Query         033561
Match_columns 116
No_of_seqs    95 out of 97
Neff          2.6 
Searched_HMMs 46136
Date          Fri Mar 29 03:42:06 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033561.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033561hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00088 predicted protein; Pr 100.0 1.1E-33 2.5E-38  210.8   8.1  112    1-116     1-127 (127)
  2 PF06596 PsbX:  Photosystem II   99.8 8.1E-21 1.7E-25  118.2   2.2   38   79-116     1-39  (39)
  3 CHL00114 psbX photosystem II p  99.8 2.6E-20 5.7E-25  116.1   4.2   38   79-116     1-39  (39)
  4 PF14187 DUF4310:  Domain of un  68.5     7.3 0.00016   31.9   3.7   34   77-110   101-134 (209)
  5 TIGR03579 EF_0833 conserved hy  59.6      13 0.00028   30.5   3.6   33   77-109    99-131 (209)
  6 PF12732 YtxH:  YtxH-like prote  52.5      12 0.00026   24.4   2.0   15   86-100     1-15  (74)
  7 PF09813 Coiled-coil_56:  Coile  48.7      20 0.00044   26.4   2.9   30   82-111    48-77  (100)
  8 PF04835 Pox_A9:  A9 protein co  43.8      34 0.00073   22.9   3.0   33   82-114    21-53  (54)
  9 PHA02680 ORF090 IMV phosphoryl  41.5      21 0.00045   26.1   1.9   28   82-109     6-35  (91)
 10 PF05767 Pox_A14:  Poxvirus vir  39.4      17 0.00037   26.6   1.2   30   81-110     5-36  (92)
 11 PF07423 DUF1510:  Protein of u  36.6      38 0.00083   27.3   2.9   25   85-109    13-38  (217)
 12 PF13706 PepSY_TM_3:  PepSY-ass  34.6      21 0.00046   21.0   0.9   26   88-115    11-37  (37)
 13 PHA03048 IMV membrane protein;  33.7      23 0.00051   25.9   1.2   29   82-110     6-36  (93)
 14 PHA02898 virion envelope prote  28.7      32 0.00069   25.2   1.2   30   82-111     6-37  (92)
 15 TIGR03546 conserved hypothetic  28.3      66  0.0014   24.6   2.9   21   83-103   102-122 (154)
 16 PF07123 PsbW:  Photosystem II   27.9 2.3E+02  0.0051   22.0   5.8    9    1-9       1-9   (138)
 17 PRK10927 essential cell divisi  27.9      60  0.0013   28.1   2.9   19   94-112    41-59  (319)
 18 COG4062 MtrB Tetrahydromethano  27.5      54  0.0012   24.6   2.2   25   79-103    73-99  (108)
 19 COG2354 Uncharacterized protei  25.0      72  0.0016   27.6   2.8   22   78-99    273-294 (303)
 20 PF14575 EphA2_TM:  Ephrin type  22.7      78  0.0017   21.3   2.1   22   87-108     3-24  (75)
 21 TIGR02838 spore_V_AC stage V s  22.6      75  0.0016   24.5   2.3   21   79-99     13-33  (141)
 22 PF06783 UPF0239:  Uncharacteri  22.0   1E+02  0.0022   22.2   2.7   30   83-112    18-49  (85)
 23 TIGR03319 YmdA_YtgF conserved   21.4      33 0.00071   30.4   0.1   12  104-115   246-257 (514)
 24 PF05283 MGC-24:  Multi-glycosy  20.8      40 0.00087   26.8   0.5   22   85-106   157-178 (186)
 25 PF09835 DUF2062:  Uncharacteri  20.3      98  0.0021   22.2   2.4   23   82-104   112-134 (154)
 26 PF05440 MtrB:  Tetrahydrometha  20.1 1.3E+02  0.0028   22.0   2.9   23   79-101    72-94  (97)

No 1  
>PLN00088 predicted protein; Provisional
Probab=100.00  E-value=1.1e-33  Score=210.84  Aligned_cols=112  Identities=38%  Similarity=0.511  Sum_probs=97.6

Q ss_pred             Cccccc----cccchh-hhhhccc-CCCccccccCCC-CCCcchhhhcCCCCccceeEEech-hhhHHHHHHHHHHHHHH
Q 033561            1 MASVSM----AMPLSS-ATQNRLI-QPSSESFLKPLP-VRPSKAARFLGKPKSRARLQVQAS-LKEKAVTGLTAAALTAS   72 (116)
Q Consensus         1 MAS~Sm----a~pl~~-at~~~~~-~pss~~~~~Plp-~r~s~~~~~~~~~~~~~r~~~~as-~k~k~v~~ltaaa~~as   72 (116)
                      |||++|    +.++++ ++|.|+. .++.|+|-.--| .||+++...    .+|+|+|++++ +|||+++|+|++|++|+
T Consensus         1 ma~~~~~s~~~a~~~~~~t~~~~~k~~~~~g~~l~~p~~~~~~~~~~----~n~~r~~~~as~~~ekav~gltaaAl~As   76 (127)
T PLN00088          1 MACAAMASVSSAATAPLATLVWEAKLLSRQGLALAAPSGKKQVSVAI----SNRSRVVMSLPAKEDHNVASLTSLALLAA   76 (127)
T ss_pred             CchHHHHHhhccccchhhHhhhhhhhhccccceecCCCCccchhhhh----cccceeEEecchHHHHHHHHHHHHHHHHH
Confidence            788775    357777 8899988 899999875445 677777754    34799999998 89999999999999999


Q ss_pred             hh------hc-CCCChhHHHHHHHHHHHHHHHHHHhhheeeeeccCcccCC
Q 033561           73 MA------AG-SGLSPSLKNFLLSIVAGGVVLAAIVGAVIGVANFDPVKRT  116 (116)
Q Consensus        73 ~v------Aa-~~mTPSL~NFl~SLvaG~vVv~~i~~Ali~VSq~D~V~R~  116 (116)
                      |+      || +||||||+||||||+|||+|+++|+++||||||||||+|+
T Consensus        77 mv~pevAeAA~~gvTPSLsNFL~SLvaGgvVv~pI~~Ali~VSq~D~V~R~  127 (127)
T PLN00088         77 AVVPEIAEAAQPGVSPSLKNLLLSVVAGGVVITVIGVAVAGVSTFDPVKRK  127 (127)
T ss_pred             hhCHHHHHhccCCCChhHHHHHHHHHhhhhhhhhhheeeEEEeccCccccC
Confidence            98      55 7899999999999999999999999999999999999996


No 2  
>PF06596 PsbX:  Photosystem II reaction centre X protein (PsbX);  InterPro: IPR009518 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The low molecular weight transmembrane protein PsbX found in PSII is associated with the oxygen-evolving complex. Its expression is light-regulated. PsbX appears to be involved in the regulation of the amount of PSII [], and may be involved in the binding or turnover of quinone molecules at the Qb (PsbA) site [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0016020 membrane; PDB: 3ARC_x 3A0H_X 3A0B_X 3PRR_X 1S5L_x 4FBY_j 3PRQ_X 3KZI_X 3BZ2_X 3BZ1_X.
Probab=99.81  E-value=8.1e-21  Score=118.17  Aligned_cols=38  Identities=58%  Similarity=0.922  Sum_probs=29.6

Q ss_pred             CChhHHHHHHHHHHHH-HHHHHHhhheeeeeccCcccCC
Q 033561           79 LSPSLKNFLLSIVAGG-VVLAAIVGAVIGVANFDPVKRT  116 (116)
Q Consensus        79 mTPSL~NFl~SLvaG~-vVv~~i~~Ali~VSq~D~V~R~  116 (116)
                      |||||+|||+||+||+ +|+++|+++|++|||+||++|+
T Consensus         1 mTpSL~nfl~Sl~aG~~iVv~~i~~ali~VSq~D~v~R~   39 (39)
T PF06596_consen    1 MTPSLSNFLLSLVAGAVIVVIPIAGALIFVSQFDRVKRS   39 (39)
T ss_dssp             --HHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCS-----
T ss_pred             CCHhHHHHHHHHHhhhhhhhhhhhhheEEEeccCccccC
Confidence            8999999999999999 6678899999999999999996


No 3  
>CHL00114 psbX photosystem II protein X; Reviewed
Probab=99.81  E-value=2.6e-20  Score=116.10  Aligned_cols=38  Identities=29%  Similarity=0.511  Sum_probs=36.2

Q ss_pred             CChhHHHHHHHHHHHHHHHH-HHhhheeeeeccCcccCC
Q 033561           79 LSPSLKNFLLSIVAGGVVLA-AIVGAVIGVANFDPVKRT  116 (116)
Q Consensus        79 mTPSL~NFl~SLvaG~vVv~-~i~~Ali~VSq~D~V~R~  116 (116)
                      |||||+|||+||+||++|++ +|++||+||||+|+++|+
T Consensus         1 MTpSLsnF~~SL~~Ga~ivvipi~~aLifvSq~D~v~R~   39 (39)
T CHL00114          1 MTPSLSAFINSLLLGAIIVVIPITLALLFVSQKDRTTRN   39 (39)
T ss_pred             CChhHHHHHHHHHHHHHHhHHHhhhheEEEeccceeccC
Confidence            99999999999999999976 599999999999999996


No 4  
>PF14187 DUF4310:  Domain of unknown function (DUF4310)
Probab=68.47  E-value=7.3  Score=31.90  Aligned_cols=34  Identities=29%  Similarity=0.518  Sum_probs=29.4

Q ss_pred             CCCChhHHHHHHHHHHHHHHHHHHhhheeeeecc
Q 033561           77 SGLSPSLKNFLLSIVAGGVVLAAIVGAVIGVANF  110 (116)
Q Consensus        77 ~~mTPSL~NFl~SLvaG~vVv~~i~~Ali~VSq~  110 (116)
                      .+.+-.++||-+||+-|+++=.+|+..+|++-++
T Consensus       101 ~Gi~~p~~~F~laLl~G~~iG~~iG~iIi~iRK~  134 (209)
T PF14187_consen  101 AGITAPLENFPLALLTGAVIGLIIGYIIILIRKF  134 (209)
T ss_pred             ccccchHHHhHHHHHHHHHHHHHHhheeEEEEee
Confidence            5888999999999999999988888888887653


No 5  
>TIGR03579 EF_0833 conserved hypothetical protein EF_0833/AHA_3914. Members of this family of relatively rare proteins are found in both Gram-positive (e.g. Enterococcus faecalis) and Gram-negative (e.g. Aeromonas hydrophila) bacteria, as part of a cluster of conserved proteins. The function is unknown.
Probab=59.62  E-value=13  Score=30.46  Aligned_cols=33  Identities=27%  Similarity=0.425  Sum_probs=28.0

Q ss_pred             CCCChhHHHHHHHHHHHHHHHHHHhhheeeeec
Q 033561           77 SGLSPSLKNFLLSIVAGGVVLAAIVGAVIGVAN  109 (116)
Q Consensus        77 ~~mTPSL~NFl~SLvaG~vVv~~i~~Ali~VSq  109 (116)
                      .+++-.++||-+||+-|+++=++|+..+|++-+
T Consensus        99 ~G~~~pv~nF~lsL~tG~~lG~~iG~iIi~~RK  131 (209)
T TIGR03579        99 AGIVAPVENFGLSLLTGAVLGLAVGYVIILIRK  131 (209)
T ss_pred             ccccccHHHHHHHHHHHHHHHHHhheeEEEEEe
Confidence            588999999999999999987778777777554


No 6  
>PF12732 YtxH:  YtxH-like protein;  InterPro: IPR024623 This family of uncharacterised proteins is found in bacteria. Proteins in this family are typically between 100 and 143 amino acids in length. The N-terminal region is the most conserved.
Probab=52.51  E-value=12  Score=24.35  Aligned_cols=15  Identities=47%  Similarity=0.612  Sum_probs=10.8

Q ss_pred             HHHHHHHHHHHHHHH
Q 033561           86 FLLSIVAGGVVLAAI  100 (116)
Q Consensus        86 Fl~SLvaG~vVv~~i  100 (116)
                      |++++++|+++-+++
T Consensus         1 F~~g~l~Ga~~Ga~~   15 (74)
T PF12732_consen    1 FLLGFLAGAAAGAAA   15 (74)
T ss_pred             CHHHHHHHHHHHHHH
Confidence            788888888765443


No 7  
>PF09813 Coiled-coil_56:  Coiled-coil domain-containing protein 56;  InterPro: IPR018628  Members of this family of proteins have no known function. 
Probab=48.74  E-value=20  Score=26.40  Aligned_cols=30  Identities=20%  Similarity=0.294  Sum_probs=25.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHhhheeeeeccC
Q 033561           82 SLKNFLLSIVAGGVVLAAIVGAVIGVANFD  111 (116)
Q Consensus        82 SL~NFl~SLvaG~vVv~~i~~Ali~VSq~D  111 (116)
                      .-+|-+.++..|++|+++-+--+..|+|-|
T Consensus        48 R~rN~~Tgl~L~~~v~gIY~YTi~sV~Qe~   77 (100)
T PF09813_consen   48 RRRNLLTGLALGAFVVGIYAYTIYSVKQED   77 (100)
T ss_pred             hhhhHHHHHHHHHHHHHHHhheeeeechhh
Confidence            458999999999999999888888888865


No 8  
>PF04835 Pox_A9:  A9 protein conserved region;  InterPro: IPR006920 This entry represents a family of Chordopoxvirus A9 proteins. Chordopoxvirus belongs to the family Poxviridae and is the cause of vertebrate infections [].
Probab=43.76  E-value=34  Score=22.93  Aligned_cols=33  Identities=18%  Similarity=0.108  Sum_probs=24.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHhhheeeeeccCccc
Q 033561           82 SLKNFLLSIVAGGVVLAAIVGAVIGVANFDPVK  114 (116)
Q Consensus        82 SL~NFl~SLvaG~vVv~~i~~Ali~VSq~D~V~  114 (116)
                      |+.+-+.=++.+-++-.+++++|+.+|+.|..+
T Consensus        21 sF~fViik~vismimylilGi~L~yis~~~~~~   53 (54)
T PF04835_consen   21 SFWFVIIKSVISMIMYLILGIALIYISSNDDKK   53 (54)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHhhhccCcccc
Confidence            445555556667677788999999999988653


No 9  
>PHA02680 ORF090 IMV phosphorylated membrane protein; Provisional
Probab=41.48  E-value=21  Score=26.10  Aligned_cols=28  Identities=25%  Similarity=0.419  Sum_probs=21.4

Q ss_pred             hHHHHHHHHHHHHHHHHH--Hhhheeeeec
Q 033561           82 SLKNFLLSIVAGGVVLAA--IVGAVIGVAN  109 (116)
Q Consensus        82 SL~NFl~SLvaG~vVv~~--i~~Ali~VSq  109 (116)
                      -++|+..+++.||+++++  ...|.+=.|+
T Consensus         6 ~i~ny~s~vli~GIiLL~~ACIFAfidFSK   35 (91)
T PHA02680          6 TLKSYYSGVLICGVLLLTAACVFAFVDFSK   35 (91)
T ss_pred             HHHHhccHHHHHHHHHHHHHHHHhhhhhhc
Confidence            479999999999999866  4456655555


No 10 
>PF05767 Pox_A14:  Poxvirus virion envelope protein A14;  InterPro: IPR008785 This family consists of several Poxvirus virion envelope protein A14-like sequences. A14 is a component of the virion membrane and has been found to be an H1 phosphatase substrate in vivo and in vitro. A14 is hyperphosphorylated on serine residues in the absence of H1 expression [].; GO: 0019031 viral envelope
Probab=39.37  E-value=17  Score=26.55  Aligned_cols=30  Identities=23%  Similarity=0.409  Sum_probs=21.9

Q ss_pred             hhHHHHHHHHHHHHHHHHH--Hhhheeeeecc
Q 033561           81 PSLKNFLLSIVAGGVVLAA--IVGAVIGVANF  110 (116)
Q Consensus        81 PSL~NFl~SLvaG~vVv~~--i~~Ali~VSq~  110 (116)
                      --|+|+..+++.||+++++  +..|.+=.|+.
T Consensus         5 ~~~~n~~S~vli~GiiLL~~aCIfAfidfsK~   36 (92)
T PF05767_consen    5 GFLSNYFSGVLIGGIILLIAACIFAFIDFSKN   36 (92)
T ss_pred             HHHHhccchHHHHHHHHHHHHHHHHhhhhccC
Confidence            3589999999999999866  44455555544


No 11 
>PF07423 DUF1510:  Protein of unknown function (DUF1510);  InterPro: IPR009988 This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown.
Probab=36.59  E-value=38  Score=27.33  Aligned_cols=25  Identities=32%  Similarity=0.279  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHH-Hhhheeeeec
Q 033561           85 NFLLSIVAGGVVLAA-IVGAVIGVAN  109 (116)
Q Consensus        85 NFl~SLvaG~vVv~~-i~~Ali~VSq  109 (116)
                      |-++=++.|-|+|++ |.+.-+|+.+
T Consensus        13 N~iLNiaI~IV~lLIiiva~~lf~~~   38 (217)
T PF07423_consen   13 NKILNIAIGIVSLLIIIVAYQLFFGG   38 (217)
T ss_pred             hhhHHHHHHHHHHHHHHHhhhheecC
Confidence            556667777777666 4444555533


No 12 
>PF13706 PepSY_TM_3:  PepSY-associated TM helix
Probab=34.59  E-value=21  Score=20.99  Aligned_cols=26  Identities=27%  Similarity=0.514  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHH-HhhheeeeeccCcccC
Q 033561           88 LSIVAGGVVLAA-IVGAVIGVANFDPVKR  115 (116)
Q Consensus        88 ~SLvaG~vVv~~-i~~Ali~VSq~D~V~R  115 (116)
                      .+|+.|.++++. ++|++...  .|.++|
T Consensus        11 ~Gl~~g~~l~~~~~tG~~~~f--~~ei~r   37 (37)
T PF13706_consen   11 LGLILGLLLFVIFLTGAVMVF--RDEIDR   37 (37)
T ss_pred             HHHHHHHHHHHHHHHhHHHHH--HHhhcC
Confidence            567777776655 55555443  444444


No 13 
>PHA03048 IMV membrane protein; Provisional
Probab=33.71  E-value=23  Score=25.92  Aligned_cols=29  Identities=21%  Similarity=0.438  Sum_probs=21.5

Q ss_pred             hHHHHHHHHHHHHHHHHH--Hhhheeeeecc
Q 033561           82 SLKNFLLSIVAGGVVLAA--IVGAVIGVANF  110 (116)
Q Consensus        82 SL~NFl~SLvaG~vVv~~--i~~Ali~VSq~  110 (116)
                      -++|+...++.||+++++  ...|.+=.|+.
T Consensus         6 ~~~ny~S~vli~GIiLL~~aCIfAfidfsK~   36 (93)
T PHA03048          6 MISNYFSTALIGGIILLAASCIFAFVDFSKN   36 (93)
T ss_pred             HhhcccchHHHHHHHHHHHHHHHhhhhhhcC
Confidence            489999999999999866  44455555554


No 14 
>PHA02898 virion envelope protein; Provisional
Probab=28.66  E-value=32  Score=25.20  Aligned_cols=30  Identities=27%  Similarity=0.260  Sum_probs=22.0

Q ss_pred             hHHHHHHHHHHHHHHHHH--HhhheeeeeccC
Q 033561           82 SLKNFLLSIVAGGVVLAA--IVGAVIGVANFD  111 (116)
Q Consensus        82 SL~NFl~SLvaG~vVv~~--i~~Ali~VSq~D  111 (116)
                      -++|...+++.+|++|++  ...|.+=.|+..
T Consensus         6 ~~~N~~s~vli~GIiLL~~ACIfAfidfSK~~   37 (92)
T PHA02898          6 FFKNRPSYVVAFGIILLIVACICAYIELSKSE   37 (92)
T ss_pred             hhhcCcchHHHHHHHHHHHHHHHheehhhcCC
Confidence            368999999999999866  445666556543


No 15 
>TIGR03546 conserved hypothetical protein TIGR03546. Members of this family are uncharacterized proteins, usually encoded by a gene adjacent to a member of family TIGR03545, which is also uncharacterized.
Probab=28.34  E-value=66  Score=24.58  Aligned_cols=21  Identities=33%  Similarity=0.420  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHHHHHHHhhh
Q 033561           83 LKNFLLSIVAGGVVLAAIVGA  103 (116)
Q Consensus        83 L~NFl~SLvaG~vVv~~i~~A  103 (116)
                      +..|..+++.|+++++.|.+.
T Consensus       102 l~~f~~tl~~Gg~l~Gli~~~  122 (154)
T TIGR03546       102 LARFNNTIVMGSFVVGLILLP  122 (154)
T ss_pred             HHHHHHHHHHhhHHHHHHHHH
Confidence            778888999999999876554


No 16 
>PF07123 PsbW:  Photosystem II reaction centre W protein (PsbW);  InterPro: IPR009806 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbW found in PSII, where it is a subunit of the oxygen-evolving complex. PsbW appears to have several roles, including guiding PSII biogenesis and assembly, stabilising dimeric PSII [], and facilitating PSII repair after photo-inhibition []. There appears to be two classes of PsbW, class 1 being found predominantly in algae and cyanobacteria, and class 2 being found predominantly in plants. This entry represents class 2 PsbW.; GO: 0015979 photosynthesis, 0009507 chloroplast, 0009523 photosystem II
Probab=27.94  E-value=2.3e+02  Score=21.97  Aligned_cols=9  Identities=22%  Similarity=0.464  Sum_probs=5.9

Q ss_pred             Ccccccccc
Q 033561            1 MASVSMAMP    9 (116)
Q Consensus         1 MAS~Sma~p    9 (116)
                      ||+++++.+
T Consensus         1 MAti~a~~~    9 (138)
T PF07123_consen    1 MATIAASAS    9 (138)
T ss_pred             Cceeeeccc
Confidence            677776555


No 17 
>PRK10927 essential cell division protein FtsN; Provisional
Probab=27.92  E-value=60  Score=28.08  Aligned_cols=19  Identities=16%  Similarity=0.361  Sum_probs=13.8

Q ss_pred             HHHHHHHhhheeeeeccCc
Q 033561           94 GVVLAAIVGAVIGVANFDP  112 (116)
Q Consensus        94 ~vVv~~i~~Ali~VSq~D~  112 (116)
                      ..||++.+|+|.||++..+
T Consensus        41 vavlv~fiGGLyFith~k~   59 (319)
T PRK10927         41 AAVLVTFIGGLYFITHHKK   59 (319)
T ss_pred             HHHHHHHhhheEEEecCCC
Confidence            4456667778999998664


No 18 
>COG4062 MtrB Tetrahydromethanopterin S-methyltransferase, subunit B [Coenzyme metabolism]
Probab=27.53  E-value=54  Score=24.62  Aligned_cols=25  Identities=24%  Similarity=0.230  Sum_probs=18.0

Q ss_pred             CChhHHHHHHHHHHHHHH--HHHHhhh
Q 033561           79 LSPSLKNFLLSIVAGGVV--LAAIVGA  103 (116)
Q Consensus        79 mTPSL~NFl~SLvaG~vV--v~~i~~A  103 (116)
                      |.--|+||+++++.|-.|  ++++..+
T Consensus        73 ~aG~~tna~yGfviGl~i~aLlAlil~   99 (108)
T COG4062          73 TAGYLTNAFYGFVIGLGIMALLALILG   99 (108)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445689999999999888  4444433


No 19 
>COG2354 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.03  E-value=72  Score=27.59  Aligned_cols=22  Identities=45%  Similarity=0.606  Sum_probs=19.3

Q ss_pred             CCChhHHHHHHHHHHHHHHHHH
Q 033561           78 GLSPSLKNFLLSIVAGGVVLAA   99 (116)
Q Consensus        78 ~mTPSL~NFl~SLvaG~vVv~~   99 (116)
                      -..|++-|+...+++|+++++.
T Consensus       273 w~~~t~~~~v~g~v~G~vvv~~  294 (303)
T COG2354         273 WLVPTLLNAVLGLVIGAVVVAL  294 (303)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3679999999999999998865


No 20 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=22.67  E-value=78  Score=21.26  Aligned_cols=22  Identities=32%  Similarity=0.357  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHhhheeeee
Q 033561           87 LLSIVAGGVVLAAIVGAVIGVA  108 (116)
Q Consensus        87 l~SLvaG~vVv~~i~~Ali~VS  108 (116)
                      +++++.|.++++++.+.++++.
T Consensus         3 i~~~~~g~~~ll~~v~~~~~~~   24 (75)
T PF14575_consen    3 IASIIVGVLLLLVLVIIVIVCF   24 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCC
T ss_pred             EehHHHHHHHHHHhheeEEEEE
Confidence            4566667666655444444443


No 21 
>TIGR02838 spore_V_AC stage V sporulation protein AC. This model describes stage V sporulation protein AC, a paralog of stage V sporulation protein AE. Both are proteins found to present in a species if and only if that species is one of the Firmicutes capable of endospore formation, as of the time of the publication of the genome of Carboxydothermus hydrogenoformans. Mutants in spoVAC have a stage V sproulation defect.
Probab=22.58  E-value=75  Score=24.50  Aligned_cols=21  Identities=29%  Similarity=0.594  Sum_probs=17.8

Q ss_pred             CChhHHHHHHHHHHHHHHHHH
Q 033561           79 LSPSLKNFLLSIVAGGVVLAA   99 (116)
Q Consensus        79 mTPSL~NFl~SLvaG~vVv~~   99 (116)
                      =.|.++|+++..+.||+|-++
T Consensus        13 k~~~~~n~l~AFlvGG~IC~i   33 (141)
T TIGR02838        13 KPPYLKNCVMAFLVGGLICLI   33 (141)
T ss_pred             CCcHHHHHHHHHHhCcHHHHH
Confidence            367899999999999998654


No 22 
>PF06783 UPF0239:  Uncharacterised protein family (UPF0239);  InterPro: IPR009621 This is a group of transmembrane proteins of unknown function.; GO: 0016021 integral to membrane
Probab=21.98  E-value=1e+02  Score=22.20  Aligned_cols=30  Identities=13%  Similarity=0.390  Sum_probs=19.5

Q ss_pred             HHHHH-HHHHHHHHHHHH-HhhheeeeeccCc
Q 033561           83 LKNFL-LSIVAGGVVLAA-IVGAVIGVANFDP  112 (116)
Q Consensus        83 L~NFl-~SLvaG~vVv~~-i~~Ali~VSq~D~  112 (116)
                      +.|+| ++|..|++.=.+ |..+++-+++.|.
T Consensus        18 ~e~llRYGLf~GAIFQliCilAiI~~~~~s~~   49 (85)
T PF06783_consen   18 FENLLRYGLFVGAIFQLICILAIILPISKSHE   49 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHheeeecCCccC
Confidence            44554 789999998444 5555666666654


No 23 
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF.
Probab=21.39  E-value=33  Score=30.39  Aligned_cols=12  Identities=42%  Similarity=0.891  Sum_probs=9.9

Q ss_pred             eeeeeccCcccC
Q 033561          104 VIGVANFDPVKR  115 (116)
Q Consensus       104 li~VSq~D~V~R  115 (116)
                      .|.+|.||||+|
T Consensus       246 ~v~ls~fdp~rr  257 (514)
T TIGR03319       246 AVILSGFDPVRR  257 (514)
T ss_pred             eEEecCCchHHH
Confidence            566899999988


No 24 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=20.75  E-value=40  Score=26.76  Aligned_cols=22  Identities=36%  Similarity=0.347  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHHHHHHHhhheee
Q 033561           85 NFLLSIVAGGVVLAAIVGAVIG  106 (116)
Q Consensus        85 NFl~SLvaG~vVv~~i~~Ali~  106 (116)
                      -|=-.=+.||+||+.-..+++|
T Consensus       157 ~FD~~SFiGGIVL~LGv~aI~f  178 (186)
T PF05283_consen  157 TFDAASFIGGIVLTLGVLAIIF  178 (186)
T ss_pred             CCchhhhhhHHHHHHHHHHHHH
Confidence            4655667788888664444444


No 25 
>PF09835 DUF2062:  Uncharacterized protein conserved in bacteria (DUF2062);  InterPro: IPR018639  This domain, found in various prokaryotic proteins, has no known function. It is found at the C-terminal of family 2 glycosyltransferase proteins, in addition to proteins of unknown function.
Probab=20.32  E-value=98  Score=22.15  Aligned_cols=23  Identities=30%  Similarity=0.603  Sum_probs=18.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHhhhe
Q 033561           82 SLKNFLLSIVAGGVVLAAIVGAV  104 (116)
Q Consensus        82 SL~NFl~SLvaG~vVv~~i~~Al  104 (116)
                      .+.++++.++.|++|++++.+.+
T Consensus       112 ~~~~~~~~~~~G~~i~~~v~~~i  134 (154)
T PF09835_consen  112 SLWEFGLPFLLGSLILGIVLGII  134 (154)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            57778999999999987765543


No 26 
>PF05440 MtrB:  Tetrahydromethanopterin S-methyltransferase subunit B;  InterPro: IPR008690 The N5-methyltetrahydromethanopterin: coenzyme M (2.1.1.86 from EC) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump [].; GO: 0030269 tetrahydromethanopterin S-methyltransferase activity, 0015948 methanogenesis, 0016021 integral to membrane
Probab=20.13  E-value=1.3e+02  Score=22.01  Aligned_cols=23  Identities=13%  Similarity=0.345  Sum_probs=16.9

Q ss_pred             CChhHHHHHHHHHHHHHHHHHHh
Q 033561           79 LSPSLKNFLLSIVAGGVVLAAIV  101 (116)
Q Consensus        79 mTPSL~NFl~SLvaG~vVv~~i~  101 (116)
                      +.--++|++++++.|.++.+.++
T Consensus        72 ~AG~~tn~fyGf~igL~i~~lva   94 (97)
T PF05440_consen   72 IAGIFTNMFYGFIIGLVIAGLVA   94 (97)
T ss_pred             ehhhhhhHHHHHHHHHHHHHHHH
Confidence            44467899999999988865543


Done!