Query         033542
Match_columns 117
No_of_seqs    141 out of 1041
Neff          7.0 
Searched_HMMs 46136
Date          Fri Mar 29 03:29:48 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033542.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033542hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3882 Tetraspanin family int  99.7 2.1E-17 4.6E-22  123.8   7.1   85    3-117     5-89  (237)
  2 PF00335 Tetraspannin:  Tetrasp  99.1   2E-11 4.4E-16   87.3   0.0   82    6-117     1-82  (221)
  3 PF15345 TMEM51:  Transmembrane  67.2      15 0.00033   28.1   5.0   16   82-97     62-77  (233)
  4 KOG4433 Tweety transmembrane/c  64.1      10 0.00023   32.0   3.9   32   85-116   214-245 (526)
  5 cd07912 Tweety_N N-terminal do  62.5      12 0.00025   31.0   3.9   27   89-115   217-243 (418)
  6 PF11297 DUF3098:  Protein of u  61.9      10 0.00022   23.6   2.7   25   14-38      6-30  (69)
  7 PF04906 Tweety:  Tweety;  Inte  55.7      12 0.00026   30.6   2.9   28   89-116   194-221 (406)
  8 PF04103 CD20:  CD20-like famil  55.3     3.9 8.5E-05   27.7   0.0   29   87-115    37-65  (150)
  9 PF05915 DUF872:  Eukaryotic pr  53.2      21 0.00046   24.3   3.3   25   12-36     44-68  (115)
 10 PF04156 IncA:  IncA protein;    49.0      26 0.00056   25.0   3.5   22   12-33      5-26  (191)
 11 KOG4556 Predicted membrane pro  44.7      30 0.00065   25.7   3.2   48   65-115    17-64  (205)
 12 PF15125 TMEM238:  TMEM238 prot  39.7      91   0.002   19.2   5.1   25   11-35      6-30  (65)
 13 PRK11901 hypothetical protein;  39.1      36 0.00077   27.4   3.1   23   82-104    37-59  (327)
 14 PF14927 Neurensin:  Neurensin   39.0      87  0.0019   22.1   4.7   22   11-32     47-68  (140)
 15 PF01601 Corona_S2:  Coronaviru  34.6      13 0.00028   32.2   0.0   15   78-92    547-561 (610)
 16 PF06724 DUF1206:  Domain of Un  30.9      51  0.0011   20.0   2.3   21   15-35     47-67  (73)
 17 PF10176 DUF2370:  Protein of u  30.9      69  0.0015   24.6   3.4   32   77-108   193-224 (233)
 18 PF11014 DUF2852:  Protein of u  29.0      49  0.0011   22.6   2.1   23   10-32     13-36  (115)
 19 PF04854 DUF624:  Protein of un  28.8      62  0.0014   19.6   2.4   20   12-31      2-24  (77)
 20 PF15048 OSTbeta:  Organic solu  28.6      87  0.0019   21.8   3.3   30    8-37     36-65  (125)
 21 PF06637 PV-1:  PV-1 protein (P  27.5      77  0.0017   26.3   3.3   20    2-21     20-39  (442)
 22 PF05640 NKAIN:  Na,K-Atpase In  24.7      88  0.0019   23.5   2.9   34   79-115    34-67  (200)
 23 PF06166 DUF979:  Protein of un  24.3 1.2E+02  0.0026   24.2   3.7   26   15-40      2-27  (308)
 24 PF15471 TMEM171:  Transmembran  24.0      61  0.0013   25.7   2.0   27    6-34    108-134 (319)
 25 TIGR01167 LPXTG_anchor LPXTG-m  23.7      75  0.0016   16.0   1.8   20   17-36     12-31  (34)
 26 PRK07946 putative monovalent c  23.3      69  0.0015   23.2   2.1   20   15-34      4-23  (163)
 27 PRK09400 secE preprotein trans  21.5 1.8E+02  0.0038   17.5   3.4   19   82-100    34-52  (61)
 28 PF11381 DUF3185:  Protein of u  21.4      83  0.0018   18.9   1.9   17   82-98     42-58  (59)
 29 TIGR00327 secE_euk_arch protei  20.0   2E+02  0.0043   17.3   3.4   19   82-100    30-48  (61)

No 1  
>KOG3882 consensus Tetraspanin family integral membrane protein [General function prediction only]
Probab=99.71  E-value=2.1e-17  Score=123.78  Aligned_cols=85  Identities=34%  Similarity=0.586  Sum_probs=71.7

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHhheeEEecccccccCCcCCCCCCCcccccCcchhhhhhhhhcccccCchhhHHH
Q 033542            3 CRGCLECLLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPVSGDEGFVQLGRPMLMAVSLADSIFDKLPKAWFIY   82 (117)
Q Consensus         3 c~~~lK~~l~~~N~l~~l~G~~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (117)
                      |.+|+||.++.+|+++|++|++++++|+|++.++....++...             .              ...++   +
T Consensus         5 ~~~~~K~~lf~~N~~~~l~G~~ll~~giw~~~~~~~~~~~~~~-------------~--------------~~~~~---~   54 (237)
T KOG3882|consen    5 GSSCLKYLLFLLNLLFWLLGLLLLAVGIWLLADKGFLSSLLES-------------D--------------FLVPA---Y   54 (237)
T ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHhhhheeEeccchhhcccc-------------c--------------hhcch---h
Confidence            4489999999999999999999999999999998766543210             0              02333   7


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhcccchhhhhhhhcC
Q 033542           83 LFIGVGVVLFVISCVGCISATTRNGCCLTCVSLVL  117 (117)
Q Consensus        83 ~~i~~G~~~~~v~~~Gc~ga~~es~~lL~~y~~~l  117 (117)
                      +++++|.+++++|++||+||.|||+|+|.+|++++
T Consensus        55 ili~~G~v~~~v~flGc~Ga~~es~~lL~~y~~~l   89 (237)
T KOG3882|consen   55 ILIAVGGVVFLVGFLGCCGALRESRCLLLSYFILL   89 (237)
T ss_pred             hhhhhhHHHHHHHHhhhhhhHhhhHHHHHHHHHHH
Confidence            99999999999999999999999999999998764


No 2  
>PF00335 Tetraspannin:  Tetraspanin family RDS_ROM1 subfamily;  InterPro: IPR018499 A number of eukaryotic CD antigens have been shown to be related []. CD9 (also called DRAP-27, MRP-1 or p24) upregulates HB-EGF activity as a receptor for diphtheria toxin as well as its juxtacrine activity. CD9 mAbs modulate cell adhesion and migration and trigger platelet activation that is blocked by mAbs directed to the platelet Fc receptor CD32. In mice, CD9 mAb KMC8.8 has been shown to inhibit the production of myeloid cells in vitro and has a costimulatory activity for T cells. CD9 is a type III membrane protein, with four putative transmembrane domains.  CD37 (or gp52-40) is involved in signal transduction and serves as a stable marker for malignancies derived from mature B cells, like B-CLL, HCL, and all types of B-NHL.  CD63 transfection reduced melanoma cell motility on fibronectin, collagen and laminin, and reduced the growth and metastasis of melanoma cells in nude mice []. CD63 has been used as a marker for late endosomes and for primary melanomas.  These proteins are all type II membrane proteins: they contain an N-terminal transmembrane (TM) domain, which acts both as a signal sequence and a membrane anchor, and 3 additional TM regions (hence the name 'TM4'). The sequences contain a number of conserved cysteine residues. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0016021 integral to membrane; PDB: 1IV5_A 1G8Q_A.
Probab=99.07  E-value=2e-11  Score=87.34  Aligned_cols=82  Identities=34%  Similarity=0.663  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhheeEEecccccccCCcCCCCCCCcccccCcchhhhhhhhhcccccCchhhHHHHHH
Q 033542            6 CLECLLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPVSGDEGFVQLGRPMLMAVSLADSIFDKLPKAWFIYLFI   85 (117)
Q Consensus         6 ~lK~~l~~~N~l~~l~G~~li~~Giw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i   85 (117)
                      |+|+.++++|+++++.|++++++|+|.+...+.......               +         .   ....   .++++
T Consensus         1 c~k~~l~~~n~l~~l~g~~li~~g~~~~~~~~~~~~~~~---------------~---------~---~~~~---~~~~i   50 (221)
T PF00335_consen    1 CLKYILFFLNVLFLLLGLALIGVGIWLLVNNQYLSEFSS---------------S---------F---ISYV---IIILI   50 (221)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccc---------------c---------c---hhHH---HHHHH
Confidence            789999999999999999999999999422211111100               0         0   0111   25778


Q ss_pred             HHHHHHHHHHHHHHHHhhcccchhhhhhhhcC
Q 033542           86 GVGVVLFVISCVGCISATTRNGCCLTCVSLVL  117 (117)
Q Consensus        86 ~~G~~~~~v~~~Gc~ga~~es~~lL~~y~~~l  117 (117)
                      .+|.++++++++|++|+.+|||+++..|.+++
T Consensus        51 ~~G~~~~~~~~~G~~~~~~~~~~~l~~y~~~~   82 (221)
T PF00335_consen   51 FIGIFILIISFLGCIGACRKNRCLLIIYIILL   82 (221)
T ss_dssp             --------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHhhcCcccccccccch
Confidence            89999999999999999999999999998753


No 3  
>PF15345 TMEM51:  Transmembrane protein 51
Probab=67.23  E-value=15  Score=28.12  Aligned_cols=16  Identities=38%  Similarity=0.877  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHH
Q 033542           82 YLFIGVGVVLFVISCV   97 (117)
Q Consensus        82 ~~~i~~G~~~~~v~~~   97 (117)
                      |+++++|+++++++++
T Consensus        62 yVLVG~Gv~LLLLSIC   77 (233)
T PF15345_consen   62 YVLVGSGVALLLLSIC   77 (233)
T ss_pred             EehhhHHHHHHHHHHH
Confidence            7999999999999994


No 4  
>KOG4433 consensus Tweety transmembrane/cell surface protein [General function prediction only]
Probab=64.11  E-value=10  Score=32.04  Aligned_cols=32  Identities=22%  Similarity=0.342  Sum_probs=26.0

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccchhhhhhhhc
Q 033542           85 IGVGVVLFVISCVGCISATTRNGCCLTCVSLV  116 (117)
Q Consensus        85 i~~G~~~~~v~~~Gc~ga~~es~~lL~~y~~~  116 (117)
                      +..=.+.+++-++++.|-.|+|||.+..|++.
T Consensus       214 v~lL~l~LvvC~v~vlglak~Skc~li~fsv~  245 (526)
T KOG4433|consen  214 VLLLTLLLVVCLVLVLGLAKRSKCLLIVFSVC  245 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcchhhhHHHHH
Confidence            33445677888999999999999999998763


No 5  
>cd07912 Tweety_N N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels. The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins.
Probab=62.49  E-value=12  Score=31.02  Aligned_cols=27  Identities=26%  Similarity=0.384  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHHhhcccchhhhhhhh
Q 033542           89 VVLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        89 ~~~~~v~~~Gc~ga~~es~~lL~~y~~  115 (117)
                      .+.+++..++|+|..|.|||.+..+++
T Consensus       217 ~~~lviC~~~l~gl~r~Sr~~li~~s~  243 (418)
T cd07912         217 SLLLVICLVLLVGLARHSRCLLIVFSV  243 (418)
T ss_pred             HHHHHHHHHHHHHHHHhcchHHHHHHH
Confidence            355677788899999999999998865


No 6  
>PF11297 DUF3098:  Protein of unknown function (DUF3098);  InterPro: IPR021448  This bacterial family of proteins has no known function. 
Probab=61.93  E-value=10  Score=23.65  Aligned_cols=25  Identities=24%  Similarity=0.371  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHHHHhheeEEeccc
Q 033542           14 LNFLLTLAGLAMVGYGIYLFVEYKR   38 (117)
Q Consensus        14 ~N~l~~l~G~~li~~Giw~~~~~~~   38 (117)
                      -|.++..+|++++.+|-++..-.++
T Consensus         6 ~Nyill~iG~~vIilGfilMsg~~s   30 (69)
T PF11297_consen    6 KNYILLAIGIAVIILGFILMSGGGS   30 (69)
T ss_pred             HHHHHHHHHHHHHHHHHHheeCCCC
Confidence            4889999999999999999876544


No 7  
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=55.66  E-value=12  Score=30.61  Aligned_cols=28  Identities=21%  Similarity=0.463  Sum_probs=22.7

Q ss_pred             HHHHHHHHHHHHHhhcccchhhhhhhhc
Q 033542           89 VVLFVISCVGCISATTRNGCCLTCVSLV  116 (117)
Q Consensus        89 ~~~~~v~~~Gc~ga~~es~~lL~~y~~~  116 (117)
                      .+.+++.++++.|..|+|||.+..+.++
T Consensus       194 ~l~l~icl~~l~glar~Sk~~li~~~v~  221 (406)
T PF04906_consen  194 ILDLVICLLGLLGLARQSKCLLIVFSVL  221 (406)
T ss_pred             HHHHHHHHHHHHHHHhcCcceEEEeeec
Confidence            4666788889999999999999877653


No 8  
>PF04103 CD20:  CD20-like family;  InterPro: IPR007237  This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulphide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm []. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts []. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton []. ; GO: 0016021 integral to membrane; PDB: 2OSL_Q 3BKY_P 3PP4_P.
Probab=55.27  E-value=3.9  Score=27.67  Aligned_cols=29  Identities=14%  Similarity=0.322  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHhhcccchhhhhhhh
Q 033542           87 VGVVLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        87 ~G~~~~~v~~~Gc~ga~~es~~lL~~y~~  115 (117)
                      .|...++.|.+|.....|.+|+++..+..
T Consensus        37 ~G~~fiisG~l~i~s~k~~~~~lv~~~l~   65 (150)
T PF04103_consen   37 GGIFFIISGILGIASEKKPTKCLVIASLV   65 (150)
T ss_dssp             -----------------------------
T ss_pred             HHHHHHhhHHHHHHHhcCCcccchHHHHH
Confidence            46677778888888888888888766543


No 9  
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=53.18  E-value=21  Score=24.27  Aligned_cols=25  Identities=24%  Similarity=0.392  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHhheeEEec
Q 033542           12 KLLNFLLTLAGLAMVGYGIYLFVEY   36 (117)
Q Consensus        12 ~~~N~l~~l~G~~li~~Giw~~~~~   36 (117)
                      +.+-+.++++|.+++..|..+....
T Consensus        44 I~la~~Lli~G~~li~~g~l~~~~~   68 (115)
T PF05915_consen   44 IALAVFLLIFGTVLIIIGLLLFFGH   68 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            3556778899999999999887654


No 10 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=48.99  E-value=26  Score=25.04  Aligned_cols=22  Identities=18%  Similarity=0.605  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHHHHHhheeE
Q 033542           12 KLLNFLLTLAGLAMVGYGIYLF   33 (117)
Q Consensus        12 ~~~N~l~~l~G~~li~~Giw~~   33 (117)
                      .+.+++..++|+++++.|+-..
T Consensus         5 ~i~~i~~iilgilli~~gI~~L   26 (191)
T PF04156_consen    5 RIISIILIILGILLIASGIAAL   26 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3566777777777777777654


No 11 
>KOG4556 consensus Predicted membrane protein [Function unknown]
Probab=44.71  E-value=30  Score=25.66  Aligned_cols=48  Identities=23%  Similarity=0.241  Sum_probs=27.8

Q ss_pred             hhhhhcccccCchhhHHHHHHHHHHHHHHHHHHHHHHhhcccchhhhhhhh
Q 033542           65 VSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        65 ~~~~~~~~~~~~~~~~~~~~i~~G~~~~~v~~~Gc~ga~~es~~lL~~y~~  115 (117)
                      ++++.+++|....-|.+.+.=.+=++   +-++|-.|+....+..+.+|..
T Consensus        17 ~~l~RqvFDflGyqWapilanFvhIi---ivIlGLFGtiQyR~ryl~~y~~   64 (205)
T KOG4556|consen   17 LSLERQVFDFLGYQWAPILANFVHII---IVILGLFGTIQYRRRYLYTYAS   64 (205)
T ss_pred             HHHHHHHHHHhhhhhHHHHHHHHHHH---HHHHHhhhhhhcchhHHHHHHH
Confidence            34455666655444533444444444   4455667788777777877753


No 12 
>PF15125 TMEM238:  TMEM238 protein family
Probab=39.75  E-value=91  Score=19.21  Aligned_cols=25  Identities=24%  Similarity=0.444  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhheeEEe
Q 033542           11 LKLLNFLLTLAGLAMVGYGIYLFVE   35 (117)
Q Consensus        11 l~~~N~l~~l~G~~li~~Giw~~~~   35 (117)
                      .+.+-+++=++|+.++..|+....+
T Consensus         6 ~f~laV~fD~vGl~~Ll~GiFa~l~   30 (65)
T PF15125_consen    6 FFWLAVVFDVVGLVMLLTGIFAPLD   30 (65)
T ss_pred             hhHHHHHHHHhhHHHHHHHHhcchh
Confidence            3457778889999999999987763


No 13 
>PRK11901 hypothetical protein; Reviewed
Probab=39.07  E-value=36  Score=27.39  Aligned_cols=23  Identities=22%  Similarity=0.494  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhc
Q 033542           82 YLFIGVGVVLFVISCVGCISATT  104 (117)
Q Consensus        82 ~~~i~~G~~~~~v~~~Gc~ga~~  104 (117)
                      +++|++|++++++=++|...|+|
T Consensus        37 h~MiGiGilVLlLLIi~IgSALk   59 (327)
T PRK11901         37 HMMIGIGILVLLLLIIAIGSALK   59 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhcc
Confidence            69999999999999999999886


No 14 
>PF14927 Neurensin:  Neurensin
Probab=38.96  E-value=87  Score=22.13  Aligned_cols=22  Identities=23%  Similarity=0.319  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhee
Q 033542           11 LKLLNFLLTLAGLAMVGYGIYL   32 (117)
Q Consensus        11 l~~~N~l~~l~G~~li~~Giw~   32 (117)
                      -++..+++.+.|++.+.+|--+
T Consensus        47 ~~i~g~l~Ll~Gi~~l~vgY~v   68 (140)
T PF14927_consen   47 GFISGLLLLLLGIVALTVGYLV   68 (140)
T ss_pred             HHHHHHHHHHHHHHHHHhhccc
Confidence            5677889999999999998664


No 15 
>PF01601 Corona_S2:  Coronavirus S2 glycoprotein;  InterPro: IPR002552 The type I glycoprotein S of Coronavirus, trimers of which constitute the typical viral spikes, is assembled into virions through noncovalent interactions with the M protein. The spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 IPR002551 from INTERPRO and S2 []. Both chimeric S proteins appeared to cause cell fusion when expressed individually, suggesting that they were biologically fully active []. The spike is a type I membrane glycoprotein that possesses a conserved transmembrane anchor and an unusual cysteine-rich (cys) domain that bridges the putative junction of the anchor and the cytoplasmic tail [].; GO: 0006944 cellular membrane fusion, 0046813 virion attachment, binding of host cell surface receptor, 0016021 integral to membrane, 0019031 viral envelope; PDB: 2BEQ_B 2FXP_A 1ZVB_A 1WNC_D 1ZV8_H 1ZV7_B 1WYY_B 1ZVA_A 2BEZ_F 1WDG_A ....
Probab=34.61  E-value=13  Score=32.19  Aligned_cols=15  Identities=27%  Similarity=0.910  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHH
Q 033542           78 AWFIYLFIGVGVVLF   92 (117)
Q Consensus        78 ~~~~~~~i~~G~~~~   92 (117)
                      ||++++.|+++.+.+
T Consensus       547 PWyVWL~i~~~li~~  561 (610)
T PF01601_consen  547 PWYVWLAIILALIAF  561 (610)
T ss_dssp             ---------------
T ss_pred             HHHHHHHHHHHHHHH
Confidence            477777777766544


No 16 
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=30.93  E-value=51  Score=19.98  Aligned_cols=21  Identities=48%  Similarity=1.043  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHhheeEEe
Q 033542           15 NFLLTLAGLAMVGYGIYLFVE   35 (117)
Q Consensus        15 N~l~~l~G~~li~~Giw~~~~   35 (117)
                      ..+.+++|+.++++|+|...+
T Consensus        47 ~~ll~~vg~gli~~gi~~~~~   67 (73)
T PF06724_consen   47 RWLLGAVGLGLIGYGIWQFVK   67 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            357889999999999997653


No 17 
>PF10176 DUF2370:  Protein of unknown function (DUF2370);  InterPro: IPR019325 Proteins in this family are conserved from fungi to humans. They include the human NEDD4 family-interacting proteins and the yeast BSD2 metal homeostatis proteins. 
Probab=30.92  E-value=69  Score=24.56  Aligned_cols=32  Identities=16%  Similarity=0.473  Sum_probs=27.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHhhcccch
Q 033542           77 KAWFIYLFIGVGVVLFVISCVGCISATTRNGC  108 (117)
Q Consensus        77 ~~~~~~~~i~~G~~~~~v~~~Gc~ga~~es~~  108 (117)
                      .+|..|+++++|.++++-|+.+.+=+.|--|.
T Consensus       193 ~~wla~~Lm~~G~fI~irsi~dY~rVKR~Er~  224 (233)
T PF10176_consen  193 NPWLAYILMAFGWFIFIRSIIDYWRVKRMERL  224 (233)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            35777999999999999999999988875553


No 18 
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=29.02  E-value=49  Score=22.64  Aligned_cols=23  Identities=30%  Similarity=0.469  Sum_probs=17.6

Q ss_pred             HHHHHHH-HHHHHHHHHHHHhhee
Q 033542           10 LLKLLNF-LLTLAGLAMVGYGIYL   32 (117)
Q Consensus        10 ~l~~~N~-l~~l~G~~li~~Giw~   32 (117)
                      .+.++-+ +||=+|++++++-+|-
T Consensus        13 a~mVlGFi~fWPlGla~Lay~iw~   36 (115)
T PF11014_consen   13 AAMVLGFIVFWPLGLALLAYMIWG   36 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344444 4799999999999997


No 19 
>PF04854 DUF624:  Protein of unknown function, DUF624;  InterPro: IPR006938 This family consists of uncharacterised or hypothetical bacterial proteins.
Probab=28.78  E-value=62  Score=19.55  Aligned_cols=20  Identities=40%  Similarity=0.516  Sum_probs=14.3

Q ss_pred             HHHHHHHH---HHHHHHHHHhhe
Q 033542           12 KLLNFLLT---LAGLAMVGYGIY   31 (117)
Q Consensus        12 ~~~N~l~~---l~G~~li~~Giw   31 (117)
                      ..+|++++   +.|+.++++|--
T Consensus         2 ~~ln~lwl~~~l~~l~v~tigPA   24 (77)
T PF04854_consen    2 VVLNLLWLLFTLAGLPVFTIGPA   24 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46788877   888777766643


No 20 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=28.59  E-value=87  Score=21.77  Aligned_cols=30  Identities=17%  Similarity=0.237  Sum_probs=25.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhheeEEecc
Q 033542            8 ECLLKLLNFLLTLAGLAMVGYGIYLFVEYK   37 (117)
Q Consensus         8 K~~l~~~N~l~~l~G~~li~~Giw~~~~~~   37 (117)
                      +|.++.+.++..++|..+++-++-+....+
T Consensus        36 NysiL~Ls~vvlvi~~~LLgrsi~ANRnrK   65 (125)
T PF15048_consen   36 NYSILALSFVVLVISFFLLGRSIQANRNRK   65 (125)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHhHhccccc
Confidence            688999999999999999999998865543


No 21 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=27.51  E-value=77  Score=26.29  Aligned_cols=20  Identities=15%  Similarity=0.345  Sum_probs=16.6

Q ss_pred             CCchhHHHHHHHHHHHHHHH
Q 033542            2 ACRGCLECLLKLLNFLLTLA   21 (117)
Q Consensus         2 ~c~~~lK~~l~~~N~l~~l~   21 (117)
                      ||.-.+||++++..++-+++
T Consensus        20 gC~YYlryfFlF~SLIQ~LI   39 (442)
T PF06637_consen   20 GCWYYLRYFFLFVSLIQFLI   39 (442)
T ss_pred             ChhHHHHHHHHHHHHHHHHH
Confidence            68889999999999986643


No 22 
>PF05640 NKAIN:  Na,K-Atpase Interacting protein;  InterPro: IPR008516 NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [].
Probab=24.74  E-value=88  Score=23.47  Aligned_cols=34  Identities=12%  Similarity=0.169  Sum_probs=21.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhhcccchhhhhhhh
Q 033542           79 WFIYLFIGVGVVLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        79 ~~~~~~i~~G~~~~~v~~~Gc~ga~~es~~lL~~y~~  115 (117)
                      |.+.+.-..-++.   -++|..||..-++..+..|.+
T Consensus        34 WaPIl~NF~hIi~---vIlGlFG~~QyR~ryi~~Y~v   67 (200)
T PF05640_consen   34 WAPILANFLHIIF---VILGLFGAIQYRPRYIIVYAV   67 (200)
T ss_pred             HHHHHHHHHHHHH---HHHHHhhheeecchHHHHHHH
Confidence            4334444444444   456667899888888888865


No 23 
>PF06166 DUF979:  Protein of unknown function (DUF979);  InterPro: IPR009323 This family consists of several putative bacterial membrane proteins. The function of this family is unclear.
Probab=24.30  E-value=1.2e+02  Score=24.24  Aligned_cols=26  Identities=12%  Similarity=0.193  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHhheeEEeccccc
Q 033542           15 NFLLTLAGLAMVGYGIYLFVEYKRVD   40 (117)
Q Consensus        15 N~l~~l~G~~li~~Giw~~~~~~~~~   40 (117)
                      +.+++++|+.++..+.....|+++-.
T Consensus         2 e~~Y~l~Gl~~~~~a~~~~~Dk~np~   27 (308)
T PF06166_consen    2 EIFYILIGLVFIITAVRSLRDKTNPK   27 (308)
T ss_pred             ccHHHHHHHHHHHHHHHHHcCCCCCc
Confidence            56889999999999999998875543


No 24 
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=24.03  E-value=61  Score=25.69  Aligned_cols=27  Identities=22%  Similarity=0.438  Sum_probs=21.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhheeEE
Q 033542            6 CLECLLKLLNFLLTLAGLAMVGYGIYLFV   34 (117)
Q Consensus         6 ~lK~~l~~~N~l~~l~G~~li~~Giw~~~   34 (117)
                      +.+++  +|.++|...|..+-.+|+|+--
T Consensus       108 FaQ~L--IFGFLFLTSGmLISvLGiWVPG  134 (319)
T PF15471_consen  108 FAQFL--IFGFLFLTSGMLISVLGIWVPG  134 (319)
T ss_pred             hhHHH--HHHHHHHhhhhhhhhheeeecC
Confidence            44444  6779999999999999999843


No 25 
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=23.73  E-value=75  Score=16.02  Aligned_cols=20  Identities=40%  Similarity=0.594  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHhheeEEec
Q 033542           17 LLTLAGLAMVGYGIYLFVEY   36 (117)
Q Consensus        17 l~~l~G~~li~~Giw~~~~~   36 (117)
                      .+.+.|+++++.+.|....+
T Consensus        12 ~~~~~G~~l~~~~~~~~~~r   31 (34)
T TIGR01167        12 LLLLLGLLLLGLGGLLLRKR   31 (34)
T ss_pred             HHHHHHHHHHHHHHHHheec
Confidence            45566777777777665443


No 26 
>PRK07946 putative monovalent cation/H+ antiporter subunit C; Reviewed
Probab=23.34  E-value=69  Score=23.24  Aligned_cols=20  Identities=30%  Similarity=0.431  Sum_probs=10.5

Q ss_pred             HHHHHHHHHHHHHHhheeEE
Q 033542           15 NFLLTLAGLAMVGYGIYLFV   34 (117)
Q Consensus        15 N~l~~l~G~~li~~Giw~~~   34 (117)
                      |++..+...++.++|+|+..
T Consensus         4 ~l~~~i~~gvL~~~G~Ylll   23 (163)
T PRK07946          4 NLGLLVAIGVLTSAGVYLLL   23 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            44444455555555666554


No 27 
>PRK09400 secE preprotein translocase subunit SecE; Reviewed
Probab=21.51  E-value=1.8e+02  Score=17.49  Aligned_cols=19  Identities=21%  Similarity=0.380  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 033542           82 YLFIGVGVVLFVISCVGCI  100 (117)
Q Consensus        82 ~~~i~~G~~~~~v~~~Gc~  100 (117)
                      -+.-++|+-++++|++|+.
T Consensus        34 ~ia~~~~iG~~i~G~iGf~   52 (61)
T PRK09400         34 LVAKVTGLGILLIGLIGFI   52 (61)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4667778888889999875


No 28 
>PF11381 DUF3185:  Protein of unknown function (DUF3185);  InterPro: IPR021521  Some members in this bacterial family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=21.43  E-value=83  Score=18.91  Aligned_cols=17  Identities=12%  Similarity=0.169  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 033542           82 YLFIGVGVVLFVISCVG   98 (117)
Q Consensus        82 ~~~i~~G~~~~~v~~~G   98 (117)
                      ...++.|++..++|+.+
T Consensus        42 ~~~ligG~va~ivGl~~   58 (59)
T PF11381_consen   42 IWYLIGGAVAVIVGLFL   58 (59)
T ss_pred             HHHHHhHHHHHHHHHhh
Confidence            46677788888887754


No 29 
>TIGR00327 secE_euk_arch protein translocase SEC61 complex gamma subunit, archaeal and eukaryotic. This model describes archaeal SEC61-like and eukaryotic SEC61 but not bacterial secE proteins, for which a Pfam pfam00584 (SecE) has been created.
Probab=20.01  E-value=2e+02  Score=17.34  Aligned_cols=19  Identities=16%  Similarity=0.368  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 033542           82 YLFIGVGVVLFVISCVGCI  100 (117)
Q Consensus        82 ~~~i~~G~~~~~v~~~Gc~  100 (117)
                      -+.-++|+-++++|++|+.
T Consensus        30 ~iak~t~iG~~i~G~IGf~   48 (61)
T TIGR00327        30 KVAKVTGIGIIIVGIIGYI   48 (61)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4677778888889999875


Done!