Query         033543
Match_columns 117
No_of_seqs    139 out of 1037
Neff          7.0 
Searched_HMMs 46136
Date          Fri Mar 29 03:30:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033543.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033543hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3882 Tetraspanin family int  99.7 3.5E-17 7.5E-22  122.6   6.9   85    3-117     5-89  (237)
  2 PF00335 Tetraspannin:  Tetrasp  99.1 2.6E-11 5.7E-16   86.7   0.0   82    6-117     1-82  (221)
  3 PF15345 TMEM51:  Transmembrane  64.8      17 0.00036   27.9   4.8   16   82-97     62-77  (233)
  4 cd07912 Tweety_N N-terminal do  64.4      10 0.00022   31.4   3.8   29   87-115   215-243 (418)
  5 PF11297 DUF3098:  Protein of u  62.9      13 0.00029   23.1   3.3   25   14-38      6-30  (69)
  6 KOG4433 Tweety transmembrane/c  62.5      12 0.00025   31.8   3.8   32   85-116   214-245 (526)
  7 PF05915 DUF872:  Eukaryotic pr  54.0      22 0.00048   24.1   3.6   26   11-36     43-68  (115)
  8 PF04103 CD20:  CD20-like famil  50.8     5.1 0.00011   27.1   0.0   29   87-115    37-65  (150)
  9 PF04156 IncA:  IncA protein;    47.1      32 0.00069   24.5   3.7   23   12-34      5-27  (191)
 10 PRK11901 hypothetical protein;  46.8      23 0.00051   28.4   3.1   23   82-104    37-59  (327)
 11 PF04906 Tweety:  Tweety;  Inte  45.1      23 0.00049   29.0   2.9   28   89-116   194-221 (406)
 12 PF01601 Corona_S2:  Coronaviru  43.6     7.7 0.00017   33.5   0.0   15   78-92    547-561 (610)
 13 KOG4556 Predicted membrane pro  42.9      32  0.0007   25.5   3.1   47   66-115    18-64  (205)
 14 PF10176 DUF2370:  Protein of u  35.0      52  0.0011   25.2   3.3   32   77-108   193-224 (233)
 15 PF14927 Neurensin:  Neurensin   30.5 1.5E+02  0.0032   20.9   4.8   23   11-33     47-69  (140)
 16 PF05640 NKAIN:  Na,K-Atpase In  30.3      59  0.0013   24.4   2.8   26   90-115    42-67  (200)
 17 PF06724 DUF1206:  Domain of Un  29.9      55  0.0012   19.8   2.3   20   16-35     48-67  (73)
 18 PF11014 DUF2852:  Protein of u  28.9      50  0.0011   22.6   2.1   16   17-32     21-36  (115)
 19 PF04854 DUF624:  Protein of un  26.8      71  0.0015   19.3   2.4   20   12-31      2-24  (77)
 20 PF15048 OSTbeta:  Organic solu  26.7      98  0.0021   21.5   3.3   29    8-36     36-64  (125)
 21 PF03597 CcoS:  Cytochrome oxid  26.4 1.3E+02  0.0028   17.0   3.6   26   82-107     4-29  (45)
 22 PF15125 TMEM238:  TMEM238 prot  25.2 1.7E+02  0.0038   18.0   5.2   24   12-35      7-30  (65)
 23 PF10812 DUF2561:  Protein of u  25.0   3E+02  0.0066   20.7   6.1   59   10-96     23-81  (207)
 24 PF15471 TMEM171:  Transmembran  23.2      63  0.0014   25.6   2.0   26    6-33    108-133 (319)
 25 TIGR01167 LPXTG_anchor LPXTG-m  22.8      82  0.0018   15.9   1.8   19   17-35     12-30  (34)
 26 TIGR00847 ccoS cytochrome oxid  21.9 1.8E+02  0.0039   16.9   3.8   26   82-107     5-30  (51)
 27 PF06637 PV-1:  PV-1 protein (P  21.3 1.6E+02  0.0034   24.5   3.9   19    2-20     20-38  (442)
 28 PRK09400 secE preprotein trans  21.3 1.8E+02   0.004   17.4   3.4   19   82-100    34-52  (61)
 29 PRK12585 putative monovalent c  20.9 1.5E+02  0.0032   22.2   3.4   19   81-99      9-27  (197)
 30 PF13706 PepSY_TM_3:  PepSY-ass  20.7 1.5E+02  0.0033   15.6   3.3   24   82-105    10-33  (37)
 31 PF11381 DUF3185:  Protein of u  20.3 1.6E+02  0.0034   17.7   2.9   17   82-98     42-58  (59)
 32 PRK07946 putative monovalent c  20.3      88  0.0019   22.7   2.1   20   15-34      4-23  (163)

No 1  
>KOG3882 consensus Tetraspanin family integral membrane protein [General function prediction only]
Probab=99.70  E-value=3.5e-17  Score=122.58  Aligned_cols=85  Identities=34%  Similarity=0.586  Sum_probs=71.6

Q ss_pred             CchhHHHHHHHHHHHHHHHHHHHHHHHheeEEecccccccCCcCCCCCCCcccccCcchhhhhhhhhcccccCchhhHHH
Q 033543            3 CRGCLECLLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPVSGDEGFVQLGRPMLMAVSLADSIFDKLPKAWFIY   82 (117)
Q Consensus         3 c~~~lk~~l~~~N~lf~l~G~~li~~giw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (117)
                      |.+|+|+.++.+|+++|+.|++++++|+|++.++....++...             .              ...++   +
T Consensus         5 ~~~~~K~~lf~~N~~~~l~G~~ll~~giw~~~~~~~~~~~~~~-------------~--------------~~~~~---~   54 (237)
T KOG3882|consen    5 GSSCLKYLLFLLNLLFWLLGLLLLAVGIWLLADKGFLSSLLES-------------D--------------FLVPA---Y   54 (237)
T ss_pred             ccchHHHHHHHHHHHHHHHHHHHHHhhhheeEeccchhhcccc-------------c--------------hhcch---h
Confidence            4489999999999999999999999999999998765533210             0              02333   7


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhccccchhhhhhhcC
Q 033543           83 LFIGVGVVLFVISCVGCISATTRNGCCLTCVSLVL  117 (117)
Q Consensus        83 ~li~~G~~~~~v~~~Gc~Ga~~es~~lL~~y~~~l  117 (117)
                      +++++|++++++|++||+||.|||+|+|.+|++++
T Consensus        55 ili~~G~v~~~v~flGc~Ga~~es~~lL~~y~~~l   89 (237)
T KOG3882|consen   55 ILIAVGGVVFLVGFLGCCGALRESRCLLLSYFILL   89 (237)
T ss_pred             hhhhhhHHHHHHHHhhhhhhHhhhHHHHHHHHHHH
Confidence            99999999999999999999999999999998764


No 2  
>PF00335 Tetraspannin:  Tetraspanin family RDS_ROM1 subfamily;  InterPro: IPR018499 A number of eukaryotic CD antigens have been shown to be related []. CD9 (also called DRAP-27, MRP-1 or p24) upregulates HB-EGF activity as a receptor for diphtheria toxin as well as its juxtacrine activity. CD9 mAbs modulate cell adhesion and migration and trigger platelet activation that is blocked by mAbs directed to the platelet Fc receptor CD32. In mice, CD9 mAb KMC8.8 has been shown to inhibit the production of myeloid cells in vitro and has a costimulatory activity for T cells. CD9 is a type III membrane protein, with four putative transmembrane domains.  CD37 (or gp52-40) is involved in signal transduction and serves as a stable marker for malignancies derived from mature B cells, like B-CLL, HCL, and all types of B-NHL.  CD63 transfection reduced melanoma cell motility on fibronectin, collagen and laminin, and reduced the growth and metastasis of melanoma cells in nude mice []. CD63 has been used as a marker for late endosomes and for primary melanomas.  These proteins are all type II membrane proteins: they contain an N-terminal transmembrane (TM) domain, which acts both as a signal sequence and a membrane anchor, and 3 additional TM regions (hence the name 'TM4'). The sequences contain a number of conserved cysteine residues. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0016021 integral to membrane; PDB: 1IV5_A 1G8Q_A.
Probab=99.05  E-value=2.6e-11  Score=86.71  Aligned_cols=82  Identities=34%  Similarity=0.702  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHheeEEecccccccCCcCCCCCCCcccccCcchhhhhhhhhcccccCchhhHHHHHH
Q 033543            6 CLECLLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPVSGDEGFVQLGRPMLMAVSLADSIFDKLPKAWFIYLFI   85 (117)
Q Consensus         6 ~lk~~l~~~N~lf~l~G~~li~~giw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li   85 (117)
                      |+|+.++++|+++++.|++++++|+|.+...+.......               +             ....  ..++++
T Consensus         1 c~k~~l~~~n~l~~l~g~~li~~g~~~~~~~~~~~~~~~---------------~-------------~~~~--~~~~~i   50 (221)
T PF00335_consen    1 CLKYILFFLNVLFLLLGLALIGVGIWLLVNNQYLSEFSS---------------S-------------FISY--VIIILI   50 (221)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccc---------------c-------------chhH--HHHHHH
Confidence            789999999999999999999999999422111111100               0             0111  125778


Q ss_pred             HHHHHHHHHHHHHHHHhhccccchhhhhhhcC
Q 033543           86 GVGVVLFVISCVGCISATTRNGCCLTCVSLVL  117 (117)
Q Consensus        86 ~~G~~~~~v~~~Gc~Ga~~es~~lL~~y~~~l  117 (117)
                      .+|.++++++++|++|+.+||++++..|.+++
T Consensus        51 ~~G~~~~~~~~~G~~~~~~~~~~~l~~y~~~~   82 (221)
T PF00335_consen   51 FIGIFILIISFLGCIGACRKNRCLLIIYIILL   82 (221)
T ss_dssp             --------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHhhcCcccccccccch
Confidence            89999999999999999999999999998753


No 3  
>PF15345 TMEM51:  Transmembrane protein 51
Probab=64.79  E-value=17  Score=27.86  Aligned_cols=16  Identities=38%  Similarity=0.877  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHH
Q 033543           82 YLFIGVGVVLFVISCV   97 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~   97 (117)
                      |+++++|++++++++|
T Consensus        62 yVLVG~Gv~LLLLSIC   77 (233)
T PF15345_consen   62 YVLVGSGVALLLLSIC   77 (233)
T ss_pred             EehhhHHHHHHHHHHH
Confidence            7999999999999994


No 4  
>cd07912 Tweety_N N-terminal domain of the protein encoded by the Drosophila tweety gene and related proteins, a family of chloride ion channels. The protein product of the Drosophila tweety (tty) gene is thought to form a trans-membrane protein with five membrane-spanning regions and a cytoplasmic C-terminus. This N-terminal domain contains the putative transmembrane spanning regions. Tweety has been suggested as a candidate for a large conductance chloride channel, both in vertebrate and insect cells. Three human homologs have been identified and designated TTYH1-3. TTYH2 has been associated with the progression of cancer, and Drosophila melanogaster tweety has been assumed to play a role in development. TTYH2, and TTYH3 bind to and are ubiquinated by Nedd4-2, a HECT type E3 ubiquitin ligase, which most likely plays a role in controlling the cellular levels of tweety family proteins.
Probab=64.38  E-value=10  Score=31.36  Aligned_cols=29  Identities=24%  Similarity=0.328  Sum_probs=23.2

Q ss_pred             HHHHHHHHHHHHHHHhhccccchhhhhhh
Q 033543           87 VGVVLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        87 ~G~~~~~v~~~Gc~Ga~~es~~lL~~y~~  115 (117)
                      +=++.+++..++|+|..|.|||.+..+++
T Consensus       215 lL~~~lviC~~~l~gl~r~Sr~~li~~s~  243 (418)
T cd07912         215 LLSLLLVICLVLLVGLARHSRCLLIVFSV  243 (418)
T ss_pred             HHHHHHHHHHHHHHHHHHhcchHHHHHHH
Confidence            33455677788899999999999998864


No 5  
>PF11297 DUF3098:  Protein of unknown function (DUF3098);  InterPro: IPR021448  This bacterial family of proteins has no known function. 
Probab=62.88  E-value=13  Score=23.11  Aligned_cols=25  Identities=24%  Similarity=0.371  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHHHHHHheeEEeccc
Q 033543           14 LNFLLTLAGLAMVGYGIYLFVEYKR   38 (117)
Q Consensus        14 ~N~lf~l~G~~li~~giw~~~~~~~   38 (117)
                      -|.+++..|++++.+|-++..-.++
T Consensus         6 ~Nyill~iG~~vIilGfilMsg~~s   30 (69)
T PF11297_consen    6 KNYILLAIGIAVIILGFILMSGGGS   30 (69)
T ss_pred             HHHHHHHHHHHHHHHHHHheeCCCC
Confidence            4889999999999999999876443


No 6  
>KOG4433 consensus Tweety transmembrane/cell surface protein [General function prediction only]
Probab=62.46  E-value=12  Score=31.77  Aligned_cols=32  Identities=22%  Similarity=0.342  Sum_probs=25.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhccccchhhhhhhc
Q 033543           85 IGVGVVLFVISCVGCISATTRNGCCLTCVSLV  116 (117)
Q Consensus        85 i~~G~~~~~v~~~Gc~Ga~~es~~lL~~y~~~  116 (117)
                      +..=.+.+++-++++.|-.|+|||++..|+++
T Consensus       214 v~lL~l~LvvC~v~vlglak~Skc~li~fsv~  245 (526)
T KOG4433|consen  214 VLLLTLLLVVCLVLVLGLAKRSKCLLIVFSVC  245 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcchhhhHHHHH
Confidence            33345677888899999999999999988763


No 7  
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=54.03  E-value=22  Score=24.12  Aligned_cols=26  Identities=23%  Similarity=0.350  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHheeEEec
Q 033543           11 LKLLNFLLTLAGLAMVGYGIYLFVEY   36 (117)
Q Consensus        11 l~~~N~lf~l~G~~li~~giw~~~~~   36 (117)
                      -..+-+.++++|.+++..|..+....
T Consensus        43 ~I~la~~Lli~G~~li~~g~l~~~~~   68 (115)
T PF05915_consen   43 SIALAVFLLIFGTVLIIIGLLLFFGH   68 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            34556777899999999998887653


No 8  
>PF04103 CD20:  CD20-like family;  InterPro: IPR007237  This family includes the CD20 protein and the beta subunit of the high affinity receptor for IgE Fc. The high affinity receptor for IgE is a tetrameric structure consisting of a single IgE-binding alpha subunit, a single beta subunit, and two disulphide-linked gamma subunits. The alpha subunit of Fc epsilon RI and most Fc receptors are homologous members of the Ig superfamily. By contrast, the beta and gamma subunits from Fc epsilon RI are not homologous to the Ig superfamily. Both molecules have four putative transmembrane segments and a probably topology where both amino- and carboxy termini protrude into the cytoplasm []. This family also includes LR8 like proteins from humans, mice and rats. The function of the human LR8 protein is unknown although it is known to be strongly expressed in the lung fibroblasts []. This family also includes sarcospan is a transmembrane component of dystrophin-associated glycoprotein. Loss of the sarcoglycan complex and sarcospan alone is sufficient to cause muscular dystrophy. The role of the sarcoglycan complex and sarcospan is thought to be to strengthen the dystrophin axis connecting the basement membrane with the cytoskeleton []. ; GO: 0016021 integral to membrane; PDB: 2OSL_Q 3BKY_P 3PP4_P.
Probab=50.84  E-value=5.1  Score=27.08  Aligned_cols=29  Identities=14%  Similarity=0.322  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHhhccccchhhhhhh
Q 033543           87 VGVVLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        87 ~G~~~~~v~~~Gc~Ga~~es~~lL~~y~~  115 (117)
                      .|...++.|.+|.....|.+++++..+..
T Consensus        37 ~G~~fiisG~l~i~s~k~~~~~lv~~~l~   65 (150)
T PF04103_consen   37 GGIFFIISGILGIASEKKPTKCLVIASLV   65 (150)
T ss_dssp             -----------------------------
T ss_pred             HHHHHHhhHHHHHHHhcCCcccchHHHHH
Confidence            46677778888888888888888766543


No 9  
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=47.13  E-value=32  Score=24.54  Aligned_cols=23  Identities=22%  Similarity=0.628  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHHHHHHHHheeEE
Q 033543           12 KLLNFLLTLAGLAMVGYGIYLFV   34 (117)
Q Consensus        12 ~~~N~lf~l~G~~li~~giw~~~   34 (117)
                      .+.+++..++|+++++.|+-...
T Consensus         5 ~i~~i~~iilgilli~~gI~~Lv   27 (191)
T PF04156_consen    5 RIISIILIILGILLIASGIAALV   27 (191)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            35677777888887777776643


No 10 
>PRK11901 hypothetical protein; Reviewed
Probab=46.83  E-value=23  Score=28.41  Aligned_cols=23  Identities=22%  Similarity=0.494  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhc
Q 033543           82 YLFIGVGVVLFVISCVGCISATT  104 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~  104 (117)
                      +++|++|++++++=++|...|+|
T Consensus        37 h~MiGiGilVLlLLIi~IgSALk   59 (327)
T PRK11901         37 HMMIGIGILVLLLLIIAIGSALK   59 (327)
T ss_pred             HHHHHHHHHHHHHHHHHHhhhcc
Confidence            69999999999999999998886


No 11 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=45.07  E-value=23  Score=29.01  Aligned_cols=28  Identities=21%  Similarity=0.463  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHhhccccchhhhhhhc
Q 033543           89 VVLFVISCVGCISATTRNGCCLTCVSLV  116 (117)
Q Consensus        89 ~~~~~v~~~Gc~Ga~~es~~lL~~y~~~  116 (117)
                      .+.+++.++++.|..|+|||.+..+.++
T Consensus       194 ~l~l~icl~~l~glar~Sk~~li~~~v~  221 (406)
T PF04906_consen  194 ILDLVICLLGLLGLARQSKCLLIVFSVL  221 (406)
T ss_pred             HHHHHHHHHHHHHHHhcCcceEEEeeec
Confidence            4666788889999999999999876653


No 12 
>PF01601 Corona_S2:  Coronavirus S2 glycoprotein;  InterPro: IPR002552 The type I glycoprotein S of Coronavirus, trimers of which constitute the typical viral spikes, is assembled into virions through noncovalent interactions with the M protein. The spike glycoprotein is translated as a large polypeptide that is subsequently cleaved to S1 IPR002551 from INTERPRO and S2 []. Both chimeric S proteins appeared to cause cell fusion when expressed individually, suggesting that they were biologically fully active []. The spike is a type I membrane glycoprotein that possesses a conserved transmembrane anchor and an unusual cysteine-rich (cys) domain that bridges the putative junction of the anchor and the cytoplasmic tail [].; GO: 0006944 cellular membrane fusion, 0046813 virion attachment, binding of host cell surface receptor, 0016021 integral to membrane, 0019031 viral envelope; PDB: 2BEQ_B 2FXP_A 1ZVB_A 1WNC_D 1ZV8_H 1ZV7_B 1WYY_B 1ZVA_A 2BEZ_F 1WDG_A ....
Probab=43.64  E-value=7.7  Score=33.51  Aligned_cols=15  Identities=27%  Similarity=0.910  Sum_probs=0.0

Q ss_pred             hhHHHHHHHHHHHHH
Q 033543           78 AWFIYLFIGVGVVLF   92 (117)
Q Consensus        78 ~~~~~~li~~G~~~~   92 (117)
                      ||++|+.|+++.+.+
T Consensus       547 PWyVWL~i~~~li~~  561 (610)
T PF01601_consen  547 PWYVWLAIILALIAF  561 (610)
T ss_dssp             ---------------
T ss_pred             HHHHHHHHHHHHHHH
Confidence            487888877766554


No 13 
>KOG4556 consensus Predicted membrane protein [Function unknown]
Probab=42.94  E-value=32  Score=25.47  Aligned_cols=47  Identities=23%  Similarity=0.292  Sum_probs=26.8

Q ss_pred             hhhhcccccCchhhHHHHHHHHHHHHHHHHHHHHHHhhccccchhhhhhh
Q 033543           66 SLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        66 ~~~~~~~~~~~~~~~~~~li~~G~~~~~v~~~Gc~Ga~~es~~lL~~y~~  115 (117)
                      +++.+++|.....|.+.+   .-.+=+++-+.|-.|+....+..+.+|..
T Consensus        18 ~l~RqvFDflGyqWapil---anFvhIiivIlGLFGtiQyR~ryl~~y~~   64 (205)
T KOG4556|consen   18 SLERQVFDFLGYQWAPIL---ANFVHIIIVILGLFGTIQYRRRYLYTYAS   64 (205)
T ss_pred             HHHHHHHHHhhhhhHHHH---HHHHHHHHHHHHhhhhhhcchhHHHHHHH
Confidence            344455554444443333   34444444556667888888888877753


No 14 
>PF10176 DUF2370:  Protein of unknown function (DUF2370);  InterPro: IPR019325 Proteins in this family are conserved from fungi to humans. They include the human NEDD4 family-interacting proteins and the yeast BSD2 metal homeostatis proteins. 
Probab=35.04  E-value=52  Score=25.19  Aligned_cols=32  Identities=16%  Similarity=0.473  Sum_probs=27.0

Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHHhhccccc
Q 033543           77 KAWFIYLFIGVGVVLFVISCVGCISATTRNGC  108 (117)
Q Consensus        77 ~~~~~~~li~~G~~~~~v~~~Gc~Ga~~es~~  108 (117)
                      .+|..|+++++|.++++-++.+++=+.|--|.
T Consensus       193 ~~wla~~Lm~~G~fI~irsi~dY~rVKR~Er~  224 (233)
T PF10176_consen  193 NPWLAYILMAFGWFIFIRSIIDYWRVKRMERL  224 (233)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            35777999999999999999999988875543


No 15 
>PF14927 Neurensin:  Neurensin
Probab=30.53  E-value=1.5e+02  Score=20.93  Aligned_cols=23  Identities=22%  Similarity=0.251  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHheeE
Q 033543           11 LKLLNFLLTLAGLAMVGYGIYLF   33 (117)
Q Consensus        11 l~~~N~lf~l~G~~li~~giw~~   33 (117)
                      -++.-+++++.|++.+.+|--+-
T Consensus        47 ~~i~g~l~Ll~Gi~~l~vgY~vP   69 (140)
T PF14927_consen   47 GFISGLLLLLLGIVALTVGYLVP   69 (140)
T ss_pred             HHHHHHHHHHHHHHHHHhhcccC
Confidence            56778889999999999986643


No 16 
>PF05640 NKAIN:  Na,K-Atpase Interacting protein;  InterPro: IPR008516 NKAIN (Na,K-Atpase INteracting) proteins are a family of evolutionary conserved transmembrane proteins that localise to neurons, that are critical for neuronal function, and that interact with the beta subunits, beta1 in vertebrates and beta in Drosophila, of Na,K-ATPase. NKAINs have highly conserved trans-membrane domains but otherwise no other characterised domains. NKAINs may function as subunits of pore or channel structures in neurons or they may affect the function of other membrane proteins. They are likely to function within the membrane bilayer [].
Probab=30.33  E-value=59  Score=24.37  Aligned_cols=26  Identities=8%  Similarity=0.146  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHhhccccchhhhhhh
Q 033543           90 VLFVISCVGCISATTRNGCCLTCVSL  115 (117)
Q Consensus        90 ~~~~v~~~Gc~Ga~~es~~lL~~y~~  115 (117)
                      +-+++-++|..||..-++..+..|.+
T Consensus        42 ~hIi~vIlGlFG~~QyR~ryi~~Y~v   67 (200)
T PF05640_consen   42 LHIIFVILGLFGAIQYRPRYIIVYAV   67 (200)
T ss_pred             HHHHHHHHHHhhheeecchHHHHHHH
Confidence            33344466678899888888888864


No 17 
>PF06724 DUF1206:  Domain of Unknown Function (DUF1206);  InterPro: IPR009597 This region consists of two a pair of transmembrane helices and occurs three times in each of the family member proteins.
Probab=29.87  E-value=55  Score=19.81  Aligned_cols=20  Identities=50%  Similarity=1.090  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHheeEEe
Q 033543           16 FLLTLAGLAMVGYGIYLFVE   35 (117)
Q Consensus        16 ~lf~l~G~~li~~giw~~~~   35 (117)
                      .+.+++|+.++++|+|...+
T Consensus        48 ~ll~~vg~gli~~gi~~~~~   67 (73)
T PF06724_consen   48 WLLGAVGLGLIGYGIWQFVK   67 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            57789999999999997653


No 18 
>PF11014 DUF2852:  Protein of unknown function (DUF2852);  InterPro: IPR021273  This bacterial family of proteins has no known function. 
Probab=28.89  E-value=50  Score=22.58  Aligned_cols=16  Identities=31%  Similarity=0.478  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHhee
Q 033543           17 LLTLAGLAMVGYGIYL   32 (117)
Q Consensus        17 lf~l~G~~li~~giw~   32 (117)
                      +||=+|++++++-+|-
T Consensus        21 ~fWPlGla~Lay~iw~   36 (115)
T PF11014_consen   21 VFWPLGLALLAYMIWG   36 (115)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5789999999999997


No 19 
>PF04854 DUF624:  Protein of unknown function, DUF624;  InterPro: IPR006938 This family consists of uncharacterised or hypothetical bacterial proteins.
Probab=26.82  E-value=71  Score=19.27  Aligned_cols=20  Identities=40%  Similarity=0.516  Sum_probs=14.1

Q ss_pred             HHHHHHHH---HHHHHHHHHHhe
Q 033543           12 KLLNFLLT---LAGLAMVGYGIY   31 (117)
Q Consensus        12 ~~~N~lf~---l~G~~li~~giw   31 (117)
                      ..+|++++   +.|+.++++|--
T Consensus         2 ~~ln~lwl~~~l~~l~v~tigPA   24 (77)
T PF04854_consen    2 VVLNLLWLLFTLAGLPVFTIGPA   24 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46788877   788777666643


No 20 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=26.74  E-value=98  Score=21.48  Aligned_cols=29  Identities=14%  Similarity=0.209  Sum_probs=24.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHheeEEec
Q 033543            8 ECLLKLLNFLLTLAGLAMVGYGIYLFVEY   36 (117)
Q Consensus         8 k~~l~~~N~lf~l~G~~li~~giw~~~~~   36 (117)
                      +|.+..+.++..++|+.+++-++-+....
T Consensus        36 NysiL~Ls~vvlvi~~~LLgrsi~ANRnr   64 (125)
T PF15048_consen   36 NYSILALSFVVLVISFFLLGRSIQANRNR   64 (125)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHhHhcccc
Confidence            68889999999999999999999875543


No 21 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=26.40  E-value=1.3e+02  Score=16.95  Aligned_cols=26  Identities=23%  Similarity=0.372  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcccc
Q 033543           82 YLFIGVGVVLFVISCVGCISATTRNG  107 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~es~  107 (117)
                      ++++.++.++..++...+.=|.|..+
T Consensus         4 ~~lip~sl~l~~~~l~~f~Wavk~GQ   29 (45)
T PF03597_consen    4 YILIPVSLILGLIALAAFLWAVKSGQ   29 (45)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHccCC
Confidence            67777777777777777777776554


No 22 
>PF15125 TMEM238:  TMEM238 protein family
Probab=25.18  E-value=1.7e+02  Score=17.95  Aligned_cols=24  Identities=25%  Similarity=0.434  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHHHheeEEe
Q 033543           12 KLLNFLLTLAGLAMVGYGIYLFVE   35 (117)
Q Consensus        12 ~~~N~lf~l~G~~li~~giw~~~~   35 (117)
                      +.+.++|=++|..++..|+.+..+
T Consensus         7 f~laV~fD~vGl~~Ll~GiFa~l~   30 (65)
T PF15125_consen    7 FWLAVVFDVVGLVMLLTGIFAPLD   30 (65)
T ss_pred             hHHHHHHHHhhHHHHHHHHhcchh
Confidence            456778889999999999987763


No 23 
>PF10812 DUF2561:  Protein of unknown function (DUF2561);  InterPro: IPR024381 This family of proteins with unknown function appears to be found predominantly in Mycobacterium spp.
Probab=24.99  E-value=3e+02  Score=20.70  Aligned_cols=59  Identities=20%  Similarity=0.241  Sum_probs=37.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHheeEEecccccccCCcCCCCCCCcccccCcchhhhhhhhhcccccCchhhHHHHHHHHHH
Q 033543           10 LLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPVSGDEGFVQLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGV   89 (117)
Q Consensus        10 ~l~~~N~lf~l~G~~li~~giw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~G~   89 (117)
                      +|.-.+-..|+.-+.+-....-.+.|.++-.+-.+             ++               ...+|.+|..|++++
T Consensus        23 iLlG~CaaiWLa~lG~~VaA~VaL~Dlgrg~~~~s-------------~s---------------s~T~WvLY~VI~VSa   74 (207)
T PF10812_consen   23 ILLGACAAIWLAALGVSVAATVALVDLGRGFHESS-------------GS---------------SGTPWVLYAVIGVSA   74 (207)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhheeecccCCccCcC-------------CC---------------CCCCEeehHHHHHHH
Confidence            44555667788888888888888888765321111             00               123467788888888


Q ss_pred             HHHHHHH
Q 033543           90 VLFVISC   96 (117)
Q Consensus        90 ~~~~v~~   96 (117)
                      .++.-+.
T Consensus        75 aVIagAV   81 (207)
T PF10812_consen   75 AVIAGAV   81 (207)
T ss_pred             HHHHHHH
Confidence            7765443


No 24 
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=23.20  E-value=63  Score=25.57  Aligned_cols=26  Identities=23%  Similarity=0.497  Sum_probs=21.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHheeE
Q 033543            6 CLECLLKLLNFLLTLAGLAMVGYGIYLF   33 (117)
Q Consensus         6 ~lk~~l~~~N~lf~l~G~~li~~giw~~   33 (117)
                      ..+++  +|.++|+..|..+-.+|+|+-
T Consensus       108 FaQ~L--IFGFLFLTSGmLISvLGiWVP  133 (319)
T PF15471_consen  108 FAQFL--IFGFLFLTSGMLISVLGIWVP  133 (319)
T ss_pred             hhHHH--HHHHHHHhhhhhhhhheeeec
Confidence            45555  668899999999999999984


No 25 
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=22.78  E-value=82  Score=15.86  Aligned_cols=19  Identities=42%  Similarity=0.656  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHheeEEe
Q 033543           17 LLTLAGLAMVGYGIYLFVE   35 (117)
Q Consensus        17 lf~l~G~~li~~giw~~~~   35 (117)
                      .+.+.|+++++.+.|....
T Consensus        12 ~~~~~G~~l~~~~~~~~~~   30 (34)
T TIGR01167        12 LLLLLGLLLLGLGGLLLRK   30 (34)
T ss_pred             HHHHHHHHHHHHHHHHhee
Confidence            4456677777777766544


No 26 
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=21.89  E-value=1.8e+02  Score=16.92  Aligned_cols=26  Identities=12%  Similarity=0.151  Sum_probs=19.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcccc
Q 033543           82 YLFIGVGVVLFVISCVGCISATTRNG  107 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~es~  107 (117)
                      +++|.++.++..++...+.=|.|..+
T Consensus         5 ~~LIpiSl~l~~~~l~~f~Wavk~GQ   30 (51)
T TIGR00847         5 TILIPISLLLGGVGLVAFLWSLKSGQ   30 (51)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHccCC
Confidence            67788888877777777777776544


No 27 
>PF06637 PV-1:  PV-1 protein (PLVAP);  InterPro: IPR009538 This family consists of several PV-1 (PLVAP) proteins, which seem to be specific to mammals. PV-1 is a novel protein component of the endothelial fenestral and stomatal diaphragms []. The function of this family is unknown.
Probab=21.34  E-value=1.6e+02  Score=24.54  Aligned_cols=19  Identities=16%  Similarity=0.377  Sum_probs=16.0

Q ss_pred             CCchhHHHHHHHHHHHHHH
Q 033543            2 ACRGCLECLLKLLNFLLTL   20 (117)
Q Consensus         2 ~c~~~lk~~l~~~N~lf~l   20 (117)
                      ||...+||++++..++-.+
T Consensus        20 gC~YYlryfFlF~SLIQ~L   38 (442)
T PF06637_consen   20 GCWYYLRYFFLFVSLIQFL   38 (442)
T ss_pred             ChhHHHHHHHHHHHHHHHH
Confidence            6888999999999987764


No 28 
>PRK09400 secE preprotein translocase subunit SecE; Reviewed
Probab=21.30  E-value=1.8e+02  Score=17.41  Aligned_cols=19  Identities=21%  Similarity=0.380  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 033543           82 YLFIGVGVVLFVISCVGCI  100 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~  100 (117)
                      -+.-++|+..+++|++|+.
T Consensus        34 ~ia~~~~iG~~i~G~iGf~   52 (61)
T PRK09400         34 LVAKVTGLGILLIGLIGFI   52 (61)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            4667778888889998875


No 29 
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=20.87  E-value=1.5e+02  Score=22.19  Aligned_cols=19  Identities=26%  Similarity=0.574  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 033543           81 IYLFIGVGVVLFVISCVGC   99 (117)
Q Consensus        81 ~~~li~~G~~~~~v~~~Gc   99 (117)
                      ..+++.+|++.+++|.+|.
T Consensus         9 ~~vLLliG~~f~ligaIGL   27 (197)
T PRK12585          9 ISIMILIGGLLSILAAIGV   27 (197)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3578888988888887764


No 30 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=20.71  E-value=1.5e+02  Score=15.65  Aligned_cols=24  Identities=29%  Similarity=0.466  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcc
Q 033543           82 YLFIGVGVVLFVISCVGCISATTR  105 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~Gc~Ga~~e  105 (117)
                      ++-+.+|.+++++.+-|.....++
T Consensus        10 W~Gl~~g~~l~~~~~tG~~~~f~~   33 (37)
T PF13706_consen   10 WLGLILGLLLFVIFLTGAVMVFRD   33 (37)
T ss_pred             HHHHHHHHHHHHHHHHhHHHHHHH
Confidence            577889999999999998877653


No 31 
>PF11381 DUF3185:  Protein of unknown function (DUF3185);  InterPro: IPR021521  Some members in this bacterial family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=20.28  E-value=1.6e+02  Score=17.70  Aligned_cols=17  Identities=12%  Similarity=0.169  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 033543           82 YLFIGVGVVLFVISCVG   98 (117)
Q Consensus        82 ~~li~~G~~~~~v~~~G   98 (117)
                      ...++.|++..++|..+
T Consensus        42 ~~~ligG~va~ivGl~~   58 (59)
T PF11381_consen   42 IWYLIGGAVAVIVGLFL   58 (59)
T ss_pred             HHHHHhHHHHHHHHHhh
Confidence            36677788888887653


No 32 
>PRK07946 putative monovalent cation/H+ antiporter subunit C; Reviewed
Probab=20.28  E-value=88  Score=22.68  Aligned_cols=20  Identities=30%  Similarity=0.431  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHheeEE
Q 033543           15 NFLLTLAGLAMVGYGIYLFV   34 (117)
Q Consensus        15 N~lf~l~G~~li~~giw~~~   34 (117)
                      |++..+...++.++|+|+..
T Consensus         4 ~l~~~i~~gvL~~~G~Ylll   23 (163)
T PRK07946          4 NLGLLVAIGVLTSAGVYLLL   23 (163)
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            44444555555556666554


Done!