

Q ss_pred             CCchhHHHHHHHHHHHh
Q 033540            2 SAYGVSFSLLFLLILAN   18 (117)
Q Consensus         2 ~~~~~~~~~~fl~~~a~   18 (117)
                      +|||++|.+|..+++.+
T Consensus        10 ~sYg~t~l~l~~li~~~   26 (45)
T TIGR03141        10 LAYGITALVLAGLILWS   26 (45)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            57888877666655554


No 4  
>cd06918 ChtBD1_like Domain observed in several metazoan proteins. The pattern of conserved cysteine residues resembles that of chitin binding domains found in plants and fungi.
Probab=50.89  E-value=7.8  Score=25.10  Aligned_cols=22  Identities=36%  Similarity=1.174  Sum_probs=19.4

Q ss_pred             CCceeeeecCCCCCCeeeeeeeccccccCcc
Q 033540           85 SPCCYAINCNIPNKPFGFCSFTPQTCNCLRC  115 (117)
Q Consensus        85 t~CCY~InCniP~kPFG~CsFtP~tC~C~gC  115 (117)
                      +|||.         +.|+|--++..|+|.+|
T Consensus        27 ~pCCS---------~~gwCG~t~~hC~C~~C   48 (51)
T cd06918          27 KPCCS---------NGGYCGSGSEHCDCPGC   48 (51)
T ss_pred             CcccC---------CCceeCCCcccccCCCC
Confidence            78886         56999999999999998


No 5  
>PF11478 Tachystatin_B:  Antimicrobial chitin binding protein tachystatin B;  InterPro: IPR020957  Tachystatin B is an antimicrobial chitin binding peptide and consists of two isotopes B1 and B2. Both structures contain a short antiparallel beta sheet with an inhibitory cysteine knot motif. Tyr(14) and Arg(17) are thought to be the essential residues for chitin binding []. ; PDB: 2DCW_A 2DCV_A.
Probab=40.06  E-value=20  Score=22.91  Aligned_cols=21  Identities=38%  Similarity=1.091  Sum_probs=15.7

Q ss_pred             CCceeeeec--CCCCCCeeeeee
Q 033540           85 SPCCYAINC--NIPNKPFGFCSF  105 (117)
Q Consensus        85 t~CCY~InC--niP~kPFG~CsF  105 (117)
                      -.||+..-|  +.||--||.||-
T Consensus        17 rsccfgyycrrdfpgsifgtcsr   39 (42)
T PF11478_consen   17 RSCCFGYYCRRDFPGSIFGTCSR   39 (42)
T ss_dssp             S-BSTTEEEEESSTT-SEEEEEE
T ss_pred             CceEeEEEEcccCCCceeeeeec
Confidence            357888777  799999999983


No 6  
>smart00765 MANEC The MANEC domain was formerly called MANSC. This domain, comprising 8 conserved cysteines, is found in the N terminus of higher multicellular animal membrane and extracellular proteins. It is postulated that this domain may play a role in the formation of protein complexes involving various protease activators and inhibitors. It is possible that some of the cysteine residues in the MANSC domain form structurally important disulfide bridges. All of the MANSC-containing proteins contain predicted transmembrane regions and signal peptides. It has been proposed that the MANSC domain in HAI-1 might function through binding with hepatocyte growth factor activator and matriptase.
Probab=35.85  E-value=24  Score=25.02  Aligned_cols=22  Identities=41%  Similarity=1.040  Sum_probs=16.9

Q ss_pred             CceeeeecCCCCCCeeeeeeeccc
Q 033540           86 PCCYAINCNIPNKPFGFCSFTPQT  109 (117)
Q Consensus        86 ~CCY~InCniP~kPFG~CsFtP~t  109 (117)
                      +=||-|||..|++  -.|.|.|++
T Consensus        67 ~~CyLf~C~~~~~--~vC~f~~~~   88 (93)
T smart00765       67 GNCYLFNCTYPGK--EVCKFKPHE   88 (93)
T ss_pred             CceEEEEcCCCCc--ccccccccc
Confidence            4499999998876  368888764


No 7  
>PF07502 MANEC:  MANEC domain;  InterPro: IPR011106 The MANSC (motif at N terminus with seven cysteines) domain is a module with a well-conserved seven cysteine motif that is present at the N terminus of higher multicellular animal membrane and extracellular proteins. It is possible that some of the cysteine residues in the MANSC domain form structurally important disulphide bridges. All of the MANSC-containing proteins contain predicted transmembrane regions and signal peptides. It has been proposed that the MANSC domain in HAI-1 might function through binding with hepatocyte growth factor activator and matriptase [].
Probab=33.97  E-value=34  Score=23.97  Aligned_cols=20  Identities=45%  Similarity=1.072  Sum_probs=16.7

Q ss_pred             eeeeecCCCCCCeeeeeeeccc
Q 033540           88 CYAINCNIPNKPFGFCSFTPQT  109 (117)
Q Consensus        88 CY~InCniP~kPFG~CsFtP~t  109 (117)
                      ||-+||..|++  -.|.|+|++
T Consensus        68 CyLf~C~~~~~--~~C~f~~~~   87 (92)
T PF07502_consen   68 CYLFNCLYPGK--FVCKFKPHK   87 (92)
T ss_pred             EEEEEcCCCCC--CeeeccccC
Confidence            99999998874  479998874


No 8  
>PF11837 DUF3357:  Domain of unknown function (DUF3357);  InterPro: IPR021792  This entry represents the N-terminal domain of beta-fructofuranosidase, whcih is involved in the hydrolysis of terminal non-reducing beta-D-fructofuranoside residues in beta-D-fructofuranosides. ; GO: 0004564 beta-fructofuranosidase activity, 0004575 sucrose alpha-glucosidase activity; PDB: 3UGG_A 3UGH_B 3UGF_B.
Probab=33.75  E-value=14  Score=26.24  Aligned_cols=12  Identities=67%  Similarity=0.916  Sum_probs=0.0

Q ss_pred             HHHHHHHHHhhc
Q 033540            9 SLLFLLILANVI   20 (117)
Q Consensus         9 ~~~fl~~~a~v~   20 (117)
                      +++||++|+.+|
T Consensus        37 s~~~ll~lval~   48 (106)
T PF11837_consen   37 SLLFLLSLVALI   48 (106)
T ss_dssp             ------------
T ss_pred             HHHHHHHHHHHH
Confidence            567777777777


No 9  
>PF02950 Conotoxin:  Conotoxin;  InterPro: IPR004214 Cone snail toxins, conotoxins, are small neurotoxic peptides with disulphide connectivity that target ion-channels or G-protein coupled receptors. Based on the number and pattern of disulphide bonds and biological activities, conotoxins can be classified into several families []. Omega, delta and kappa families of conotoxins have a knottin or inhibitor cysteine knot scaffold. The knottin scaffold is a very special disulphide-through-disulphide knot, in which the III-VI disulphide bond crosses the macrocycle formed by two other disulphide bonds (I-IV and II-V) and the interconnecting backbone segments, where I-VI indicates the six cysteine residues starting from the N terminus.  The disulphide bonding network, as well as specific amino acids in inter-cysteine loops, provide the specificity of conotoxins []. The cysteine arrangements are the same for omega, delta and kappa families, even though omega conotoxins are calcium channel blockers, whereas delta conotoxins delay the inactivation of sodium channels, and kappa conotoxins are potassium channel blockers []. Mu conotoxins have two types of cysteine arrangements, but the knottin scaffold is not observed. Mu conotoxins target the voltage-gated sodium channels [], and are useful probes for investigating voltage-dependent sodium channels of excitable tissues []. Alpha conotoxins have two types of cysteine arrangements [], and are competitive nicotinic acetylcholine receptor antagonists. ; GO: 0008200 ion channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 2EFZ_A 1FYG_A 1RMK_A 1DG0_A 1DFY_A 1DFZ_A 2JQC_A 2YYF_A 2JQB_A 1F3K_A ....
Probab=33.36  E-value=37  Score=21.50  Aligned_cols=14  Identities=29%  Similarity=0.707  Sum_probs=5.5

Q ss_pred             CCCCee--ecCCceee
Q 033540           77 GAKGLC--LPSPCCYA   90 (117)
Q Consensus        77 ~a~~~C--~~t~CCY~   90 (117)
                      +..+.|  .+.+||..
T Consensus        52 ~~g~~C~~~~~~CC~~   67 (75)
T PF02950_consen   52 PPGSYCCKRNSECCSG   67 (75)
T ss_dssp             -TTSB-BTTTTCBSSS
T ss_pred             CCCCcCCCCCCCCCCC
Confidence            333444  44445544


No 10 
>KOG4623 consensus Uncharacterized conserved protein [Function unknown]
Probab=26.57  E-value=20  Score=33.35  Aligned_cols=35  Identities=23%  Similarity=0.401  Sum_probs=29.8

Q ss_pred             cccccceechhHHHHHHhHHHHhccC-Ccccccccc
Q 033540           39 SKSEEMVPLMEIKTVMMMNETRRKLN-SFQICAVCT   73 (117)
Q Consensus        39 ~~~~~mvPv~~~~~~~~~ne~rr~lg-~Fq~C~~Ct   73 (117)
                      .+..++-|..|.++...+++-|.+|+ -|++|+.|.
T Consensus       116 ~kLA~FeP~de~rydeeLevYR~~LE~mf~LCs~C~  151 (611)
T KOG4623|consen  116 RKLADFEPPDEQRYDEELEVYRKSLEEMFPLCSECY  151 (611)
T ss_pred             HHHhhcCCCchhhHHHHHHHHHHHHHHHcccchHHH
Confidence            44567889888889999999999999 899999985


No 11 
>PF10960 DUF2762:  Protein of unknown function (DUF2762);  InterPro: IPR024405 BhlA is a SP-beta prophage-derived protein found in Bacillus subtilis [, ] and other Bacilli. A related protein, UviB, has also been described in Clostridia, where it is believed to be involved in bacteriocin secretion or immunity [, ].
Probab=24.12  E-value=42  Score=22.87  Aligned_cols=18  Identities=33%  Similarity=0.632  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHhhccCCc
Q 033540            7 SFSLLFLLILANVISPNE   24 (117)
Q Consensus         7 ~~~~~fl~~~a~v~~~~e   24 (117)
                      +|.+||+.||..|+-.|+
T Consensus        14 ~fA~LFv~Ll~yvlK~~~   31 (71)
T PF10960_consen   14 IFAVLFVWLLFYVLKENK   31 (71)
T ss_pred             cHHHHHHHHHHHHHHHhH
Confidence            458889999998777655


No 12 
>PF11674 DUF3270:  Protein of unknown function (DUF3270);  InterPro: IPR021688  This family of proteins with unknown function appears to be restricted to Streptococcus. 
Probab=21.66  E-value=62  Score=23.19  Aligned_cols=17  Identities=35%  Similarity=0.507  Sum_probs=11.6

Q ss_pred             hHHHHHHHHH-HHhhccC
Q 033540            6 VSFSLLFLLI-LANVISP   22 (117)
Q Consensus         6 ~~~~~~fl~~-~a~v~~~   22 (117)
                      |.||++||.+ ++++++-
T Consensus        53 vlfsFvfLs~kl~t~~Af   70 (90)
T PF11674_consen   53 VLFSFVFLSLKLNTFWAF   70 (90)
T ss_pred             HHHHHHHHHHhhhHHHHH
Confidence            5677888887 6666543


No 13 
>PF06783 UPF0239:  Uncharacterised protein family (UPF0239);  InterPro: IPR009621 This is a group of transmembrane proteins of unknown function.; GO: 0016021 integral to membrane
Probab=21.49  E-value=96  Score=22.34  Aligned_cols=19  Identities=32%  Similarity=0.616  Sum_probs=12.8

Q ss_pred             chhHHHHHH--HHHHHhhccC
Q 033540            4 YGVSFSLLF--LLILANVISP   22 (117)
Q Consensus         4 ~~~~~~~~f--l~~~a~v~~~   22 (117)
                      ||+.|--||  +-|||-|+..
T Consensus        24 YGLf~GAIFQliCilAiI~~~   44 (85)
T PF06783_consen   24 YGLFVGAIFQLICILAIILPI   44 (85)
T ss_pred             HHHHHHHHHHHHHHHheeeec
Confidence            787775544  5577877765


No 14 
>PF09451 ATG27:  Autophagy-related protein 27;  InterPro: IPR018939 Autophagy is a degradative transport pathway that delivers cytosolic proteins to the lysosome (vacuole) [] and is induced by starvation []. Cytosolic proteins appear inside the vacuole enclosed in autophagic vesicles. Autophagy significantly differs from other transport pathways by using double membrane layered transport intermediates, called autophagosomes [, ]. The breakdown of vesicular transport intermediates is a unique feature of autophagy []. Autophagy can also function in the elimination of invading bacteria and antigens []. There are more than 25 AuTophaGy-related (ATG) genes that are essential for autophagy, although it is still not known how the autophagosome is made. Atg9 is a potential membrane carrier to deliver lipids that are used to form the vesicle. Atg27 is another transmembrane protein, and is a cycling protein []. It acts as an effector of VPS34 phosphatidylinositol 3-phosphate kinase signalling and regulates the cytoplasm to vacuole transport (Cvt) vesicle formation. It is also required for autophagy-dependent cycling of ATG9. 
Probab=21.41  E-value=1.7e+02  Score=23.30  Aligned_cols=55  Identities=22%  Similarity=0.313  Sum_probs=26.3

Q ss_pred             hHHHHHHHHHHHhhccCCccchhhhccCCCccccccccceechhH-H--HHHHhHHHHhccCCcc
Q 033540            6 VSFSLLFLLILANVISPNESSKINQANGSLSLESKSEEMVPLMEI-K--TVMMMNETRRKLNSFQ   67 (117)
Q Consensus         6 ~~~~~~fl~~~a~v~~~~e~s~~~qangs~~~e~~~~~mvPv~~~-~--~~~~~ne~rr~lg~Fq   67 (117)
                      .+|.++||.+++-+|..  +-.+....|..     -+||+|=.+. +  ...+-.-.|+-++.+|
T Consensus       205 wl~i~~~l~~~~Y~i~g--~~~n~~~~g~~-----g~e~iP~~dfw~~lP~l~kd~~~~v~~~~~  262 (268)
T PF09451_consen  205 WLFIILFLFLAAYLIFG--SWYNYNRYGAR-----GFELIPHFDFWRSLPYLIKDGVRFVVGTVQ  262 (268)
T ss_pred             HHHHHHHHHHHHHhhhh--hheeeccCCCC-----CceecccHhHHHhchHHHHHHHHHhhcccc
Confidence            44555666665555544  11112222222     1268887653 2  3445555566555554


Done!