Query         033584
Match_columns 116
No_of_seqs    105 out of 1024
Neff          6.6 
Searched_HMMs 46136
Date          Fri Mar 29 03:57:58 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033584.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033584hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 CHL00160 rpl9 ribosomal protei 100.0 1.4E-36 3.1E-41  218.9  14.4  115    1-115    38-152 (153)
  2 TIGR00158 L9 ribosomal protein 100.0 2.8E-35 6.1E-40  211.2  14.8  113    1-115    33-147 (148)
  3 COG0359 RplI Ribosomal protein 100.0 3.6E-35 7.9E-40  210.0  13.8  113    1-115    33-146 (148)
  4 PRK00137 rplI 50S ribosomal pr 100.0   2E-33 4.3E-38  201.4  15.6  114    1-116    33-147 (147)
  5 PF03948 Ribosomal_L9_C:  Ribos 100.0 2.9E-31 6.2E-36  175.3  10.9   85   30-115     1-86  (87)
  6 PRK14538 putative bifunctional 100.0 3.7E-30 8.1E-35  223.5  14.8  114    1-115   720-834 (838)
  7 KOG4607 Mitochondrial ribosoma  98.7   3E-08 6.5E-13   74.8   6.4  114    1-116    81-195 (222)
  8 PF01281 Ribosomal_L9_N:  Ribos  92.8    0.11 2.3E-06   30.6   2.4   16    1-16     33-48  (48)
  9 PF10045 DUF2280:  Uncharacteri  84.1    0.58 1.2E-05   31.9   1.2   29   63-91     21-50  (104)
 10 PF00571 CBS:  CBS domain CBS d  78.2       3 6.4E-05   23.6   2.8   21   52-72     36-56  (57)
 11 PF08766 DEK_C:  DEK C terminal  74.9     1.4 3.1E-05   26.0   0.8   25   59-83     18-42  (54)
 12 PF07523 Big_3:  Bacterial Ig-l  73.3     9.3  0.0002   23.0   4.2   25   88-113    43-67  (67)
 13 PF07718 Coatamer_beta_C:  Coat  69.2       5 0.00011   28.7   2.6   19   45-63    118-136 (140)
 14 cd08505 PBP2_NikA_DppA_OppA_li  58.7      22 0.00047   29.8   5.0   56   41-104    63-126 (528)
 15 PF13592 HTH_33:  Winged helix-  54.2     8.1 0.00017   23.1   1.3   33   60-93      3-35  (60)
 16 smart00116 CBS Domain in cysta  53.8      13 0.00028   18.9   2.0   18   54-71     31-48  (49)
 17 COG1356 tfx Transcriptional re  48.3      75  0.0016   22.6   5.5   43    7-55     35-77  (143)
 18 PF01282 Ribosomal_S24e:  Ribos  47.8      18 0.00038   23.4   2.2   44   60-105    11-57  (84)
 19 cd03081 TRX_Fd_NuoE_FDH_gamma   46.9      19  0.0004   22.6   2.2   19   55-73     61-79  (80)
 20 PF14221 DUF4330:  Domain of un  44.6      20 0.00043   26.1   2.3   20   53-72      5-24  (168)
 21 cd04608 CBS_pair_PALP_assoc Th  40.6      17 0.00037   23.8   1.3   19   53-71    106-124 (124)
 22 cd02980 TRX_Fd_family Thioredo  38.5      32  0.0007   20.7   2.3   20   54-73     57-76  (77)
 23 cd04632 CBS_pair_19 The CBS do  37.4      36 0.00077   21.9   2.5   21   52-72     30-50  (128)
 24 cd08506 PBP2_clavulanate_OppA2  37.0      58  0.0012   26.3   4.1   45   45-104    65-112 (466)
 25 cd04623 CBS_pair_10 The CBS do  36.7      40 0.00087   20.8   2.6   21   54-74     32-52  (113)
 26 cd04592 CBS_pair_EriC_assoc_eu  36.5      40 0.00088   22.7   2.7   22   53-74     31-52  (133)
 27 cd04590 CBS_pair_CorC_HlyC_ass  36.0      42 0.00092   20.8   2.6   18   56-73     35-52  (111)
 28 cd03082 TRX_Fd_NuoE_W_FDH_beta  35.9      33 0.00073   21.2   2.0   18   55-72     53-70  (72)
 29 cd04629 CBS_pair_16 The CBS do  35.6      46 0.00099   20.7   2.7   22   53-74     31-52  (114)
 30 COG2524 Predicted transcriptio  35.4      33 0.00071   27.4   2.3   23   51-73    207-229 (294)
 31 cd04624 CBS_pair_11 The CBS do  34.8      45 0.00097   20.7   2.6   21   53-73     31-51  (112)
 32 cd04639 CBS_pair_26 The CBS do  34.6      48   0.001   20.5   2.7   20   54-73     32-51  (111)
 33 PF10826 DUF2551:  Protein of u  34.6      24 0.00053   23.1   1.3   23   60-84     24-46  (83)
 34 cd04630 CBS_pair_17 The CBS do  34.3      88  0.0019   19.5   4.0   19   56-74     35-53  (114)
 35 cd03064 TRX_Fd_NuoE TRX-like [  34.0      42 0.00091   20.7   2.3   19   55-73     61-79  (80)
 36 cd08490 PBP2_NikA_DppA_OppA_li  33.4   1E+02  0.0022   24.8   5.0   60   41-104    54-117 (470)
 37 cd04643 CBS_pair_30 The CBS do  33.3      48   0.001   20.6   2.5   20   54-73     32-51  (116)
 38 COG3620 Predicted transcriptio  32.9      37  0.0008   25.3   2.1   19   54-72    166-184 (187)
 39 cd04619 CBS_pair_6 The CBS dom  32.9      49  0.0011   20.9   2.6   21   53-73     31-51  (114)
 40 PRK07639 acyl carrier protein;  32.7      15 0.00033   23.6   0.1   34   60-93     39-72  (86)
 41 PF12167 DUF3596:  Domain of un  32.7      63  0.0014   19.6   2.9   23    3-25     26-48  (64)
 42 cd03063 TRX_Fd_FDH_beta TRX-li  32.5      58  0.0013   21.4   2.9   21   54-74     56-77  (92)
 43 cd04582 CBS_pair_ABC_OpuCA_ass  32.4      45 0.00097   20.5   2.3   19   53-71     31-49  (106)
 44 cd04607 CBS_pair_NTP_transfera  32.4      44 0.00094   20.9   2.3   20   53-72     32-51  (113)
 45 cd04606 CBS_pair_Mg_transporte  32.4      68  0.0015   19.9   3.2   19   53-71     91-109 (109)
 46 COG5556 Uncharacterized conser  32.4      22 0.00047   24.1   0.8   25   63-87     21-45  (110)
 47 PHA02119 hypothetical protein   31.9      32 0.00069   22.1   1.4   34   45-83     41-74  (87)
 48 cd04801 CBS_pair_M50_like This  31.4      48   0.001   20.7   2.3   19   54-72     33-51  (114)
 49 PF13565 HTH_32:  Homeodomain-l  31.3      35 0.00076   20.6   1.6   19   61-79     48-66  (77)
 50 COG1438 ArgR Arginine represso  31.0      31 0.00067   24.9   1.5   34   63-98     22-55  (150)
 51 COG3620 Predicted transcriptio  30.4      47   0.001   24.7   2.3   23   52-74    101-123 (187)
 52 cd08502 PBP2_NikA_DppA_OppA_li  30.3 1.2E+02  0.0025   24.7   4.9   57   45-104    59-120 (472)
 53 cd04593 CBS_pair_EriC_assoc_ba  29.8      55  0.0012   20.5   2.4   20   54-73     32-51  (115)
 54 cd04587 CBS_pair_CAP-ED_DUF294  29.4      28  0.0006   21.7   0.9   17   53-69     96-112 (113)
 55 cd04604 CBS_pair_KpsF_GutQ_ass  29.3      61  0.0013   20.0   2.5   20   54-73     33-52  (114)
 56 COG0757 AroQ 3-dehydroquinate   29.3      49  0.0011   23.8   2.2   27   57-83     20-49  (146)
 57 cd04620 CBS_pair_7 The CBS dom  29.0      63  0.0014   20.1   2.6   19   55-73     33-51  (115)
 58 PF01257 2Fe-2S_thioredx:  Thio  28.8      37 0.00081   23.8   1.6   19   55-73    125-143 (145)
 59 PRK15109 antimicrobial peptide  28.7   1E+02  0.0022   25.9   4.4   59   45-103    95-174 (547)
 60 cd04605 CBS_pair_MET2_assoc Th  28.5      68  0.0015   19.7   2.7   20   54-73     33-52  (110)
 61 cd03083 TRX_Fd_NuoE_hoxF TRX-l  28.4      56  0.0012   20.4   2.2   18   55-72     61-78  (80)
 62 cd04597 CBS_pair_DRTGG_assoc2   28.4      43 0.00093   21.6   1.7   18   52-69     95-112 (113)
 63 cd04583 CBS_pair_ABC_OpuCA_ass  28.2      61  0.0013   19.8   2.4   18   54-71     33-50  (109)
 64 COG2047 Uncharacterized protei  27.9      57  0.0012   25.5   2.5   26   54-80    133-158 (258)
 65 cd08496 PBP2_NikA_DppA_OppA_li  27.8 1.4E+02  0.0029   24.1   4.8   57   45-104    59-120 (454)
 66 PF14420 Clr5:  Clr5 domain      27.4      45 0.00098   19.5   1.5   23   62-84     21-43  (54)
 67 cd04641 CBS_pair_28 The CBS do  27.4      68  0.0015   20.3   2.6   21   53-73     31-51  (120)
 68 PF05157 T2SE_Nter:  Type II se  27.0      41 0.00088   21.2   1.4   26   60-85      5-31  (109)
 69 PF11221 Med21:  Subunit 21 of   26.9   2E+02  0.0044   20.0   5.1   33   11-43    105-137 (144)
 70 cd04614 CBS_pair_1 The CBS dom  26.7      53  0.0011   20.4   1.9   19   53-71     31-49  (96)
 71 PF13954 PapC_N:  PapC N-termin  26.6 1.6E+02  0.0035   20.3   4.5   25   91-115    28-52  (146)
 72 cd04601 CBS_pair_IMPDH This cd  26.6      85  0.0018   19.2   2.8   18   52-69     92-109 (110)
 73 COG2239 MgtE Mg/Co/Ni transpor  26.5      99  0.0022   26.1   3.9   41   33-74    215-255 (451)
 74 PF05198 IF3_N:  Translation in  26.5      95  0.0021   19.6   3.0   27   52-79     18-44  (76)
 75 cd04625 CBS_pair_12 The CBS do  26.5      66  0.0014   19.9   2.3   20   54-73     31-50  (112)
 76 PF13833 EF-hand_8:  EF-hand do  26.4      41 0.00088   18.8   1.2   24   60-84      3-27  (54)
 77 COG0112 GlyA Glycine/serine hy  26.2 2.8E+02  0.0061   23.4   6.3   62   25-89    285-352 (413)
 78 cd04585 CBS_pair_ACT_assoc2 Th  26.1      54  0.0012   20.4   1.9   16   54-69    106-121 (122)
 79 cd04618 CBS_pair_5 The CBS dom  25.9 1.7E+02  0.0036   18.2   4.2   17   55-71     34-50  (98)
 80 smart00089 PKD Repeats in poly  25.9 1.3E+02  0.0028   17.9   3.5   25   89-113    51-78  (79)
 81 cd04603 CBS_pair_KefB_assoc Th  25.9   1E+02  0.0023   19.2   3.2   17   53-69     94-110 (111)
 82 cd04636 CBS_pair_23 The CBS do  25.8      72  0.0016   20.7   2.5   21   53-73     31-51  (132)
 83 PF03484 B5:  tRNA synthetase B  25.8      72  0.0016   19.4   2.3   21   61-82     18-38  (70)
 84 cd08518 PBP2_NikA_DppA_OppA_li  25.7 1.1E+02  0.0025   24.7   4.1   57   45-104    58-118 (464)
 85 cd04803 CBS_pair_15 The CBS do  25.5      72  0.0016   20.1   2.4   20   54-73     32-51  (122)
 86 cd05886 Ig1_Nectin-1_like Firs  25.2 1.8E+02   0.004   18.8   4.3   31   83-113    64-98  (99)
 87 PF11548 Receptor_IA-2:  Protei  25.0 1.2E+02  0.0027   20.0   3.4   24   45-73     46-69  (91)
 88 cd04631 CBS_pair_18 The CBS do  24.9      74  0.0016   20.1   2.4   19   55-73     34-52  (125)
 89 cd04627 CBS_pair_14 The CBS do  24.5      85  0.0018   19.9   2.6   18   56-73     35-52  (123)
 90 cd04609 CBS_pair_PALP_assoc2 T  24.5      77  0.0017   19.3   2.3   18   56-73     33-50  (110)
 91 cd08503 PBP2_NikA_DppA_OppA_li  24.5 1.6E+02  0.0034   23.8   4.7   56   45-103    66-128 (460)
 92 cd04600 CBS_pair_HPP_assoc Thi  23.7      75  0.0016   20.0   2.2   20   54-73     33-52  (124)
 93 cd04640 CBS_pair_27 The CBS do  23.6 1.4E+02  0.0031   19.1   3.6   34   34-69     90-125 (126)
 94 PRK05087 D-alanine--poly(phosp  23.5      29 0.00064   21.9   0.2   35   59-93     34-68  (78)
 95 KOG1058 Vesicle coat complex C  23.3      73  0.0016   29.2   2.6   38   45-90    783-820 (948)
 96 cd04615 CBS_pair_2 The CBS dom  23.3      86  0.0019   19.4   2.4   19   54-72     32-50  (113)
 97 cd04617 CBS_pair_4 The CBS dom  23.3      84  0.0018   19.9   2.4   20   54-73     32-51  (118)
 98 cd08497 PBP2_NikA_DppA_OppA_li  23.2 1.7E+02  0.0036   24.0   4.6   56   45-103    77-138 (491)
 99 PF00496 SBP_bac_5:  Bacterial   22.9 1.1E+02  0.0025   23.4   3.5   57   45-104    19-83  (374)
100 KOG1494 NAD-dependent malate d  22.9      46 0.00099   27.0   1.2   16   54-70    166-181 (345)
101 smart00874 B5 tRNA synthetase   22.7      58  0.0012   19.5   1.4   24   57-81     13-37  (71)
102 PTZ00373 60S Acidic ribosomal   22.6      48   0.001   22.8   1.1   25   61-86     19-43  (112)
103 PRK05988 formate dehydrogenase  22.6      81  0.0018   22.6   2.4   19   55-73    135-153 (156)
104 PRK07081 acyl carrier protein;  22.4      25 0.00054   22.3  -0.3   34   59-92     33-66  (83)
105 cd04642 CBS_pair_29 The CBS do  22.4      81  0.0018   20.2   2.2   20   53-72     31-50  (126)
106 PF13344 Hydrolase_6:  Haloacid  22.3      68  0.0015   20.8   1.8   27   60-87     40-66  (101)
107 PRK00441 argR arginine repress  22.1      45 0.00098   23.7   1.0   36   60-97     17-52  (149)
108 PF04282 DUF438:  Family of unk  21.9      36 0.00079   21.5   0.4   23   57-80     24-49  (71)
109 PF10668 Phage_terminase:  Phag  21.9      58  0.0013   19.9   1.3   12   60-71     21-32  (60)
110 cd04621 CBS_pair_8 The CBS dom  21.9      90  0.0019   20.7   2.4   21   53-73     31-51  (135)
111 KOG2639 Sodium sulfate symport  21.8      90   0.002   27.6   2.8   33   50-83    623-655 (685)
112 PF01316 Arg_repressor:  Argini  21.8      39 0.00084   21.1   0.5   34   63-98     21-54  (70)
113 cd02205 CBS_pair The CBS domai  21.8 1.9E+02  0.0041   17.1   4.6   21   54-74     32-52  (113)
114 cd08512 PBP2_NikA_DppA_OppA_li  21.7 1.8E+02   0.004   23.4   4.5   57   45-104    64-130 (476)
115 cd04610 CBS_pair_ParBc_assoc T  21.6      57  0.0012   20.0   1.3   18   52-69     89-106 (107)
116 PRK05395 3-dehydroquinate dehy  21.6      82  0.0018   22.7   2.2   27   57-83     21-50  (146)
117 PF04552 Sigma54_DBD:  Sigma-54  21.6      39 0.00085   24.4   0.5   22   62-84    122-143 (160)
118 PF01835 A2M_N:  MG2 domain;  I  21.5 2.2E+02  0.0048   17.8   4.6   31   83-113    67-99  (99)
119 cd08489 PBP2_NikA The substrat  21.3 2.1E+02  0.0045   23.2   4.8   58   45-105    57-121 (488)
120 cd05833 Ribosomal_P2 Ribosomal  21.2      54  0.0012   22.3   1.1   25   61-86     17-41  (109)
121 PRK07539 NADH dehydrogenase su  21.1      90  0.0019   22.1   2.3   19   55-73    134-152 (154)
122 TIGR02294 nickel_nikA nickel A  20.9 2.2E+02  0.0047   23.4   4.9   57   45-104    64-127 (500)
123 cd08492 PBP2_NikA_DppA_OppA_li  20.8 2.6E+02  0.0057   22.5   5.3   57   45-104    61-125 (484)
124 cd04613 CBS_pair_SpoIVFB_EriC_  20.8 1.1E+02  0.0023   18.7   2.5   19   54-72     32-50  (114)
125 cd04595 CBS_pair_DHH_polyA_Pol  20.5   1E+02  0.0022   19.0   2.3   17   56-72     34-50  (110)
126 cd04588 CBS_pair_CAP-ED_DUF294  20.5 1.5E+02  0.0033   18.0   3.2   16   54-69     94-109 (110)
127 TIGR01088 aroQ 3-dehydroquinat  20.3      79  0.0017   22.6   1.9   27   57-83     19-48  (141)
128 cd00466 DHQase_II Dehydroquina  20.3      80  0.0017   22.6   1.9   27   57-83     19-48  (140)

No 1  
>CHL00160 rpl9 ribosomal protein L9; Provisional
Probab=100.00  E-value=1.4e-36  Score=218.89  Aligned_cols=115  Identities=34%  Similarity=0.546  Sum_probs=111.0

Q ss_pred             CCceeecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCeEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCcee
Q 033584            1 MGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVD   80 (116)
Q Consensus         1 ~glA~~aT~~n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~id   80 (116)
                      ||+|++||++|+++++.+++.+++++++.+++|++++++|+++++++|++++|++|+||||||++||+++|++++|++||
T Consensus        38 ~glA~~AT~~n~~~~e~~~~~~~~~~~~~~~~a~~la~~l~~~~~~~i~~k~ge~gklfGSVt~~dIa~~l~~~~g~~id  117 (153)
T CHL00160         38 NKMAKVATQGSLKQQKMYQKILDLKLKEAKEKCLKVKQLLEEIQKFSVKKKVGENNQIFGSVTEKEISQIIKNKTNIDLE  117 (153)
T ss_pred             cCchhhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCceEEEEEEeCCCCeEEcccCHHHHHHHHHHhhCCccc
Confidence            69999999999999999999999999999999999999999964599999999999999999999999999988899999


Q ss_pred             cccccccCccceeeEEEEEEecCCeEEEEEEEEee
Q 033584           81 KKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFA  115 (116)
Q Consensus        81 kk~I~l~~Ik~lG~y~V~i~L~~~V~a~i~v~V~~  115 (116)
                      |++|.||+||++|+|+|+|+||++|+|+++|+|++
T Consensus       118 k~~I~l~~Ik~~G~~~v~v~L~~~V~a~i~v~V~~  152 (153)
T CHL00160        118 KQNIELPEIKTIGIYNIEIKLTSDVKANINLQILP  152 (153)
T ss_pred             cceeehhhccccEeEEEEEEecCCcEEEEEEEEEE
Confidence            99999988999999999999999999999999987


No 2  
>TIGR00158 L9 ribosomal protein L9. Ribosomal protein L9 appears to be universal in, but restricted to, eubacteria and chloroplast.
Probab=100.00  E-value=2.8e-35  Score=211.16  Aligned_cols=113  Identities=31%  Similarity=0.448  Sum_probs=109.2

Q ss_pred             CCceeecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCeEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCcee
Q 033584            1 MGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVD   80 (116)
Q Consensus         1 ~glA~~aT~~n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~id   80 (116)
                      ||+|++||++|+++++.+++.+++++++.+++|++++++|++. +++|++++|++|+||||||++||+++|.++ |++||
T Consensus        33 ~g~A~~aT~~nl~~~e~~~~~~~~~~~~~~~~a~~l~~~l~~~-~~~i~~k~ge~gklfGSVt~~~I~~~l~~~-g~~id  110 (148)
T TIGR00158        33 KGLAVPATKKNIEFFEARRKKLEEKLAANKAAAARLKEVLELG-TLTISKKVGDEGKLFGSITTKQIADALKAA-GLDLD  110 (148)
T ss_pred             cCchhhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCc-EEEEEEEeCCCCeEEEeECHHHHHHHHHHc-CCccc
Confidence            6999999999999999999999999999999999999999997 799999999999999999999999999888 99999


Q ss_pred             ccccccc-C-ccceeeEEEEEEecCCeEEEEEEEEee
Q 033584           81 KKIVDLP-E-IRETGEYIAQLKLHPEVTARIRLNVFA  115 (116)
Q Consensus        81 kk~I~l~-~-Ik~lG~y~V~i~L~~~V~a~i~v~V~~  115 (116)
                      |++|.|| + ||++|+|+|+|+||++|+|+|+|+|++
T Consensus       111 k~~I~l~~~~Ik~~G~y~v~i~L~~~V~a~i~v~V~~  147 (148)
T TIGR00158       111 KKKIELPDGVIRTTGEHEVTIKLHEEVFAVLKVIVVP  147 (148)
T ss_pred             HhhEECCCCceeceEEEEEEEEEcCCcEEEEEEEEEE
Confidence            9999997 4 999999999999999999999999986


No 3  
>COG0359 RplI Ribosomal protein L9 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=3.6e-35  Score=210.04  Aligned_cols=113  Identities=33%  Similarity=0.463  Sum_probs=109.8

Q ss_pred             CCceeecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCeEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCcee
Q 033584            1 MGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVD   80 (116)
Q Consensus         1 ~glA~~aT~~n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~id   80 (116)
                      ||+|++||+.|++.++.++++++++..+.+++|++++++|++. +++|.+++|++|+||||||++||+++|.++ |++||
T Consensus        33 kglAv~At~~n~~~~e~~r~~~e~~~~~~~~~a~~lk~~Le~~-~~~i~~kag~~GklfGSVt~~dIa~~l~~~-g~~id  110 (148)
T COG0359          33 KGLAVPATKGNLKLLEARRAKLEKKAAEELAEAEALKEKLEGK-TVEIAVKAGEDGKLFGSVTSKDIAEALKAA-GFKLD  110 (148)
T ss_pred             ccchhhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCc-eEEEEEEcCCCCceeccccHHHHHHHHHHc-CCCcc
Confidence            6999999999999999999999999999999999999999994 899999999999999999999999999999 99999


Q ss_pred             cccccccC-ccceeeEEEEEEecCCeEEEEEEEEee
Q 033584           81 KKIVDLPE-IRETGEYIAQLKLHPEVTARIRLNVFA  115 (116)
Q Consensus        81 kk~I~l~~-Ik~lG~y~V~i~L~~~V~a~i~v~V~~  115 (116)
                      |++|.+|+ ||++|.|+|+|+||++|+++++|.|++
T Consensus       111 k~~i~l~~~ik~~G~~~V~vkLh~eV~a~v~v~V~~  146 (148)
T COG0359         111 KRKIRLPNGIKTLGEHEVEVKLHEEVTATVKVNVVA  146 (148)
T ss_pred             hheeEcCchhhhcceeEEEEEecCceEEEEEEEEEe
Confidence            99999997 999999999999999999999999986


No 4  
>PRK00137 rplI 50S ribosomal protein L9; Reviewed
Probab=100.00  E-value=2e-33  Score=201.37  Aligned_cols=114  Identities=39%  Similarity=0.589  Sum_probs=109.8

Q ss_pred             CCceeecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCeEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCcee
Q 033584            1 MGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVD   80 (116)
Q Consensus         1 ~glA~~aT~~n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~id   80 (116)
                      +|+|++||++|+++++.+++..++++++.+++|+++++.|++. +++|.+++|++|+||||||++||+++|.++ |++||
T Consensus        33 ~~lA~~aT~~~~~~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~-~l~i~~k~g~~gklfGsVt~~~I~~~l~~~-g~~id  110 (147)
T PRK00137         33 QGKAVRATKGNLKQLEARRAELEAKAAEELAEAEALAEKLEGL-TVTIKAKAGEDGKLFGSVTTKDIAEALKKQ-GIEID  110 (147)
T ss_pred             CCceeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCC-EEEEEEEcCCCCeEEeeeCHHHHHHHHHHc-CCccC
Confidence            6999999999999999999999999999999999999999986 799999999999999999999999999998 99999


Q ss_pred             ccccccc-CccceeeEEEEEEecCCeEEEEEEEEeeC
Q 033584           81 KKIVDLP-EIRETGEYIAQLKLHPEVTARIRLNVFAN  116 (116)
Q Consensus        81 kk~I~l~-~Ik~lG~y~V~i~L~~~V~a~i~v~V~~~  116 (116)
                      |+.|.|| +||++|+|+|+|+||++|+|+++|+|++.
T Consensus       111 k~~I~l~~~Ik~~G~y~v~i~L~~~v~a~l~v~V~~~  147 (147)
T PRK00137        111 KRKIELPGPIKTLGEYEVPVKLHPEVTATIKVNVVAE  147 (147)
T ss_pred             HHHeECCCcccccEEEEEEEEECCCcEEEEEEEEEEC
Confidence            9999998 59999999999999999999999999863


No 5  
>PF03948 Ribosomal_L9_C:  Ribosomal protein L9, C-terminal domain;  InterPro: IPR020069 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L9 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L9 is known to bind directly to the 23S rRNA. It belongs to a family of ribosomal proteins grouped on the basis of sequence similarities [, ].  The crystal structure of Bacillus stearothermophilus L9 shows the 149-residue protein comprises two globular domains connected by a rigid linker []. Each domain contains an rRNA binding site, and the protein functions as a structural protein in the large subunit of the ribosome. The C-terminal domain consists of two loops, an alpha-helix and a three-stranded mixed parallel, anti-parallel beta-sheet packed against the central alpha-helix. The long central alpha-helix is exposed to solvent in the middle and participates in the hydrophobic cores of the two domains at both ends. ; PDB: 3D5B_I 3PYV_H 3F1H_I 3PYR_H 3MRZ_H 1VSP_G 3MS1_H 1VSA_G 3PYT_H 2WH4_I ....
Probab=99.97  E-value=2.9e-31  Score=175.33  Aligned_cols=85  Identities=47%  Similarity=0.777  Sum_probs=81.9

Q ss_pred             HHHHHHHHHHhhccCeEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCceecccccccC-ccceeeEEEEEEecCCeEEE
Q 033584           30 KEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPE-IRETGEYIAQLKLHPEVTAR  108 (116)
Q Consensus        30 ~~~a~~l~~~l~~~~~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~idkk~I~l~~-Ik~lG~y~V~i~L~~~V~a~  108 (116)
                      +++|++++++|++. +++|.+++|++|+||||||++||+++|++++|++|||++|.|+. ||++|+|+|+|+||++|+|+
T Consensus         1 k~~A~~l~~~l~~~-~l~i~~k~g~~gklfGSVt~~dIa~~l~~~~g~~Idk~~I~l~~~IK~~G~~~v~v~L~~~V~a~   79 (87)
T PF03948_consen    1 KAEAQALAEKLEGI-TLTIKRKAGENGKLFGSVTSKDIAKALKEQTGIEIDKKKIELPEPIKSLGEYEVKVKLHPEVSAK   79 (87)
T ss_dssp             HHHHHHHHHHHCSS-EEEEEECBSSCSSBSSEBSHHHHHHHHHHCCSSSSSSSSBCSSSTBESSEEEEEEEEEETTEEEE
T ss_pred             CHHHHHHHHHhcCC-EEEEEEEecCCcceecCcCHHHHHHHHHHhhCCeEeccEEECCCchhccEEEEEEEEeCCCeEEE
Confidence            47899999999997 79999999999999999999999999999999999999999996 99999999999999999999


Q ss_pred             EEEEEee
Q 033584          109 IRLNVFA  115 (116)
Q Consensus       109 i~v~V~~  115 (116)
                      |+|+|.+
T Consensus        80 i~v~V~~   86 (87)
T PF03948_consen   80 IKVNVVA   86 (87)
T ss_dssp             EEEEEEE
T ss_pred             EEEEEEe
Confidence            9999985


No 6  
>PRK14538 putative bifunctional signaling protein/50S ribosomal protein L9; Provisional
Probab=99.97  E-value=3.7e-30  Score=223.48  Aligned_cols=114  Identities=20%  Similarity=0.259  Sum_probs=110.3

Q ss_pred             CCceeecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCeEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCcee
Q 033584            1 MGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVD   80 (116)
Q Consensus         1 ~glA~~aT~~n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~id   80 (116)
                      ||+|++||++|+++++.+++++++++++.+++|++++++|+++ +++|++++|++|+||||||++||+++|++++|++||
T Consensus       720 ~~~A~~aT~~nlk~~e~~~~~~~~~~~~~~~~a~~l~~~l~~~-~~~i~~k~ge~gklfGSVt~~~I~~~l~~~~g~~id  798 (838)
T PRK14538        720 NKKALLADKENLAKIKKKKILEQEKKRNHELLMKKLKSEIDNK-KITLDIQLGPKGKIYGKITLKQIVEEFHKIHNITID  798 (838)
T ss_pred             CCchhhcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCc-EEEEEEEeCCCCeeeeccCHHHHHHHHHHhhCCccc
Confidence            7999999999999999999999999999999999999999997 799999999999999999999999999998899999


Q ss_pred             ccccccc-CccceeeEEEEEEecCCeEEEEEEEEee
Q 033584           81 KKIVDLP-EIRETGEYIAQLKLHPEVTARIRLNVFA  115 (116)
Q Consensus        81 kk~I~l~-~Ik~lG~y~V~i~L~~~V~a~i~v~V~~  115 (116)
                      |++|.|+ |||++|+|+|+|+||++|+|+++|+|+.
T Consensus       799 k~~I~l~~~Ik~~G~~~v~i~L~~~V~a~i~v~V~~  834 (838)
T PRK14538        799 RKKISLENEIISVGIYPVDVFLTDQIKATFFLNVIE  834 (838)
T ss_pred             cceeeCCCcccccEEEEEEEEEcCCeEEEEEEEEEE
Confidence            9999998 4999999999999999999999999974


No 7  
>KOG4607 consensus Mitochondrial ribosomal protein L9 [Translation, ribosomal structure and biogenesis]
Probab=98.73  E-value=3e-08  Score=74.77  Aligned_cols=114  Identities=39%  Similarity=0.489  Sum_probs=96.1

Q ss_pred             CCceeecCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCeEEEEEecCCCCe-eEeeeCHHHHHHHHHHhcCCce
Q 033584            1 MGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQ-IFGSVTAQDVVDIIKAQLQRDV   79 (116)
Q Consensus         1 ~glA~~aT~~n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~Gk-lfGSVt~~dIa~~L~~~~g~~i   79 (116)
                      +|+|+++||.|.+.+..+.++......+..++++-++ -|+.. .+.+.+.-+..+. -+++|+++..-....++.-+++
T Consensus        81 ~glAvy~tp~~~~~~k~~~~e~~~~k~~vk~e~k~V~-~lqt~-v~~~~~~k~~kw~l~~~~V~~~l~~gv~~~~~t~~l  158 (222)
T KOG4607|consen   81 KGLAVYNTPLNLKKYKLREQEEEAEKIRVKEEAKVVA-VLQTV-VLFKVMNKGGKWKLNPNLVKASLRKGVIVAELTIKL  158 (222)
T ss_pred             ccccccCChhhHHHHHHHHHHHHhhhhccHHHHHHHH-HHHhh-hhhheeccCCceeecHHHHHHHHhcceEeccccccC
Confidence            5899999999999988888888888888888888888 77765 3555555555554 4799999998888877778899


Q ss_pred             ecccccccCccceeeEEEEEEecCCeEEEEEEEEeeC
Q 033584           80 DKKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFAN  116 (116)
Q Consensus        80 dkk~I~l~~Ik~lG~y~V~i~L~~~V~a~i~v~V~~~  116 (116)
                      |++-|..|.++.-|+|.+.|++++++++.+...|+.+
T Consensus       159 ~k~~vs~P~~k~e~~~~~~V~in~~~~vr~~~~v~~~  195 (222)
T KOG4607|consen  159 DKELVSGPITKEEGEYICEVKINPDVTVRVKIRVTHN  195 (222)
T ss_pred             cccccCCCcccccceEEEEEEECCcceEEeeeeeecc
Confidence            9999999989999999999999999999999988753


No 8  
>PF01281 Ribosomal_L9_N:  Ribosomal protein L9, N-terminal domain;  InterPro: IPR020070 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L9 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L9 is known to bind directly to the 23S rRNA. It belongs to a family of ribosomal proteins grouped on the basis of sequence similarities [, ].  The crystal structure of Bacillus stearothermophilus L9 shows the 149-residue protein comprises two globular domains connected by a rigid linker []. Each domain contains an rRNA binding site, and the protein functions as a structural protein in the large subunit of the ribosome. The C-terminal domain consists of two loops, an alpha-helix and a three-stranded mixed parallel, anti-parallel beta-sheet packed against the central alpha-helix. The long central alpha-helix is exposed to solvent in the middle and participates in the hydrophobic cores of the two domains at both ends. ; PDB: 3D5B_I 3PYV_H 3F1H_I 3PYR_H 3MRZ_H 1VSP_G 3MS1_H 1VSA_G 3PYT_H 2WH4_I ....
Probab=92.82  E-value=0.11  Score=30.63  Aligned_cols=16  Identities=38%  Similarity=0.439  Sum_probs=14.6

Q ss_pred             CCceeecCHHHHHHHH
Q 033584            1 MGKAQIVTPLLLKEMK   16 (116)
Q Consensus         1 ~glA~~aT~~n~k~~~   16 (116)
                      +|+|++||++|+++++
T Consensus        33 ~~~A~~at~~~~~~~e   48 (48)
T PF01281_consen   33 QGLAVYATPENLKQLE   48 (48)
T ss_dssp             TTSEEECSHHHHHHHH
T ss_pred             CCceeeCCHHHHHhcC
Confidence            6899999999999885


No 9  
>PF10045 DUF2280:  Uncharacterized conserved protein (DUF2280);  InterPro: IPR018738 This entry is represented by Burkholderia phage Bups phi1, Orf2.36. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=84.11  E-value=0.58  Score=31.89  Aligned_cols=29  Identities=21%  Similarity=0.363  Sum_probs=24.5

Q ss_pred             CHHHHHHHHHHhcCCceeccccccc-Cccc
Q 033584           63 TAQDVVDIIKAQLQRDVDKKIVDLP-EIRE   91 (116)
Q Consensus        63 t~~dIa~~L~~~~g~~idkk~I~l~-~Ik~   91 (116)
                      |++++++++++.||++|+|.+++.- |=|.
T Consensus        21 TPs~v~~aVk~eFgi~vsrQqve~yDPTK~   50 (104)
T PF10045_consen   21 TPSEVAEAVKEEFGIDVSRQQVESYDPTKR   50 (104)
T ss_pred             CHHHHHHHHHHHhCCccCHHHHHHcCchHH
Confidence            8999999999999999999998753 3443


No 10 
>PF00571 CBS:  CBS domain CBS domain web page. Mutations in the CBS domain of Swiss:P35520 lead to homocystinuria.;  InterPro: IPR000644 CBS (cystathionine-beta-synthase) domains are small intracellular modules, mostly found in two or four copies within a protein, that occur in a variety of proteins in bacteria, archaea, and eukaryotes [, ]. Tandem pairs of CBS domains can act as binding domains for adenosine derivatives and may regulate the activity of attached enzymatic or other domains []. In some cases, CBS domains may act as sensors of cellular energy status by being activated by AMP and inhibited by ATP []. In chloride ion channels, the CBS domains have been implicated in intracellular targeting and trafficking, as well as in protein-protein interactions, but results vary with different channels: in the CLC-5 channel, the CBS domain was shown to be required for trafficking [], while in the CLC-1 channel, the CBS domain was shown to be critical for channel function, but not necessary for trafficking []. Recent experiments revealing that CBS domains can bind adenosine-containing ligands such ATP, AMP, or S-adenosylmethionine have led to the hypothesis that CBS domains function as sensors of intracellular metabolites [, ]. Crystallographic studies of CBS domains have shown that pairs of CBS sequences form a globular domain where each CBS unit adopts a beta-alpha-beta-beta-alpha pattern []. Crystal structure of the CBS domains of the AMP-activated protein kinase in complexes with AMP and ATP shows that the phosphate groups of AMP/ATP lie in a surface pocket at the interface of two CBS domains, which is lined with basic residues, many of which are associated with disease-causing mutations [].  In humans, mutations in conserved residues within CBS domains cause a variety of human hereditary diseases, including (with the gene mutated in parentheses): homocystinuria (cystathionine beta-synthase); Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase); retinitis pigmentosa (IMP dehydrogenase-1); congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members).; GO: 0005515 protein binding; PDB: 3JTF_A 3TE5_C 3TDH_C 3T4N_C 2QLV_C 3OI8_A 3LV9_A 2QH1_B 1PVM_B 3LQN_A ....
Probab=78.25  E-value=3  Score=23.65  Aligned_cols=21  Identities=10%  Similarity=0.305  Sum_probs=18.2

Q ss_pred             cCCCCeeEeeeCHHHHHHHHH
Q 033584           52 GGKGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        52 ~g~~GklfGSVt~~dIa~~L~   72 (116)
                      .+++|++-|.||..||..++.
T Consensus        36 ~d~~~~~~G~is~~dl~~~l~   56 (57)
T PF00571_consen   36 VDEDGKLVGIISRSDLLKALL   56 (57)
T ss_dssp             ESTTSBEEEEEEHHHHHHHHH
T ss_pred             EecCCEEEEEEEHHHHHhhhh
Confidence            456799999999999999875


No 11 
>PF08766 DEK_C:  DEK C terminal domain;  InterPro: IPR014876 DEK is a chromatin associated protein that is linked with cancers and autoimmune disease. This domain is found at the C-terminal of DEK and is of clinical importance since it can reverse the characteristic abnormal DNA-mutagen sensitivity in fibroblasts from ataxia-telangiectasia (A-T) patients []. The structure of this domain shows it to be homologous to the E2F/DP transcription factor family []. This domain is also found in chitin synthase proteins like Q8TF96 from SWISSPROT, and in protein phosphatases such as Q6NN85 from SWISSPROT. ; PDB: 1Q1V_A.
Probab=74.93  E-value=1.4  Score=25.97  Aligned_cols=25  Identities=16%  Similarity=0.347  Sum_probs=17.2

Q ss_pred             EeeeCHHHHHHHHHHhcCCceeccc
Q 033584           59 FGSVTAQDVVDIIKAQLQRDVDKKI   83 (116)
Q Consensus        59 fGSVt~~dIa~~L~~~~g~~idkk~   83 (116)
                      +.+||.++|-..|.+.+|+++.-++
T Consensus        18 l~~vT~k~vr~~Le~~~~~dL~~~K   42 (54)
T PF08766_consen   18 LDTVTKKQVREQLEERFGVDLSSRK   42 (54)
T ss_dssp             GGG--HHHHHHHHHHH-SS--SHHH
T ss_pred             HhHhhHHHHHHHHHHHHCCCcHHHH
Confidence            5679999999999999999987554


No 12 
>PF07523 Big_3:  Bacterial Ig-like domain (group 3);  InterPro: IPR011080 This entry represents bacterial domains with an Ig-like fold. These domains are found in a variety of bacterial surface proteins.; PDB: 2L7Y_A 2KPN_A.
Probab=73.32  E-value=9.3  Score=23.05  Aligned_cols=25  Identities=24%  Similarity=0.417  Sum_probs=20.3

Q ss_pred             CccceeeEEEEEEecCCeEEEEEEEE
Q 033584           88 EIRETGEYIAQLKLHPEVTARIRLNV  113 (116)
Q Consensus        88 ~Ik~lG~y~V~i~L~~~V~a~i~v~V  113 (116)
                      +-...|.|.|.+.... .+++++|.|
T Consensus        43 d~~~~G~y~Vt~~y~~-~t~t~~VtV   67 (67)
T PF07523_consen   43 DTSKAGTYTVTYTYKG-VTATFTVTV   67 (67)
T ss_dssp             -TTS-CCEEEEEEECT-EEEEEEEEE
T ss_pred             ecCCCceEEEEEEECC-EEEEEEEEC
Confidence            3678899999999887 888988876


No 13 
>PF07718 Coatamer_beta_C:  Coatomer beta C-terminal region;  InterPro: IPR011710 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C-terminal domain of the beta subunit from coatomer proteins (Beta-coat proteins). The C-terminal domain probably adapts the function of the N-terminal IPR002553 from INTERPRO domain. Coatomer protein complex I (COPI)-coated vesicles are involved in transport between the endoplasmic reticulum and the Golgi but also participate in transport from early to late endosomes within the endocytic pathway [].  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat
Probab=69.18  E-value=5  Score=28.70  Aligned_cols=19  Identities=21%  Similarity=0.356  Sum_probs=16.8

Q ss_pred             eEEEEEecCCCCeeEeeeC
Q 033584           45 AFKVKRKGGKGKQIFGSVT   63 (116)
Q Consensus        45 ~l~i~~k~g~~GklfGSVt   63 (116)
                      ..+|+..+.++|-+||.|+
T Consensus       118 ~~~iKVsStetGvIfG~I~  136 (140)
T PF07718_consen  118 KATIKVSSTETGVIFGNIV  136 (140)
T ss_pred             EEEEEEEeccCCEEEEEEE
Confidence            5788888999999999986


No 14 
>cd08505 PBP2_NikA_DppA_OppA_like_18 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=58.68  E-value=22  Score=29.82  Aligned_cols=56  Identities=23%  Similarity=0.351  Sum_probs=42.5

Q ss_pred             hccCeEEEEEecCC---CCeeE-----eeeCHHHHHHHHHHhcCCceecccccccCccceeeEEEEEEecCC
Q 033584           41 ETVGAFKVKRKGGK---GKQIF-----GSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        41 ~~~~~l~i~~k~g~---~Gklf-----GSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      ++. +++|..+-|-   ||..|     ..||+.|++-.+..-.    +.   .+..|+.++.|+|.|+|..-
T Consensus        63 D~~-t~tf~LR~~v~fsDG~~~~~~~G~p~TA~Dv~~s~~~~~----~~---~i~~v~~~d~~tv~~~l~~p  126 (528)
T cd08505          63 DGS-VYTIRIKPGIYFQPDPAFPKGKTRELTAEDYVYSIKRLA----DP---PLEGVEAVDRYTLRIRLTGP  126 (528)
T ss_pred             Cce-EEEEEEcCCCEeeCCcccccCCCcccchHHhhhhHhhhh----cC---cccceEeccCcEEEEEecCC
Confidence            344 7999999876   77777     5689999999986542    22   23458999999999999764


No 15 
>PF13592 HTH_33:  Winged helix-turn helix
Probab=54.20  E-value=8.1  Score=23.05  Aligned_cols=33  Identities=15%  Similarity=0.195  Sum_probs=24.7

Q ss_pred             eeeCHHHHHHHHHHhcCCceecccccccCcccee
Q 033584           60 GSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETG   93 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG   93 (116)
                      |--|..+|++.|.+.+|+.+....|.- -++.+|
T Consensus         3 ~~wt~~~i~~~I~~~fgv~ys~~~v~~-lL~r~G   35 (60)
T PF13592_consen    3 GRWTLKEIAAYIEEEFGVKYSPSGVYR-LLKRLG   35 (60)
T ss_pred             CcccHHHHHHHHHHHHCCEEcHHHHHH-HHHHcC
Confidence            557899999999999999988776631 145554


No 16 
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins. Domain present in all 3 forms of cellular life. Present in two copies in inosine monophosphate dehydrogenase, of which one is disordered in the crystal structure [3]. A number of disease states are associated with CBS-containing proteins including homocystinuria, Becker's and Thomsen disease.
Probab=53.79  E-value=13  Score=18.86  Aligned_cols=18  Identities=22%  Similarity=0.532  Sum_probs=14.9

Q ss_pred             CCCeeEeeeCHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDII   71 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L   71 (116)
                      ++|++.|.++..++...+
T Consensus        31 ~~~~~~g~i~~~~l~~~~   48 (49)
T smart00116       31 EEGRLVGIVTRRDIIKAL   48 (49)
T ss_pred             CCCeEEEEEEHHHHHHhh
Confidence            457899999999987765


No 17 
>COG1356 tfx Transcriptional regulator [DNA replication, recombination and repair]
Probab=48.33  E-value=75  Score=22.64  Aligned_cols=43  Identities=9%  Similarity=0.062  Sum_probs=27.1

Q ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCeEEEEEecCCC
Q 033584            7 VTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKG   55 (116)
Q Consensus         7 aT~~n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~   55 (116)
                      -|..|+..+|.+...    ..+.-..-..+.++|.+  ++.|..++|++
T Consensus        35 TTraNvSaIEkrA~e----nIekarnTL~l~~~i~s--pv~i~v~aGe~   77 (143)
T COG1356          35 TTRANVSAIEKRALE----NIEKARNTLLLWEQINS--PVSITVKAGED   77 (143)
T ss_pred             cchhhHHHHHHHHHH----HHHHHHHHHHHHHHhCC--CeEEEecCCCc
Confidence            366777777633222    22222333567888886  69999999975


No 18 
>PF01282 Ribosomal_S24e:  Ribosomal protein S24e;  InterPro: IPR001976 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the S24e ribosomal proteins from eukaryotes and archaebacteria. These proteins have 101 to 148 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2V94_B 1YWX_A 2G1D_A 3IZ6_U 1XN9_A 2XZM_P 2XZN_P 3U5G_Y 3J16_D 3IZB_U ....
Probab=47.79  E-value=18  Score=23.41  Aligned_cols=44  Identities=16%  Similarity=0.196  Sum_probs=31.0

Q ss_pred             eeeCHHHHHHHHHHhcCCceecccccccCcc-ceeeE--EEEEEecCCe
Q 033584           60 GSVTAQDVVDIIKAQLQRDVDKKIVDLPEIR-ETGEY--IAQLKLHPEV  105 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik-~lG~y--~V~i~L~~~V  105 (116)
                      ++.+-.||.+.|.+.+|.  |+..|.+..|+ ..|..  ....++|.+.
T Consensus        11 ~Tpsr~ei~~klA~~~~~--~~~~ivv~~~~t~fG~~~s~g~a~IYd~~   57 (84)
T PF01282_consen   11 PTPSRKEIREKLAAMLNV--DPDLIVVFGIKTEFGGGKSTGFAKIYDSA   57 (84)
T ss_dssp             SS--HHHHHHHHHHHHTS--TGCCEEEEEEEESSSSSEEEEEEEEESSH
T ss_pred             CCCCHHHHHHHHHHHhCC--CCCeEEEeccEecCCCceEEEEEEEeCCH
Confidence            678999999999999875  77788877655 66655  5555666654


No 19 
>cd03081 TRX_Fd_NuoE_FDH_gamma TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily, NAD-dependent formate dehydrogenase (FDH) gamma subunit; composed of proteins similar to the gamma subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD+ to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH gamma subunit is closely related to NuoE, which is part of a multisubunit complex (Nuo) catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE. Similarly, the FDH gamma subunit is hypothesized to be involved in an electron transport chain involving other FDH subunits, upon the oxidat
Probab=46.95  E-value=19  Score=22.64  Aligned_cols=19  Identities=11%  Similarity=0.319  Sum_probs=16.7

Q ss_pred             CCeeEeeeCHHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~~   73 (116)
                      ||.+|+.+|+.+|.+.+.+
T Consensus        61 ~~~~~~~~~~e~i~~il~~   79 (80)
T cd03081          61 DGEVHGRVDPEKFDALLAE   79 (80)
T ss_pred             CCEEECCCCHHHHHHHHHc
Confidence            7899999999999988754


No 20 
>PF14221 DUF4330:  Domain of unknown function (DUF4330)
Probab=44.60  E-value=20  Score=26.05  Aligned_cols=20  Identities=20%  Similarity=0.501  Sum_probs=15.7

Q ss_pred             CCCCeeEeeeCHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~   72 (116)
                      .+.|+|||.|+.=|+.-.|.
T Consensus         5 D~kGrlFgkiniiDl~~~lv   24 (168)
T PF14221_consen    5 DSKGRLFGKINIIDLLAILV   24 (168)
T ss_pred             ccCCcEeeeEeHHHHHHHHH
Confidence            35799999999999665543


No 21 
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream.   The vitamin B6 complex comprises pyridoxine, pyridoxal, and pyridoxamine, as well as the 5'-phosphate esters of pyridoxal (PALP) and pyridoxamine, the last two being the biologically active coenzyme derivatives.  The members of the PALP family are principally involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and other amine-containing compounds.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a poten
Probab=40.55  E-value=17  Score=23.84  Aligned_cols=19  Identities=32%  Similarity=0.405  Sum_probs=15.8

Q ss_pred             CCCCeeEeeeCHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDII   71 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L   71 (116)
                      .++|++-|-||..||.+++
T Consensus       106 ~~~~~~~Givt~~Dl~~~~  124 (124)
T cd04608         106 EKQEKPIGIVTKIDLLSYI  124 (124)
T ss_pred             ccccceEEEEehhHhhhhC
Confidence            3568999999999998763


No 22 
>cd02980 TRX_Fd_family Thioredoxin (TRX)-like [2Fe-2S] Ferredoxin (Fd) family; composed of [2Fe-2S] Fds with a TRX fold (TRX-like Fds) and proteins containing domains similar to TRX-like Fd including formate dehydrogenases, NAD-reducing hydrogenases and the subunit E of NADH:ubiquinone oxidoreductase (NuoE). TRX-like Fds are soluble low-potential electron carriers containing a single [2Fe-2S] cluster. The exact role of TRX-like Fd is still unclear. It has been suggested that it may be involved in nitrogen fixation. Its homologous domains in large redox enzymes (such as Nuo and hydrogenases) function as electron carriers.
Probab=38.52  E-value=32  Score=20.69  Aligned_cols=20  Identities=30%  Similarity=0.529  Sum_probs=16.5

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|.+||-||+.++.+.|.+
T Consensus        57 ~~~~~y~~v~~~~~~~il~~   76 (77)
T cd02980          57 PDGVWYGRVTPEDVEEIVEE   76 (77)
T ss_pred             CCCeEEccCCHHHHHHHHHh
Confidence            35899999999999887753


No 23 
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=37.40  E-value=36  Score=21.92  Aligned_cols=21  Identities=29%  Similarity=0.450  Sum_probs=16.9

Q ss_pred             cCCCCeeEeeeCHHHHHHHHH
Q 033584           52 GGKGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        52 ~g~~GklfGSVt~~dIa~~L~   72 (116)
                      .+++|++.|.||..|+...+.
T Consensus        30 v~~~~~~~G~it~~dl~~~~~   50 (128)
T cd04632          30 VDDNGKLTGIVTRHDIVDFVV   50 (128)
T ss_pred             ECCCCcEEEEEEHHHHHHHHh
Confidence            345689999999999987653


No 24 
>cd08506 PBP2_clavulanate_OppA2 The substrate-binding domain of an oligopeptide binding protein (OppA2) from the biosynthesis pathway of the beta-lactamase inhibitor clavulanic acid contains the type 2 periplasmic binding fold. Clavulanic acid (CA), a clinically important beta-lactamase inhibitor, is one of a family of clavams produced as secondary metabolites by fermentation of Streptomyces clavuligeru. The biosynthesis of CA proceeds via multiple steps from the precursors, glyceraldehyde-3-phosphate and arginine. CA possesses a characteristic (3R,5R) stereochemistry essential for reaction with penicillin-binding proteins and beta-lactamases. Two genes (oppA1 and oppA2) in the clavulanic acid gene cluster encode oligopeptide-binding proteins that are required for CA biosynthesis. OppA1/2 is involved in the binding and transport of peptides across the cell membrane of Streptomyces clavuligerus.  Most of other periplasmic binding proteins are comprised of only two globular subdomains cor
Probab=37.01  E-value=58  Score=26.34  Aligned_cols=45  Identities=18%  Similarity=0.214  Sum_probs=35.2

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceecccccccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|+.+-|-   ||..   +|+.|++..+....+            ++.++.|+|.|+|...
T Consensus        65 ~~tf~Lr~~vkf~dG~p---~TA~Dv~~s~~~~~~------------v~~~d~~tv~i~l~~p  112 (466)
T cd08506          65 TWTYTLRDGLKFEDGTP---ITAKDVKYGIERSFA------------IETPDDKTIVFHLNRP  112 (466)
T ss_pred             EEEEEECCCCEeCCCCe---eeHHHHHHhhhheEE------------EEecCCCeEEEEecCC
Confidence            6999998774   7766   899999999975422            6777888888888754


No 25 
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=36.68  E-value=40  Score=20.78  Aligned_cols=21  Identities=19%  Similarity=0.479  Sum_probs=17.6

Q ss_pred             CCCeeEeeeCHHHHHHHHHHh
Q 033584           54 KGKQIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~~   74 (116)
                      ++|++.|.||..|+...+...
T Consensus        32 ~~~~~~Giv~~~~l~~~~~~~   52 (113)
T cd04623          32 DGGRLVGIFSERDIVRKVALR   52 (113)
T ss_pred             CCCCEEEEEehHHHHHHHhhc
Confidence            457999999999999887653


No 26 
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes. These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually 
Probab=36.46  E-value=40  Score=22.74  Aligned_cols=22  Identities=14%  Similarity=0.181  Sum_probs=18.4

Q ss_pred             CCCCeeEeeeCHHHHHHHHHHh
Q 033584           53 GKGKQIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~~~   74 (116)
                      .++|++.|.||..|+..++...
T Consensus        31 D~~g~l~Givt~~Dl~~~~~~~   52 (133)
T cd04592          31 DSDDFLEGILTLGDIQRFLFTN   52 (133)
T ss_pred             CCCCeEEEEEEHHHHHHHHhhc
Confidence            3578999999999999988643


No 27 
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in magnesium and cobalt efflux, and in association with some proteins of unknown function.  The function of the CorC_HlyC domain is uncertain but it might be involved in modulating transport of ion substrates. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role,
Probab=36.03  E-value=42  Score=20.76  Aligned_cols=18  Identities=22%  Similarity=0.484  Sum_probs=16.0

Q ss_pred             CeeEeeeCHHHHHHHHHH
Q 033584           56 KQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        56 GklfGSVt~~dIa~~L~~   73 (116)
                      |++.|.||..++...+..
T Consensus        35 ~~~~G~v~~~~l~~~~~~   52 (111)
T cd04590          35 DNIIGVVHVKDLLRALAE   52 (111)
T ss_pred             ceEEEEEEHHHHHHHHHc
Confidence            899999999999988754


No 28 
>cd03082 TRX_Fd_NuoE_W_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E family, Tungsten-containing formate dehydrogenase (W-FDH) beta subunit; composed of proteins similar to the W-FDH beta subunit of Methylobacterium extorquens. W-FDH is a heterodimeric NAD-dependent enzyme catalyzing the conversion of formate to carbon dioxide. The beta subunit is a fusion protein containing an N-terminal NuoE domain and a C-terminal NuoF domain. NuoE and NuoF are components of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster in NuoE and the [4Fe-4S] cluster in NuoF. In addition, NuoF is also the NADH- and FMN-binding subunit. Similarly, the beta subunit of W-FDH is most likely involved in the electron transport chain during the NAD-dependen
Probab=35.89  E-value=33  Score=21.21  Aligned_cols=18  Identities=17%  Similarity=0.311  Sum_probs=15.9

Q ss_pred             CCeeEeeeCHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~   72 (116)
                      +|++|+.+|+.+|-+.+.
T Consensus        53 ~~~~~~~~t~~~i~~~~~   70 (72)
T cd03082          53 GQRPVDGATPAAVAAAVE   70 (72)
T ss_pred             CCEEeCCcCHHHHHHHHh
Confidence            789999999999987764


No 29 
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=35.55  E-value=46  Score=20.66  Aligned_cols=22  Identities=14%  Similarity=0.294  Sum_probs=17.8

Q ss_pred             CCCCeeEeeeCHHHHHHHHHHh
Q 033584           53 GKGKQIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~~~   74 (116)
                      .++|++.|.|+..++...+...
T Consensus        31 ~~~~~~~G~v~~~~l~~~~~~~   52 (114)
T cd04629          31 DDNGNLVGFLSEQDCLKQLLES   52 (114)
T ss_pred             CCCCeEEEEeehHHHHHHhhhh
Confidence            3578999999999999876543


No 30 
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]
Probab=35.44  E-value=33  Score=27.36  Aligned_cols=23  Identities=22%  Similarity=0.289  Sum_probs=19.9

Q ss_pred             ecCCCCeeEeeeCHHHHHHHHHH
Q 033584           51 KGGKGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        51 k~g~~GklfGSVt~~dIa~~L~~   73 (116)
                      .+-++|++-|-+|..||++++..
T Consensus       207 PVvd~dk~vGiit~~dI~~aia~  229 (294)
T COG2524         207 PVVDDDKIVGIITLSDIAKAIAN  229 (294)
T ss_pred             ceecCCceEEEEEHHHHHHHHHc
Confidence            34478899999999999999975


No 31 
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=34.81  E-value=45  Score=20.70  Aligned_cols=21  Identities=29%  Similarity=0.447  Sum_probs=17.2

Q ss_pred             CCCCeeEeeeCHHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~~   73 (116)
                      .++|++.|.||..|+...+..
T Consensus        31 d~~~~~~G~v~~~~l~~~~~~   51 (112)
T cd04624          31 DPDERPIGIVTERDIVRAVAA   51 (112)
T ss_pred             CCCCCEEEEeeHHHHHHHHhc
Confidence            346899999999999887654


No 32 
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=34.64  E-value=48  Score=20.51  Aligned_cols=20  Identities=15%  Similarity=0.368  Sum_probs=16.7

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.|+..++...+..
T Consensus        32 ~~~~~~G~v~~~~l~~~~~~   51 (111)
T cd04639          32 GDGHLVGLLTRDDLIRALAE   51 (111)
T ss_pred             CCCcEEEEeeHHHHHHHHHh
Confidence            45899999999999887654


No 33 
>PF10826 DUF2551:  Protein of unknown function (DUF2551) ;  InterPro: IPR020501 This entry contains proteins with no known function.
Probab=34.62  E-value=24  Score=23.07  Aligned_cols=23  Identities=26%  Similarity=0.328  Sum_probs=20.3

Q ss_pred             eeeCHHHHHHHHHHhcCCceecccc
Q 033584           60 GSVTAQDVVDIIKAQLQRDVDKKIV   84 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~idkk~I   84 (116)
                      |+.|+.||-+.|.++  ++|..+.+
T Consensus        24 ~~~T~~di~e~L~~~--f~vs~~~V   46 (83)
T PF10826_consen   24 KKFTTDDIYERLKEK--FDVSYRGV   46 (83)
T ss_pred             CCeeHHHHHHHHHHH--cCchHHHH
Confidence            789999999999987  77888876


No 34 
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=34.33  E-value=88  Score=19.52  Aligned_cols=19  Identities=26%  Similarity=0.532  Sum_probs=16.2

Q ss_pred             CeeEeeeCHHHHHHHHHHh
Q 033584           56 KQIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        56 GklfGSVt~~dIa~~L~~~   74 (116)
                      |++.|.||..|+...+...
T Consensus        35 ~~~~G~v~~~dl~~~~~~~   53 (114)
T cd04630          35 SDAYGIVTMRDILKKVVAE   53 (114)
T ss_pred             CcEEEEEehHHHHHHHHhC
Confidence            7999999999999876543


No 35 
>cd03064 TRX_Fd_NuoE TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily; Nuo, also called respiratory chain Complex 1, is the entry point for electrons into the respiratory chains of bacteria and the mitochondria of eukaryotes. It is a multisubunit complex with at least 14 core subunits. It catalyzes the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane, providing the proton motive force required for energy-consuming processes. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster present in NuoE core subunit, also called the 24 kD subunit of Complex 1. This subfamily also include formate dehydrogenases, NiFe hydrogenases and NAD-reducing hydrogenases, that contain a NuoE domain. A subset of these proteins contain both NuoE and NuoF in a single chain. NuoF, also called the 51 kD subunit of Complex 1, contains one [4Fe-4S] clu
Probab=34.04  E-value=42  Score=20.70  Aligned_cols=19  Identities=26%  Similarity=0.594  Sum_probs=16.2

Q ss_pred             CCeeEeeeCHHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~~   73 (116)
                      +|.+|+-||+.+|.+.+.+
T Consensus        61 ~g~~y~~vt~~~i~~i~~~   79 (80)
T cd03064          61 NDDVYGRLTPEKVDAILEA   79 (80)
T ss_pred             CCEEECCCCHHHHHHHHHh
Confidence            5899999999999987753


No 36 
>cd08490 PBP2_NikA_DppA_OppA_like_3 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=33.43  E-value=1e+02  Score=24.84  Aligned_cols=60  Identities=12%  Similarity=0.182  Sum_probs=40.0

Q ss_pred             hccCeEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceecccc-cccCccceeeEEEEEEecCC
Q 033584           41 ETVGAFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDKKIV-DLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        41 ~~~~~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idkk~I-~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      ++. +++|..+-|-   ||.   -||+.|+.-.+........-.... .+..++.++.|+|.|+|...
T Consensus        54 d~~-~~tf~Lr~~~~wsDG~---plTA~Dv~~s~~~~~~~~~~~~~~~~~~~v~~~d~~tv~i~l~~p  117 (470)
T cd08490          54 DDT-TWEFTLRDGVKFHDGT---PLTAEAVKASLERALAKSPRAKGGALIISVIAVDDYTVTITTKEP  117 (470)
T ss_pred             CCC-EEEEEECCCCCccCCC---CCCHHHHHHHHHHHhccCccccccccceEEEecCCCEEEEEeCCC
Confidence            554 7999998874   776   499999999887532211111101 12248889999999999764


No 37 
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=33.31  E-value=48  Score=20.65  Aligned_cols=20  Identities=20%  Similarity=0.376  Sum_probs=16.9

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.|+..|+...+..
T Consensus        32 ~~~~~~Giv~~~dl~~~~~~   51 (116)
T cd04643          32 KEGKYVGTISLTDILWKLKG   51 (116)
T ss_pred             CCCcEEEEEeHHHHHHHhhc
Confidence            57899999999999887653


No 38 
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]
Probab=32.91  E-value=37  Score=25.29  Aligned_cols=19  Identities=16%  Similarity=0.529  Sum_probs=17.4

Q ss_pred             CCCeeEeeeCHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~   72 (116)
                      ++|++-|.||..||.+-+.
T Consensus       166 e~G~~vGIITk~DI~k~~~  184 (187)
T COG3620         166 ENGKVVGIITKADIMKLLA  184 (187)
T ss_pred             eCCceEEEEeHHHHHHHHh
Confidence            7889999999999998875


No 39 
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=32.90  E-value=49  Score=20.87  Aligned_cols=21  Identities=24%  Similarity=0.297  Sum_probs=17.3

Q ss_pred             CCCCeeEeeeCHHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~~   73 (116)
                      .++|++.|.||..|+...+..
T Consensus        31 d~~g~~~G~vt~~dl~~~~~~   51 (114)
T cd04619          31 DPHGKLAGVLTKTDVVRQMGR   51 (114)
T ss_pred             CCCCCEEEEEehHHHHHHHhh
Confidence            467899999999999887653


No 40 
>PRK07639 acyl carrier protein; Provisional
Probab=32.75  E-value=15  Score=23.57  Aligned_cols=34  Identities=21%  Similarity=0.203  Sum_probs=25.4

Q ss_pred             eeeCHHHHHHHHHHhcCCceecccccccCcccee
Q 033584           60 GSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETG   93 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG   93 (116)
                      =|+..-++.-+|...||+.|+...+....+.++|
T Consensus        39 DSld~velv~~lE~~fgi~i~d~~~~~~~~~Tv~   72 (86)
T PRK07639         39 DSVMMLQLIVYIEMDVKLCVPEDEVDPKAFLTVG   72 (86)
T ss_pred             ChHHHHHHHHHHHHHHCCccCHHHccHHHhCCHH
Confidence            4778888888899999999987766444455554


No 41 
>PF12167 DUF3596:  Domain of unknown function (DUF3596);  InterPro: IPR022000  This N-terminal domain is found in Bacteriophage P27p02, it is functionally uncharacterised, though it is considered to be an integrase. Integrase is necessary for integration of the phage into the host genome by site-specific recombination. In conjunction with excisionase, integrase is also necessary for excision of the prophage from the host genome. This domain is found in related proteins in other bacteriophage, and prophage regions of bacterial genomes. The domain is approximately 90 amino acids in length and is found is associated with the C-terminal domain characterised by PF00589 from PFAM. 
Probab=32.66  E-value=63  Score=19.61  Aligned_cols=23  Identities=30%  Similarity=0.144  Sum_probs=16.6

Q ss_pred             ceeecCHHHHHHHHHHHHHHHHH
Q 033584            3 KAQIVTPLLLKEMKMEEERIEAE   25 (116)
Q Consensus         3 lA~~aT~~n~k~~~~~~~~~~~~   25 (116)
                      +..+.|+.|++.++....+.+.+
T Consensus        26 l~l~dT~~N~k~a~~~~~~I~~~   48 (64)
T PF12167_consen   26 LGLPDTPANRKKAERLRAEIEAE   48 (64)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHH
Confidence            45678999999887666555543


No 42 
>cd03063 TRX_Fd_FDH_beta TRX-like [2Fe-2S] Ferredoxin (Fd) family, NAD-dependent formate dehydrogenase (FDH) beta subunit; composed of proteins similar to the beta subunit of NAD-linked FDH of Ralstonia eutropha, a soluble enzyme that catalyzes the irreversible oxidation of formate to carbon dioxide accompanied by the reduction of NAD to NADH. FDH is a heteromeric enzyme composed of four nonidentical subunits (alpha, beta, gamma and delta). The FDH beta subunit contains a NADH:ubiquinone oxidoreductase (Nuo) F domain C-terminal to a Fd-like domain without the active site cysteines. The absence of conserved metal-binding residues in the putative active site suggests that members of this subfamily have lost the ability to bind iron-sulfur clusters in the N-terminal Fd-like domain. The C-terminal NuoF domain is a component of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. NuoF contains one [4Fe-4S] c
Probab=32.50  E-value=58  Score=21.41  Aligned_cols=21  Identities=33%  Similarity=0.586  Sum_probs=17.4

Q ss_pred             CCC-eeEeeeCHHHHHHHHHHh
Q 033584           54 KGK-QIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        54 ~~G-klfGSVt~~dIa~~L~~~   74 (116)
                      ++| -+||-||+.|+.+.+.+.
T Consensus        56 p~g~v~Y~~V~~edv~~Iv~~~   77 (92)
T cd03063          56 PGGRVAYGPVTPADVASLLDAG   77 (92)
T ss_pred             CCCcEEEEeCCHHHHHHHHHHH
Confidence            345 899999999999888764


No 43 
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown.  In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzi
Probab=32.44  E-value=45  Score=20.46  Aligned_cols=19  Identities=21%  Similarity=0.202  Sum_probs=15.6

Q ss_pred             CCCCeeEeeeCHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDII   71 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L   71 (116)
                      .++|++.|.||..||....
T Consensus        31 d~~g~~~Giv~~~dl~~~~   49 (106)
T cd04582          31 DADGQPLGFVTRREAARAS   49 (106)
T ss_pred             CCCCCEEEEEeHHHHHHhc
Confidence            3578999999999998754


No 44 
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=32.43  E-value=44  Score=20.90  Aligned_cols=20  Identities=20%  Similarity=0.418  Sum_probs=16.5

Q ss_pred             CCCCeeEeeeCHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~   72 (116)
                      .++|++.|.||..|+...+.
T Consensus        32 d~~~~~~G~v~~~dl~~~~~   51 (113)
T cd04607          32 DENGRLLGTVTDGDIRRALL   51 (113)
T ss_pred             CCCCCEEEEEEcHHHHHHHh
Confidence            35689999999999987664


No 45 
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE.  MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other divalent cations into the cell via two highly conserved aspartates. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=32.39  E-value=68  Score=19.89  Aligned_cols=19  Identities=32%  Similarity=0.671  Sum_probs=15.3

Q ss_pred             CCCCeeEeeeCHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDII   71 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L   71 (116)
                      .++|++.|-||..|+.++|
T Consensus        91 ~~~~~~~Gvit~~dll~~~  109 (109)
T cd04606          91 DEEGRLVGIITVDDVIDVI  109 (109)
T ss_pred             CCCCcEEEEEEhHHhhhhC
Confidence            4568999999999988653


No 46 
>COG5556 Uncharacterized conserved protein [Function unknown]
Probab=32.37  E-value=22  Score=24.15  Aligned_cols=25  Identities=20%  Similarity=0.351  Sum_probs=21.1

Q ss_pred             CHHHHHHHHHHhcCCceeccccccc
Q 033584           63 TAQDVVDIIKAQLQRDVDKKIVDLP   87 (116)
Q Consensus        63 t~~dIa~~L~~~~g~~idkk~I~l~   87 (116)
                      |++-++++.++.+|++|.+..++-.
T Consensus        21 s~S~Va~aVkkEfGi~VsrQlvesh   45 (110)
T COG5556          21 SPSVVAAAVKKEFGIDVSRQLVESH   45 (110)
T ss_pred             cHHHHHHHHHHHhcchHHHHHHHhc
Confidence            5778999999999999999887643


No 47 
>PHA02119 hypothetical protein
Probab=31.92  E-value=32  Score=22.06  Aligned_cols=34  Identities=21%  Similarity=0.394  Sum_probs=24.9

Q ss_pred             eEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCceeccc
Q 033584           45 AFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKI   83 (116)
Q Consensus        45 ~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~idkk~   83 (116)
                      .++|.-.    |--|-.|-++||++.|... |+++.-..
T Consensus        41 ~f~isf~----~~kfp~i~~~divdylr~l-gy~~~~~s   74 (87)
T PHA02119         41 SFKISFD----VAKFPAIMPKDIVDYLRSL-GYDAKSDS   74 (87)
T ss_pred             eeEEEec----cccCCccccHHHHHHHHHc-cchhcccc
Confidence            4555543    3467779999999999987 98875443


No 48 
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=31.39  E-value=48  Score=20.73  Aligned_cols=19  Identities=16%  Similarity=0.239  Sum_probs=16.3

Q ss_pred             CCCeeEeeeCHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~   72 (116)
                      ++|++.|.||..|+...+.
T Consensus        33 ~~~~~~G~v~~~dl~~~~~   51 (114)
T cd04801          33 NEGRYVGIISLADLRAIPT   51 (114)
T ss_pred             CCCcEEEEEEHHHHHHHHH
Confidence            4689999999999988765


No 49 
>PF13565 HTH_32:  Homeodomain-like domain
Probab=31.31  E-value=35  Score=20.56  Aligned_cols=19  Identities=11%  Similarity=0.310  Sum_probs=16.5

Q ss_pred             eeCHHHHHHHHHHhcCCce
Q 033584           61 SVTAQDVVDIIKAQLQRDV   79 (116)
Q Consensus        61 SVt~~dIa~~L~~~~g~~i   79 (116)
                      --|+.+|++.|..++|+.+
T Consensus        48 ~wt~~~i~~~L~~~~g~~~   66 (77)
T PF13565_consen   48 RWTPREIAEYLEEEFGISV   66 (77)
T ss_pred             CCCHHHHHHHHHHHhCCCC
Confidence            4789999999999989866


No 50 
>COG1438 ArgR Arginine repressor [Transcription]
Probab=31.03  E-value=31  Score=24.91  Aligned_cols=34  Identities=18%  Similarity=0.416  Sum_probs=25.0

Q ss_pred             CHHHHHHHHHHhcCCceecccccccCccceeeEEEE
Q 033584           63 TAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQ   98 (116)
Q Consensus        63 t~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG~y~V~   98 (116)
                      |-.||++.|++. |++|.--.+. .+||++|-..|+
T Consensus        22 TQ~Elv~~L~~~-Gi~vTQaTvS-RDlkelglvKv~   55 (150)
T COG1438          22 TQEELVELLQEE-GIEVTQATVS-RDLKELGLVKVR   55 (150)
T ss_pred             CHHHHHHHHHHc-CCeEehHHHH-HHHHHcCCEEec
Confidence            567899999887 9888755442 148888887776


No 51 
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription]
Probab=30.40  E-value=47  Score=24.70  Aligned_cols=23  Identities=22%  Similarity=0.330  Sum_probs=19.2

Q ss_pred             cCCCCeeEeeeCHHHHHHHHHHh
Q 033584           52 GGKGKQIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        52 ~g~~GklfGSVt~~dIa~~L~~~   74 (116)
                      +-++|++-||||-.+|.+++.+.
T Consensus       101 Vi~~~k~VGsItE~~iv~~~le~  123 (187)
T COG3620         101 VIEEDKVVGSITENDIVRALLEG  123 (187)
T ss_pred             eeeCCeeeeeecHHHHHHHHhcc
Confidence            33568999999999999998654


No 52 
>cd08502 PBP2_NikA_DppA_OppA_like_16 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=30.33  E-value=1.2e+02  Score=24.72  Aligned_cols=57  Identities=19%  Similarity=0.326  Sum_probs=38.6

Q ss_pred             eEEEEEecC---CCCeeEeeeCHHHHHHHHHHhcCCcee-ccccc-ccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGG---KGKQIFGSVTAQDVVDIIKAQLQRDVD-KKIVD-LPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g---~~GklfGSVt~~dIa~~L~~~~g~~id-kk~I~-l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|..+-|   .||.   .||+.|++-.+..-.+.... +.... +..|..+|.|+|.|+|...
T Consensus        59 ~~tf~LR~~v~wsdG~---~lTA~Dv~~s~~~~~~~~~~~~~~~~~i~~v~~~d~~tv~~~l~~p  120 (472)
T cd08502          59 TYTFTLRDGLKFHDGS---PVTAADVVASLKRWAKRDAMGQALMAAVESLEAVDDKTVVITLKEP  120 (472)
T ss_pred             EEEEEEcCCCEecCCc---cCcHHHHHHHHHHHhccCcccccccccceeEEecCCCEEEEEeCCC
Confidence            688998887   3674   59999999888743222211 11222 2348899999999999753


No 53 
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea. These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS d
Probab=29.82  E-value=55  Score=20.50  Aligned_cols=20  Identities=20%  Similarity=0.443  Sum_probs=16.9

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.|+..|+...+..
T Consensus        32 ~~~~~~G~v~~~dl~~~~~~   51 (115)
T cd04593          32 RDGGVVGIITLPDLLRALEA   51 (115)
T ss_pred             CCCCEEEEEEHHHHHHHHhc
Confidence            46899999999999987754


No 54 
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain.  Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. The PB1 domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pai
Probab=29.41  E-value=28  Score=21.66  Aligned_cols=17  Identities=18%  Similarity=0.347  Sum_probs=14.0

Q ss_pred             CCCCeeEeeeCHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVD   69 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~   69 (116)
                      .++|++.|.||..||..
T Consensus        96 ~~~~~~~Gvvs~~dl~~  112 (113)
T cd04587          96 DKSGQVVGLLDVTKLTH  112 (113)
T ss_pred             CCCCCEEEEEEHHHhcc
Confidence            34689999999999864


No 55 
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein.  These APIs catalyze the conversion of the pentose pathway intermediate D-ribulose 5-phosphate into A5P, a precursor of 3-deoxy-D-manno-octulosonate, which is an integral carbohydrate component of various glycolipids coating the surface of the outer membrane of Gram-negative bacteria, including lipopolysaccharide and many group 2 K-antigen capsules. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other funct
Probab=29.34  E-value=61  Score=20.00  Aligned_cols=20  Identities=15%  Similarity=0.297  Sum_probs=16.9

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.|+..++...+..
T Consensus        33 ~~~~~~G~v~~~~i~~~~~~   52 (114)
T cd04604          33 EDGRLVGIFTDGDLRRALEK   52 (114)
T ss_pred             CCCCEEEEechHHHHHHHhc
Confidence            45799999999999988764


No 56 
>COG0757 AroQ 3-dehydroquinate dehydratase II [Amino acid transport and metabolism]
Probab=29.31  E-value=49  Score=23.83  Aligned_cols=27  Identities=26%  Similarity=0.427  Sum_probs=21.7

Q ss_pred             eeEeeeCHHHHHHHHHH---hcCCceeccc
Q 033584           57 QIFGSVTAQDVVDIIKA---QLQRDVDKKI   83 (116)
Q Consensus        57 klfGSVt~~dIa~~L~~---~~g~~idkk~   83 (116)
                      .+||+.|-.||.+.++.   +.|++++=++
T Consensus        20 ~iYG~~Tl~di~~~~~~~a~~~g~~v~~~Q   49 (146)
T COG0757          20 GIYGSTTLEDIEADLEEEAAKLGVEVEFRQ   49 (146)
T ss_pred             CccCcccHHHHHHHHHHHHHHcCceEEEEe
Confidence            59999999999998874   4477777655


No 57 
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=28.95  E-value=63  Score=20.14  Aligned_cols=19  Identities=21%  Similarity=0.438  Sum_probs=16.0

Q ss_pred             CCeeEeeeCHHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~~   73 (116)
                      +|++.|.||..|+...+..
T Consensus        33 ~~~~~G~v~~~dl~~~~~~   51 (115)
T cd04620          33 KGRLLGIFTERDIVRLTAI   51 (115)
T ss_pred             CCcEEEEEeHHHHHHHHhc
Confidence            5899999999999986643


No 58 
>PF01257 2Fe-2S_thioredx:  Thioredoxin-like [2Fe-2S] ferredoxin;  InterPro: IPR002023  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. Among the many polypeptide subunits that make up complex I, there is one with a molecular weight of 24 kDa (in mammals), which is a component of the iron-sulphur (IP) fragment of the enzyme. It seems to bind a 2Fe-2S iron-sulphur cluster. The 24 kDa subunit is nuclear encoded, as a precursor form with a transit peptide in mammals and in Neurospora crassa. There is a highly conserved region located in the central section of this subunit that contains two conserved cysteines, that are probably involved in the binding of the 2Fe-2S centre. The 24 kDa subunit is highly similar to [, ]:  Subunit E of Escherichia coli NADH-ubiquinone oxidoreductase (gene nuoE) Subunit NQO2 of Paracoccus denitrificans NADH-ubiquinone oxidoreductase  ; GO: 0016491 oxidoreductase activity, 0051287 NAD binding, 0055114 oxidation-reduction process; PDB: 1M2D_A 1M2A_B 1F37_B 1M2B_B 2FUG_B 3M9S_B 3IAM_B 3IAS_K 2YBB_2 3I9V_B ....
Probab=28.83  E-value=37  Score=23.76  Aligned_cols=19  Identities=26%  Similarity=0.546  Sum_probs=16.8

Q ss_pred             CCeeEeeeCHHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~~   73 (116)
                      ||.+||-+|+.+|.+.|.+
T Consensus       125 ~~~~y~~vt~e~v~~il~~  143 (145)
T PF01257_consen  125 DGEWYGNVTPEKVDEILEE  143 (145)
T ss_dssp             CCCEEESSSCCHHHHHHHH
T ss_pred             CCEEECCCCHHHHHHHHHh
Confidence            7899999999999888764


No 59 
>PRK15109 antimicrobial peptide ABC transporter periplasmic binding protein SapA; Provisional
Probab=28.71  E-value=1e+02  Score=25.93  Aligned_cols=59  Identities=15%  Similarity=0.318  Sum_probs=38.1

Q ss_pred             eEEEEEecCC---CCeeEe---eeCHHHHHHHHHHhcCCceecc--------------cc-cccCccceeeEEEEEEecC
Q 033584           45 AFKVKRKGGK---GKQIFG---SVTAQDVVDIIKAQLQRDVDKK--------------IV-DLPEIRETGEYIAQLKLHP  103 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfG---SVt~~dIa~~L~~~~g~~idkk--------------~I-~l~~Ik~lG~y~V~i~L~~  103 (116)
                      +++|+.+-|-   ||..||   -||+.|++..+..-.+......              .. .+..++..+.|+|.|+|..
T Consensus        95 t~tf~LR~gvkfsDG~~~~~G~pvTA~DV~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~v~~~d~~Tv~~~l~~  174 (547)
T PRK15109         95 TYRFHLRRDVPFQKTDWFTPTRKMNADDVVFSFQRIFDRNHPWHNVNGGNYPYFDSLQFADNVKSVRKLDNYTVEFRLAQ  174 (547)
T ss_pred             EEEEEecCCCeecCCcccCCCccccHHHhhhhHHHHhCcccccccccccccccccccccccceeEEEEeCCCeEEEEecC
Confidence            6888888764   554443   6999999998875422221100              00 1224778899999998865


No 60 
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain. Met2 is a key enzyme in the biosynthesis of methionine.  It encodes a homoserine transacetylase involved in converting homoserine to O-acetyl homoserine. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=28.49  E-value=68  Score=19.73  Aligned_cols=20  Identities=20%  Similarity=0.373  Sum_probs=16.4

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.||.+++...+..
T Consensus        33 ~~~~~~G~v~~~~l~~~~~~   52 (110)
T cd04605          33 EDGRLVGIVTSWDISKAVAR   52 (110)
T ss_pred             CCCcEEEEEeHHHHHHHHhh
Confidence            46899999999999876653


No 61 
>cd03083 TRX_Fd_NuoE_hoxF TRX-like [2Fe-2S] Ferredoxin (Fd) family, NADH:ubiquinone oxidoreductase (Nuo) subunit E subfamily, hoxF; composed of proteins similar to the NAD-reducing hydrogenase (hoxS) alpha subunit of Alcaligenes eutrophus H16. HoxS is a cytoplasmic hydrogenase catalyzing the oxidation of molecular hydrogen accompanied by the reduction of NAD. It is composed of four structural subunits encoded by the genes hoxF, hoxU, hoxY and hoxH. The hoxF protein (or alpha subunit) is a fusion protein containing an N-terminal NuoE-like domain and a C-terminal NuoF domain. NuoE and NuoF are components of Nuo, a multisubunit complex catalyzing the electron transfer of NADH to quinone coupled with the transfer of protons across the membrane. Electrons are transferred from NADH to quinone through a chain of iron-sulfur clusters in Nuo, including the [2Fe-2S] cluster in NuoE and the [4Fe-4S] cluster in NuoF. In addition, NuoF is also the NADH- and FMN-binding subunit. HoxF may be involved 
Probab=28.45  E-value=56  Score=20.41  Aligned_cols=18  Identities=17%  Similarity=0.377  Sum_probs=15.5

Q ss_pred             CCeeEeeeCHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~   72 (116)
                      +|.+||-||+.++.+.+.
T Consensus        61 ~~~~y~~v~~~~v~~iv~   78 (80)
T cd03083          61 NNRVFTRLTPGRIDQIAE   78 (80)
T ss_pred             CCEEECCCCHHHHHHHHh
Confidence            678999999999887764


No 62 
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream. The function of the DRTGG domain, named after its conserved residues, is unknown. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=28.36  E-value=43  Score=21.64  Aligned_cols=18  Identities=17%  Similarity=0.156  Sum_probs=14.6

Q ss_pred             cCCCCeeEeeeCHHHHHH
Q 033584           52 GGKGKQIFGSVTAQDVVD   69 (116)
Q Consensus        52 ~g~~GklfGSVt~~dIa~   69 (116)
                      ..++|++.|-||..||.+
T Consensus        95 vd~~~~l~Givt~~dl~~  112 (113)
T cd04597          95 VDDDGTPAGIITLLDLAE  112 (113)
T ss_pred             ECCCCeEEEEEEHHHhhc
Confidence            345789999999999864


No 63 
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA. OpuCA is the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment but the function of the CBS domains in OpuCA remains unknown.  In the related ABC transporter, OpuA, the tandem CBS domains have been shown to function as sensors for ionic strength, whereby they control the transport activity through an electronic switching mechanism. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules. They are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyz
Probab=28.22  E-value=61  Score=19.82  Aligned_cols=18  Identities=17%  Similarity=0.379  Sum_probs=15.2

Q ss_pred             CCCeeEeeeCHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDII   71 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L   71 (116)
                      ++|++.|.|+..|+...+
T Consensus        33 ~~~~~~G~v~~~dl~~~~   50 (109)
T cd04583          33 KDNKLLGIVSLESLEQAY   50 (109)
T ss_pred             CCCcEEEEEEHHHHHHHh
Confidence            468999999999998764


No 64 
>COG2047 Uncharacterized protein (ATP-grasp superfamily) [General function prediction only]
Probab=27.92  E-value=57  Score=25.48  Aligned_cols=26  Identities=15%  Similarity=0.474  Sum_probs=21.4

Q ss_pred             CCCeeEeeeCHHHHHHHHHHhcCCcee
Q 033584           54 KGKQIFGSVTAQDVVDIIKAQLQRDVD   80 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~~~g~~id   80 (116)
                      ++-+++|++|++++++.|++. |+...
T Consensus       133 eep~VlGA~ts~eLi~~lke~-gV~fr  158 (258)
T COG2047         133 EEPRVLGAVTSKELIEELKEH-GVEFR  158 (258)
T ss_pred             CCceeEEecCCHHHHHHHHHc-CeEec
Confidence            345899999999999999876 87654


No 65 
>cd08496 PBP2_NikA_DppA_OppA_like_9 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA can bind peptides of a wide range of lengths (2-35 amino-acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most
Probab=27.76  E-value=1.4e+02  Score=24.12  Aligned_cols=57  Identities=9%  Similarity=0.106  Sum_probs=38.4

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceecc-cc-cccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDKK-IV-DLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idkk-~I-~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|+.+-|-   ||..   ||+.|++-.+........... .+ .+..++.+|.|+|.|+|..-
T Consensus        59 t~tf~Lr~~~~f~DG~p---vTA~Dv~~s~~~~~~~~~~~~~~~~~i~~v~~~d~~tv~i~l~~p  120 (454)
T cd08496          59 TLTLHLREGLTFSDGTP---LDAAAVKANLDRGKSTGGSQVKQLASISSVEVVDDTTVTLTLSQP  120 (454)
T ss_pred             EEEEEeCCCCCccCCCC---cCHHHHHHHHHHHhCCCcchhhhccccceEEecCCCEEEEEeCCC
Confidence            6888888774   6764   799999999875432221110 11 12248889999999999753


No 66 
>PF14420 Clr5:  Clr5 domain
Probab=27.44  E-value=45  Score=19.49  Aligned_cols=23  Identities=22%  Similarity=0.299  Sum_probs=19.7

Q ss_pred             eCHHHHHHHHHHhcCCceecccc
Q 033584           62 VTAQDVVDIIKAQLQRDVDKKIV   84 (116)
Q Consensus        62 Vt~~dIa~~L~~~~g~~idkk~I   84 (116)
                      -|..||++.+++.+||...+++.
T Consensus        21 ~tl~~v~~~M~~~~~F~at~rqy   43 (54)
T PF14420_consen   21 KTLEEVMEIMKEEHGFKATKRQY   43 (54)
T ss_pred             CcHHHHHHHHHHHhCCCcCHHHH
Confidence            57899999999999999887764


No 67 
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=27.41  E-value=68  Score=20.32  Aligned_cols=21  Identities=14%  Similarity=0.322  Sum_probs=17.3

Q ss_pred             CCCCeeEeeeCHHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~~   73 (116)
                      .++|++.|.||.+|+...+..
T Consensus        31 ~~~~~~~Giv~~~dl~~~~~~   51 (120)
T cd04641          31 DENGKVVDVYSRFDVINLAKE   51 (120)
T ss_pred             CCCCeEEEEEeHHHHHHHHhc
Confidence            357899999999999987643


No 68 
>PF05157 T2SE_Nter:  Type II secretion system (T2SS), protein E, N-terminal domain;  InterPro: IPR007831 This domain is found at the N terminus of members of the general secretory system II protein E. Proteins in this subfamily are typically involved in Type IV pilus biogenesis (e.g. Q9X4G8 from SWISSPROT), though some are involved in other processes; for instance aggregation in Myxococcus xanthus (e.g. Q9RF11 from SWISSPROT) [].; GO: 0005524 ATP binding, 0006810 transport; PDB: 2D27_A 2D28_C.
Probab=27.03  E-value=41  Score=21.23  Aligned_cols=26  Identities=19%  Similarity=0.341  Sum_probs=16.1

Q ss_pred             eeeCHHHHHHHHHHhcCCc-eeccccc
Q 033584           60 GSVTAQDVVDIIKAQLQRD-VDKKIVD   85 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~-idkk~I~   85 (116)
                      |-||..++.++|++++|++ +|.....
T Consensus         5 g~ise~~l~~~la~~~~l~~~~~~~~~   31 (109)
T PF05157_consen    5 GLISEDQLLEALAEQLGLPFVDLDELP   31 (109)
T ss_dssp             T-S-HHHHHHHHHHHHT--B--GGGS-
T ss_pred             CCCCHHHHHHHHHHHhCCCeechhhcC
Confidence            7799999999999999997 4444443


No 69 
>PF11221 Med21:  Subunit 21 of Mediator complex;  InterPro: IPR021384 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.  The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11.  The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation.   The head module contains: MED6, MED8, MED11, SRB4/MED17, SRB5/MED18, ROX3/MED19, SRB2/MED20 and SRB6/MED22.  The middle module contains: MED1, MED4, NUT1/MED5, MED7, CSE2/MED9, NUT2/MED10, SRB7/MED21 and SOH1/MED31. CSE2/MED9 interacts directly with MED4.  The tail module contains: MED2, PGD1/MED3, RGR1/MED14, GAL11/MED15 and SIN4/MED16.  The CDK8 module contains: MED12, MED13, CCNC and CDK8.   Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP.  Med21 has been known as Srb7 in yeasts, hSrb7 in humans and Trap 19 in Drosophila. The heterodimer of the two subunits Med7 and Med21 appears to act as a hinge between the middle and the tail regions of Mediator []. ; PDB: 1YKE_B 1YKH_B.
Probab=26.90  E-value=2e+02  Score=20.03  Aligned_cols=33  Identities=27%  Similarity=0.359  Sum_probs=26.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Q 033584           11 LLKEMKMEEERIEAEKKRVKEEAQQLALIFETV   43 (116)
Q Consensus        11 n~k~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~   43 (116)
                      .++.|+.+.+..+.+..+...++.++-+.+++.
T Consensus       105 ~i~~L~~E~~~~~~el~~~v~e~e~ll~~v~~~  137 (144)
T PF11221_consen  105 RIKELEEENEEAEEELQEAVKEAEELLKQVQEL  137 (144)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            677788888888888888888888888887753


No 70 
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=26.71  E-value=53  Score=20.38  Aligned_cols=19  Identities=16%  Similarity=0.324  Sum_probs=15.6

Q ss_pred             CCCCeeEeeeCHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDII   71 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L   71 (116)
                      .++|++.|.||..|+....
T Consensus        31 d~~~~~~Giv~~~dl~~~~   49 (96)
T cd04614          31 DDDGKLSGIITERDLIAKS   49 (96)
T ss_pred             CCCCCEEEEEEHHHHhcCC
Confidence            3578999999999998743


No 71 
>PF13954 PapC_N:  PapC N-terminal domain; PDB: 2VQI_B 3FIP_A 3RFZ_E 3OHN_A 1ZDV_A 1ZE3_D 3BWU_D 1ZDX_A.
Probab=26.65  E-value=1.6e+02  Score=20.30  Aligned_cols=25  Identities=16%  Similarity=0.365  Sum_probs=20.1

Q ss_pred             ceeeEEEEEEecCCeEEEEEEEEee
Q 033584           91 ETGEYIAQLKLHPEVTARIRLNVFA  115 (116)
Q Consensus        91 ~lG~y~V~i~L~~~V~a~i~v~V~~  115 (116)
                      .-|+|.|.|.+...-..+..|.+..
T Consensus        28 ~pG~Y~vdv~vN~~~~~~~~i~f~~   52 (146)
T PF13954_consen   28 PPGEYSVDVYVNGKFIGRYDIEFIN   52 (146)
T ss_dssp             -SEEEEEEEEETTEEEEEEEEEEEE
T ss_pred             CCeEEEEEEEECCeeeeeEEEEEEe
Confidence            4599999999999888888877654


No 72 
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein.  IMPDH is an essential enzyme that catalyzes the first step unique to GTP synthesis, playing a key role in the regulation of cell proliferation and differentiation. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain in IMPDH have been associated with retinitis pigmentosa.
Probab=26.58  E-value=85  Score=19.16  Aligned_cols=18  Identities=17%  Similarity=0.270  Sum_probs=13.7

Q ss_pred             cCCCCeeEeeeCHHHHHH
Q 033584           52 GGKGKQIFGSVTAQDVVD   69 (116)
Q Consensus        52 ~g~~GklfGSVt~~dIa~   69 (116)
                      ..++|++.|-||..|+.+
T Consensus        92 v~~~~~~~Gvi~~~dil~  109 (110)
T cd04601          92 VDDEGKLKGLITVKDIEK  109 (110)
T ss_pred             EcCCCCEEEEEEhhhhhc
Confidence            345678999999988754


No 73 
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]
Probab=26.52  E-value=99  Score=26.11  Aligned_cols=41  Identities=20%  Similarity=0.434  Sum_probs=31.3

Q ss_pred             HHHHHHHhhccCeEEEEEecCCCCeeEeeeCHHHHHHHHHHh
Q 033584           33 AQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        33 a~~l~~~l~~~~~l~i~~k~g~~GklfGSVt~~dIa~~L~~~   74 (116)
                      .++.+..++.- .+..---+.++|+|-|.||-.||.+.+.++
T Consensus       215 qeevA~~~~~y-dl~a~PVVd~~~~LiG~itiDDiidvi~eE  255 (451)
T COG2239         215 QEEVARLFEKY-DLLAVPVVDEDNRLIGIITIDDIIDVIEEE  255 (451)
T ss_pred             HHHHHHHHHHh-CCeecceECCCCceeeeeeHHHHHHHHHHH
Confidence            34556666664 465556677889999999999999998865


No 74 
>PF05198 IF3_N:  Translation initiation factor IF-3, N-terminal domain;  InterPro: IPR019814 Initiation factor 3 (IF-3) (gene infC) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-3 is thought to function as a fidelity factor during the assembly of the ternary initiation complex which consist of the 30S ribosomal subunit, the initiator tRNA and the messenger RNA. IF-3 is a basic protein that binds to the 30S ribosomal subunit []. The chloroplast initiation factor IF-3(chl) is a protein that enhances the poly(A,U,G)-dependent binding of the initiator tRNA to chloroplast ribosomal 30s subunits in which the central section is evolutionary related to the sequence of bacterial IF-3 []. ; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1TIF_A.
Probab=26.49  E-value=95  Score=19.61  Aligned_cols=27  Identities=11%  Similarity=0.260  Sum_probs=18.4

Q ss_pred             cCCCCeeEeeeCHHHHHHHHHHhcCCce
Q 033584           52 GGKGKQIFGSVTAQDVVDIIKAQLQRDV   79 (116)
Q Consensus        52 ~g~~GklfGSVt~~dIa~~L~~~~g~~i   79 (116)
                      .+++|..-|.++..+-...-... |+++
T Consensus        18 I~~~g~~lGv~~~~eAl~~A~~~-~lDL   44 (76)
T PF05198_consen   18 IDEDGEQLGVMSLREALRLAKEK-GLDL   44 (76)
T ss_dssp             E-TTS-EEEEEEHHHHHHHHHHT-T-EE
T ss_pred             ECCCCcEeceEEHHHHHHHHHHc-CCcE
Confidence            38899999999999877766555 7653


No 75 
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=26.47  E-value=66  Score=19.88  Aligned_cols=20  Identities=15%  Similarity=0.361  Sum_probs=16.7

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.||..|+...+..
T Consensus        31 ~~~~~~G~v~~~dl~~~~~~   50 (112)
T cd04625          31 ERGELVGLLTFREVLQAMAQ   50 (112)
T ss_pred             eCCEEEEEEEHHHHHHHHHh
Confidence            35899999999999987753


No 76 
>PF13833 EF-hand_8:  EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A ....
Probab=26.44  E-value=41  Score=18.80  Aligned_cols=24  Identities=13%  Similarity=0.231  Sum_probs=18.6

Q ss_pred             eeeCHHHHHHHHHHhcCCc-eecccc
Q 033584           60 GSVTAQDVVDIIKAQLQRD-VDKKIV   84 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~-idkk~I   84 (116)
                      |.||..++..+|... |+. ++...+
T Consensus         3 G~i~~~~~~~~l~~~-g~~~~s~~e~   27 (54)
T PF13833_consen    3 GKITREEFRRALSKL-GIKDLSEEEV   27 (54)
T ss_dssp             SEEEHHHHHHHHHHT-TSSSSCHHHH
T ss_pred             CEECHHHHHHHHHHh-CCCCCCHHHH
Confidence            789999999999544 887 766554


No 77 
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism]
Probab=26.20  E-value=2.8e+02  Score=23.35  Aligned_cols=62  Identities=23%  Similarity=0.322  Sum_probs=43.1

Q ss_pred             HHHHHHHHHHHHHHHhhccCeEEEEEecCCCCeeE-e-----eeCHHHHHHHHHHhcCCceecccccccCc
Q 033584           25 EKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIF-G-----SVTAQDVVDIIKAQLQRDVDKKIVDLPEI   89 (116)
Q Consensus        25 ~~~~~~~~a~~l~~~l~~~~~l~i~~k~g~~Gklf-G-----SVt~~dIa~~L~~~~g~~idkk~I~l~~I   89 (116)
                      =+++-...|++|++.|.+.+ +.+-- .|.+..++ =     -+|-++....|.+. ||.++|..|-.++.
T Consensus       285 Ya~qVv~NAkaLAe~l~~~G-~~vvs-GgTdnHl~lVDl~~~~~~Gk~ae~~L~~~-~It~NKN~iP~D~~  352 (413)
T COG0112         285 YAKQVVKNAKALAEALKERG-FKVVS-GGTDNHLVLVDLRSKGLTGKKAEAALERA-GITVNKNAIPFDPE  352 (413)
T ss_pred             HHHHHHHHHHHHHHHHHHcC-CeEec-CCccceEEEEEcccCCCCHHHHHHHHHHc-CEeeccCCCCCCCC
Confidence            34567889999999999864 55544 33444443 1     26788888888776 99999998854433


No 78 
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in  the acetoin utilization proteins in bacteria. Acetoin is a product of fermentative metabolism in many prokaryotic and eukaryotic microorganisms.  They produce acetoin as an external carbon storage compound and then later reuse it as a carbon and energy source during their stationary phase and sporulation. In addition these CBS domains are associated with a downstream ACT domain, which is linked to a wide range of metabolic enzymes that are regulated by amino acid concentration. Pairs of ACT domains bind specifically to a particular amino acid leading to regulation of the linked enzyme. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The i
Probab=26.11  E-value=54  Score=20.41  Aligned_cols=16  Identities=19%  Similarity=0.412  Sum_probs=13.7

Q ss_pred             CCCeeEeeeCHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVD   69 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~   69 (116)
                      ++|++.|-||..||.+
T Consensus       106 ~~~~~~Gvvt~~di~~  121 (122)
T cd04585         106 DQGRLVGIITESDLFR  121 (122)
T ss_pred             CCCcEEEEEEHHHhhh
Confidence            4689999999999875


No 79 
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=25.87  E-value=1.7e+02  Score=18.19  Aligned_cols=17  Identities=29%  Similarity=0.464  Sum_probs=14.7

Q ss_pred             CCeeEeeeCHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDII   71 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L   71 (116)
                      +|++.|-||..|+...+
T Consensus        34 ~~~~~Givt~~Dl~~~~   50 (98)
T cd04618          34 KQQFVGMLTITDFILIL   50 (98)
T ss_pred             CCEEEEEEEHHHHhhhe
Confidence            57999999999998765


No 80 
>smart00089 PKD Repeats in polycystic kidney disease 1 (PKD1) and other proteins. Polycystic kidney disease 1 protein contains 14 repeats, present elsewhere such as in microbial collagenases.
Probab=25.87  E-value=1.3e+02  Score=17.89  Aligned_cols=25  Identities=24%  Similarity=0.426  Sum_probs=18.6

Q ss_pred             ccceeeEEEEEEecCCe---EEEEEEEE
Q 033584           89 IRETGEYIAQLKLHPEV---TARIRLNV  113 (116)
Q Consensus        89 Ik~lG~y~V~i~L~~~V---~a~i~v~V  113 (116)
                      ...-|.|.|.+.+..+.   ++.+.|.|
T Consensus        51 y~~~G~y~v~l~v~n~~g~~~~~~~i~v   78 (79)
T smart00089       51 YTKPGTYTVTLTVTNAVGSASATVTVVV   78 (79)
T ss_pred             eCCCcEEEEEEEEEcCCCcEEEEEEEEE
Confidence            67889999999988776   44555544


No 81 
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=25.85  E-value=1e+02  Score=19.22  Aligned_cols=17  Identities=12%  Similarity=0.444  Sum_probs=13.1

Q ss_pred             CCCCeeEeeeCHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVD   69 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~   69 (116)
                      .++|++.|-||..||..
T Consensus        94 d~~~~~~Giit~~di~~  110 (111)
T cd04603          94 DKEGKLVGTIYERELLR  110 (111)
T ss_pred             cCCCeEEEEEEhHHhhc
Confidence            34578999999998853


No 82 
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=25.79  E-value=72  Score=20.65  Aligned_cols=21  Identities=19%  Similarity=0.336  Sum_probs=17.4

Q ss_pred             CCCCeeEeeeCHHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~~   73 (116)
                      .++|++.|.|+..++...+..
T Consensus        31 d~~~~~~G~i~~~~l~~~~~~   51 (132)
T cd04636          31 DNEGRVVGIVSEGDLIRKIYK   51 (132)
T ss_pred             CCCCCEEEEEeHHHHHHHHhc
Confidence            346899999999999987754


No 83 
>PF03484 B5:  tRNA synthetase B5 domain;  InterPro: IPR005147 Domain B5 is found in phenylalanine-tRNA synthetase beta subunits. This domain has been shown to bind DNA through a winged helix-turn-helix motif []. Phenylalanine-tRNA synthetase may influence common cellular processes via DNA binding, in addition to its aminoacylation function.; GO: 0000287 magnesium ion binding, 0003723 RNA binding, 0005524 ATP binding, 0006432 phenylalanyl-tRNA aminoacylation; PDB: 2AKW_B 1B70_B 1B7Y_B 2ALY_B 2IY5_B 2AMC_B 3PCO_D 2CXI_C 1JJC_B 1EIY_B ....
Probab=25.78  E-value=72  Score=19.39  Aligned_cols=21  Identities=19%  Similarity=0.442  Sum_probs=13.8

Q ss_pred             eeCHHHHHHHHHHhcCCceecc
Q 033584           61 SVTAQDVVDIIKAQLQRDVDKK   82 (116)
Q Consensus        61 SVt~~dIa~~L~~~~g~~idkk   82 (116)
                      +++..++.+.|... |+.++..
T Consensus        18 ~i~~~~i~~~L~~l-g~~~~~~   38 (70)
T PF03484_consen   18 DISPEEIIKILKRL-GFKVEKI   38 (70)
T ss_dssp             ---HHHHHHHHHHT-T-EEEE-
T ss_pred             CCCHHHHHHHHHHC-CCEEEEC
Confidence            57888999998876 9988875


No 84 
>cd08518 PBP2_NikA_DppA_OppA_like_19 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=25.71  E-value=1.1e+02  Score=24.66  Aligned_cols=57  Identities=14%  Similarity=0.297  Sum_probs=38.7

Q ss_pred             eEEEEEecC---CCCeeEeeeCHHHHHHHHHHhcCCceecccc-cccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGG---KGKQIFGSVTAQDVVDIIKAQLQRDVDKKIV-DLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g---~~GklfGSVt~~dIa~~L~~~~g~~idkk~I-~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|..+-|   .||.   -||+.|++-.+....+........ .+..++.++.|+|.|+|..-
T Consensus        58 t~tf~LR~gv~fsDG~---p~TA~Dv~~s~~r~~~~~~~~~~~~~i~~v~~~d~~Tv~i~l~~p  118 (464)
T cd08518          58 TWTFTLRDDVKFSDGE---PLTAEDVAFTYNTAKDPGSASDILSNLEDVEAVDDYTVKFTLKKP  118 (464)
T ss_pred             EEEEEECCCCEecCCc---CCchHHhhehHHHhhCCCCCcccccceeEEEecCCCEEEEEEcCC
Confidence            689999987   3776   489999999887543322111101 12348889999999998753


No 85 
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=25.53  E-value=72  Score=20.06  Aligned_cols=20  Identities=15%  Similarity=0.336  Sum_probs=16.7

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.||..++...+..
T Consensus        32 ~~~~~~G~v~~~~l~~~~~~   51 (122)
T cd04803          32 EDGKLVGLLTQRDLLRAALS   51 (122)
T ss_pred             CCCCEEEEEEHHHHHHHhcc
Confidence            45899999999999887653


No 86 
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=25.23  E-value=1.8e+02  Score=18.84  Aligned_cols=31  Identities=23%  Similarity=0.554  Sum_probs=22.7

Q ss_pred             cccccC--ccceeeEEEEEEecCC--eEEEEEEEE
Q 033584           83 IVDLPE--IRETGEYIAQLKLHPE--VTARIRLNV  113 (116)
Q Consensus        83 ~I~l~~--Ik~lG~y~V~i~L~~~--V~a~i~v~V  113 (116)
                      .|.|.+  +..-|.|.+.|+-+|+  -++++.+.|
T Consensus        64 Si~i~nl~~~D~G~Y~C~v~t~P~g~~~~~~~L~V   98 (99)
T cd05886          64 TISLSRLELEDEGVYICEFATFPTGNRESQLNLTV   98 (99)
T ss_pred             eEEEcCCccccCEEEEEEEEeCCCCCeEEEEEEEE
Confidence            355554  7789999999999877  456666555


No 87 
>PF11548 Receptor_IA-2:  Protein-tyrosine phosphatase receptor IA-2;  InterPro: IPR021613  IA-2 is a protein-tyrosine phosphatase receptor that upon exocytosis, the cytoplasmic domain is cleaved and moves to the nucleus where it enhances transcription of the insulin gene. The mature exodomain of IA-2 participates in adhesion to the extracellular matrix and is self-proteolyzed in vitro by reactive oxygen species which may be a new shedding mechanism. ; PDB: 2QT7_B 3N01_B 3N4W_B 3NG8_A.
Probab=24.97  E-value=1.2e+02  Score=20.05  Aligned_cols=24  Identities=21%  Similarity=0.223  Sum_probs=14.5

Q ss_pred             eEEEEEecCCCCeeEeeeCHHHHHHHHHH
Q 033584           45 AFKVKRKGGKGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        45 ~l~i~~k~g~~GklfGSVt~~dIa~~L~~   73 (116)
                      .++|....++.+     +|+.|+++..-.
T Consensus        46 avTFrv~~N~~n-----~taadVa~~a~~   69 (91)
T PF11548_consen   46 AVTFRVRPNNKN-----LTAADVAKQAVD   69 (91)
T ss_dssp             EEEEEE---TT--------HHHHHHHHHH
T ss_pred             eEEEEeccCcCC-----CCHHHHHHHHHH
Confidence            588999888766     899999988643


No 88 
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=24.93  E-value=74  Score=20.10  Aligned_cols=19  Identities=21%  Similarity=0.468  Sum_probs=16.3

Q ss_pred             CCeeEeeeCHHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~~   73 (116)
                      +|++.|.|+..|+...+.+
T Consensus        34 ~~~~~G~v~~~dl~~~~~~   52 (125)
T cd04631          34 TGKLVGIITATDILKYLGG   52 (125)
T ss_pred             CCEEEEEEEHHHHHHHhhc
Confidence            3899999999999987754


No 89 
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=24.50  E-value=85  Score=19.95  Aligned_cols=18  Identities=11%  Similarity=0.409  Sum_probs=15.3

Q ss_pred             CeeEeeeCHHHHHHHHHH
Q 033584           56 KQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        56 GklfGSVt~~dIa~~L~~   73 (116)
                      |++.|.||..|+...+..
T Consensus        35 ~~~~Giv~~~dl~~~~~~   52 (123)
T cd04627          35 GEVIGILSQRRLVEFLWE   52 (123)
T ss_pred             CcEEEEEEHHHHHHHHHH
Confidence            789999999999887643


No 90 
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream.   The vitamin B6 complex comprises pyridoxine, pyridoxal, and pyridoxamine, as well as the 5'-phosphate esters of pyridoxal (PALP) and pyridoxamine, the last two being the biologically active coenzyme derivatives.  The members of the PALP family are principally involved in the biosynthesis of amino acids and amino acid-derived metabolites, but they are also found in the biosynthetic pathways of amino sugars and other amine-containing compounds.  CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a pote
Probab=24.49  E-value=77  Score=19.31  Aligned_cols=18  Identities=22%  Similarity=0.530  Sum_probs=15.9

Q ss_pred             CeeEeeeCHHHHHHHHHH
Q 033584           56 KQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        56 GklfGSVt~~dIa~~L~~   73 (116)
                      |++.|.||..|+...+..
T Consensus        33 ~~~~G~v~~~dl~~~~~~   50 (110)
T cd04609          33 GRVVGSIDESDLLDALIE   50 (110)
T ss_pred             CeeEEEEeHHHHHHHHhc
Confidence            799999999999998754


No 91 
>cd08503 PBP2_NikA_DppA_OppA_like_17 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=24.48  E-value=1.6e+02  Score=23.78  Aligned_cols=56  Identities=18%  Similarity=0.264  Sum_probs=37.6

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceecc---c-ccccCccceeeEEEEEEecC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDKK---I-VDLPEIRETGEYIAQLKLHP  103 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idkk---~-I~l~~Ik~lG~y~V~i~L~~  103 (116)
                      +++|..+-|-   ||.   -||+.|++..+..-.+-.....   . -.+..|+.++.|+|.|+|..
T Consensus        66 ~~tf~Lr~~~~wsdG~---pvTA~Dv~~s~~~~~~~~~~~~~~~~~~~i~~v~~~d~~tv~i~l~~  128 (460)
T cd08503          66 TWTFKLRKGVTFHDGK---PLTADDVVASLNRHRDPASGSPAKTGLLDVGAIEAVDDHTVRFTLKR  128 (460)
T ss_pred             EEEEEcCCCCCcCCCC---cCCHHHHHHHHHHhhCCcccCccchhhcccceeEecCCCeEEEEeCC
Confidence            6888887653   675   4999999999875433222111   1 12334888999999999953


No 92 
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain. These proteins are integral membrane proteins with four transmembrane spanning helices. The function of these proteins is uncertain, but they are thought to be transporters. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=23.71  E-value=75  Score=20.03  Aligned_cols=20  Identities=20%  Similarity=0.436  Sum_probs=16.5

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.||..++...+..
T Consensus        33 ~~~~~~Giv~~~~l~~~~~~   52 (124)
T cd04600          33 GDRRLVGIVTQRDLLRHARP   52 (124)
T ss_pred             CCCCEEEEEEHHHHHhhhcc
Confidence            35899999999999877654


No 93 
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=23.64  E-value=1.4e+02  Score=19.06  Aligned_cols=34  Identities=12%  Similarity=0.159  Sum_probs=20.2

Q ss_pred             HHHHHHhhccCeEE-EEEecCC-CCeeEeeeCHHHHHH
Q 033584           34 QQLALIFETVGAFK-VKRKGGK-GKQIFGSVTAQDVVD   69 (116)
Q Consensus        34 ~~l~~~l~~~~~l~-i~~k~g~-~GklfGSVt~~dIa~   69 (116)
                      .++.+.+..- .+. +.. ..+ +|++.|-||..||..
T Consensus        90 ~~~l~~m~~~-~~~~lpV-vd~~~~~~~G~it~~di~~  125 (126)
T cd04640          90 GDVVETLKAS-GRQHALV-VDREHHQIRGIISTSDIAR  125 (126)
T ss_pred             HHHHHHHHHC-CCceEEE-EECCCCEEEEEEeHHHHhh
Confidence            4455555443 232 222 233 379999999999864


No 94 
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated
Probab=23.50  E-value=29  Score=21.92  Aligned_cols=35  Identities=9%  Similarity=0.144  Sum_probs=25.8

Q ss_pred             EeeeCHHHHHHHHHHhcCCceecccccccCcccee
Q 033584           59 FGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETG   93 (116)
Q Consensus        59 fGSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG   93 (116)
                      .=|...-++.-+|...||+.|+-..+....+.++|
T Consensus        34 lDSl~~veli~~lE~~fgi~i~~~e~~~~~f~Tv~   68 (78)
T PRK05087         34 LDSMGTVELLVELENRFDIEVPVSEFDRDDWNTPN   68 (78)
T ss_pred             cchHHHHHHHHHHHHHhCCccChHhcCHHhhcCHH
Confidence            45677777888888999999987776654465554


No 95 
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=23.34  E-value=73  Score=29.16  Aligned_cols=38  Identities=24%  Similarity=0.357  Sum_probs=24.5

Q ss_pred             eEEEEEecCCCCeeEeeeCHHHHHHHHHHhcCCceecccccccCcc
Q 033584           45 AFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIR   90 (116)
Q Consensus        45 ~l~i~~k~g~~GklfGSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik   90 (116)
                      +.+++.-+.++|-+||+|+-.-=        |..-|++-|.|.+|+
T Consensus       783 katvKVsStenGvIfGnIvY~~~--------~~a~~~~~VvLndIh  820 (948)
T KOG1058|consen  783 KATVKVSSTENGVIFGNIVYDTS--------EAANDRNVVVLNDIH  820 (948)
T ss_pred             EEEEEEeeccCcEEEEEEEecCc--------cccccceEEEecccc
Confidence            56777888889999999974310        334455555555433


No 96 
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=23.28  E-value=86  Score=19.37  Aligned_cols=19  Identities=26%  Similarity=0.385  Sum_probs=15.6

Q ss_pred             CCCeeEeeeCHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~   72 (116)
                      ++|++.|.||..|+...+.
T Consensus        32 ~~~~~~G~v~~~dl~~~~~   50 (113)
T cd04615          32 DKKRLVGIITRYDVLSYAL   50 (113)
T ss_pred             CCCCEEEEEEHHHHHHhhh
Confidence            4689999999999987543


No 97 
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=23.28  E-value=84  Score=19.87  Aligned_cols=20  Identities=15%  Similarity=0.335  Sum_probs=16.7

Q ss_pred             CCCeeEeeeCHHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~   73 (116)
                      ++|++.|.||..|+...+..
T Consensus        32 ~~~~~~Givt~~dl~~~~~~   51 (118)
T cd04617          32 EDGDLVGVVSRKDLLKASIG   51 (118)
T ss_pred             CCCCEEEEEEHHHHHHHHHc
Confidence            45789999999999988753


No 98 
>cd08497 PBP2_NikA_DppA_OppA_like_14 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=23.19  E-value=1.7e+02  Score=24.05  Aligned_cols=56  Identities=13%  Similarity=0.110  Sum_probs=38.3

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCc-eecc-cc-cccCccceeeEEEEEEecC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRD-VDKK-IV-DLPEIRETGEYIAQLKLHP  103 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~-idkk-~I-~l~~Ik~lG~y~V~i~L~~  103 (116)
                      +++|..+-|-   ||..   +|+.|++-.+....+.. .... .. .+..+..+|.|+|.|+|..
T Consensus        77 t~tf~Lr~gv~fsDG~p---~tA~DV~~s~~~~~~~~~~~~~~~~~~i~~v~~~d~~tv~i~l~~  138 (491)
T cd08497          77 WVTFHLRPEARFSDGTP---VTAEDVVFSFETLKSKGPPYYRAYYADVEKVEALDDHTVRFTFKE  138 (491)
T ss_pred             EEEEEECCCCCcCCCCc---ccHhHhhhHHHHHhCCCCchhhhhhhceeEEEEECCCEEEEEECC
Confidence            6889998765   6764   99999999887443321 1111 11 1224888999999999987


No 99 
>PF00496 SBP_bac_5:  Bacterial extracellular solute-binding proteins, family 5 Middle;  InterPro: IPR000914 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. The latter are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into Gram-positive bacteria which are surrounded by a single membrane and therefore have no periplasmic region the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute throught the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped [] into eight families of clusters, which generally correlate with the nature of the solute bound. Family 5 currently includes periplasmic oligopeptide-binding proteins (oppA) of Gram-negative bacteria and homologous lipoproteins in Gram-positive bacteria (oppA, amiA or appA); periplasmic dipeptide-binding proteins of Escherichia coli (dppA) and Bacillus subtilis (dppE); periplasmic murein peptide-binding protein of E. coli (mppA); periplasmic peptide-binding proteins sapA of E. coli, Salmonella typhimurium and Haemophilus influenzae; periplasmic nickel-binding protein (nikA) of E. coli; haem-binding lipoprotein (hbpA or dppA) from H. influenzae; lipoprotein xP55 from Streptomyces lividans; and hypothetical proteins from H. influenzae (HI0213) and Rhizobium sp. (strain NGR234) symbiotic plasmid (y4tO and y4wM).; GO: 0005215 transporter activity, 0006810 transport; PDB: 1B51_A 1B0H_A 1QKA_A 1B9J_A 1B6H_A 1OLA_A 1B3L_C 1JEV_A 1B5H_A 1JET_A ....
Probab=22.92  E-value=1.1e+02  Score=23.44  Aligned_cols=57  Identities=18%  Similarity=0.293  Sum_probs=36.9

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceecccc-----cccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDKKIV-----DLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idkk~I-----~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|..+-|-   ||.   -||+.|+...+.......-....-     .+..+..++.|+|.|+|...
T Consensus        19 ~~tf~Lr~g~~wsDG~---~lTA~Dv~~s~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~tv~~~l~~p   83 (374)
T PF00496_consen   19 TYTFTLRDGLKWSDGE---PLTAEDVVFSFERLADPDYNSPWAYDFFDSIDSIEAPDDYTVVFTLKEP   83 (374)
T ss_dssp             EEEEEE-TT-B-TTST---B-SHHHHHHHHHHHHHCCGSTTTCHHHHHHEEEEEEEETTEEEEEESST
T ss_pred             EEEEEEeeeeeecCCC---cceeeEEeeeehhcccCCcccccccccccccccccccCCEEEEEEeecc
Confidence            6888888875   776   699999999876542222211111     12349999999999998753


No 100
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion]
Probab=22.91  E-value=46  Score=27.01  Aligned_cols=16  Identities=50%  Similarity=0.735  Sum_probs=13.7

Q ss_pred             CCCeeEeeeCHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDI   70 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~   70 (116)
                      +.++||| ||+-|++.+
T Consensus       166 dpkklfG-VTtLDvVRA  181 (345)
T KOG1494|consen  166 DPKKLFG-VTTLDVVRA  181 (345)
T ss_pred             Cccceec-eehhhhhhH
Confidence            4579999 999999876


No 101
>smart00874 B5 tRNA synthetase B5 domain. This domain is found in phenylalanine-tRNA synthetase beta subunits.
Probab=22.75  E-value=58  Score=19.47  Aligned_cols=24  Identities=21%  Similarity=0.530  Sum_probs=18.6

Q ss_pred             eeEe-eeCHHHHHHHHHHhcCCceec
Q 033584           57 QIFG-SVTAQDVVDIIKAQLQRDVDK   81 (116)
Q Consensus        57 klfG-SVt~~dIa~~L~~~~g~~idk   81 (116)
                      ++-| +++..++.+.|... |++++.
T Consensus        13 ~llG~~i~~~ei~~~L~~l-g~~~~~   37 (71)
T smart00874       13 RLLGLDLSAEEIEEILKRL-GFEVEV   37 (71)
T ss_pred             HHHCCCCCHHHHHHHHHHC-CCeEEe
Confidence            3444 78899999999887 998864


No 102
>PTZ00373 60S Acidic ribosomal protein P2; Provisional
Probab=22.63  E-value=48  Score=22.77  Aligned_cols=25  Identities=24%  Similarity=0.464  Sum_probs=21.1

Q ss_pred             eeCHHHHHHHHHHhcCCceecccccc
Q 033584           61 SVTAQDVVDIIKAQLQRDVDKKIVDL   86 (116)
Q Consensus        61 SVt~~dIa~~L~~~~g~~idkk~I~l   86 (116)
                      ++|..||-..|..- |+++|...+.+
T Consensus        19 ~pTaddI~kIL~Aa-GveVd~~~~~l   43 (112)
T PTZ00373         19 NPTKKEVKNVLSAV-NADVEDDVLDN   43 (112)
T ss_pred             CCCHHHHHHHHHHc-CCCccHHHHHH
Confidence            49999999999887 99999876653


No 103
>PRK05988 formate dehydrogenase subunit gamma; Validated
Probab=22.61  E-value=81  Score=22.57  Aligned_cols=19  Identities=11%  Similarity=0.324  Sum_probs=16.7

Q ss_pred             CCeeEeeeCHHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~~   73 (116)
                      ||.+||.+|+.++.+.|.+
T Consensus       135 n~~~~~~lt~~~~~~il~~  153 (156)
T PRK05988        135 DGEVHGRLDPQRLDALLAE  153 (156)
T ss_pred             CCEEeCCCCHHHHHHHHHH
Confidence            7899999999999888764


No 104
>PRK07081 acyl carrier protein; Provisional
Probab=22.43  E-value=25  Score=22.32  Aligned_cols=34  Identities=6%  Similarity=0.183  Sum_probs=25.3

Q ss_pred             EeeeCHHHHHHHHHHhcCCceecccccccCccce
Q 033584           59 FGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRET   92 (116)
Q Consensus        59 fGSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik~l   92 (116)
                      +=|+..-++.-.|...||+.|+-..+....++++
T Consensus        33 lDSl~~v~li~~lE~~f~I~i~~~~~~~~~~~tv   66 (83)
T PRK07081         33 LSSLATVQLMLAIEDAFDIEIPDEMLNRKLFASI   66 (83)
T ss_pred             CCHHHHHHHHHHHHHHhCCcCCHHHcCHHHhccH
Confidence            4688888889999999999998777653224443


No 105
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener
Probab=22.39  E-value=81  Score=20.20  Aligned_cols=20  Identities=15%  Similarity=0.459  Sum_probs=16.8

Q ss_pred             CCCCeeEeeeCHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~   72 (116)
                      .++|++.|.|+..|+...+.
T Consensus        31 d~~~~~~Giv~~~dl~~~~~   50 (126)
T cd04642          31 DEKGKLIGNISASDLKGLLL   50 (126)
T ss_pred             CCCCcEEEEEEHHHhhhhhc
Confidence            35689999999999988764


No 106
>PF13344 Hydrolase_6:  Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A ....
Probab=22.29  E-value=68  Score=20.85  Aligned_cols=27  Identities=15%  Similarity=0.110  Sum_probs=19.5

Q ss_pred             eeeCHHHHHHHHHHhcCCceeccccccc
Q 033584           60 GSVTAQDVVDIIKAQLQRDVDKKIVDLP   87 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~idkk~I~l~   87 (116)
                      ++-|..++++.|... |++++...|-.+
T Consensus        40 s~~s~~~~~~~L~~~-Gi~~~~~~i~ts   66 (101)
T PF13344_consen   40 SSRSREEYAKKLKKL-GIPVDEDEIITS   66 (101)
T ss_dssp             SSS-HHHHHHHHHHT-TTT--GGGEEEH
T ss_pred             CCCCHHHHHHHHHhc-CcCCCcCEEECh
Confidence            357889999999775 999999888654


No 107
>PRK00441 argR arginine repressor; Provisional
Probab=22.14  E-value=45  Score=23.73  Aligned_cols=36  Identities=19%  Similarity=0.186  Sum_probs=23.4

Q ss_pred             eeeCHHHHHHHHHHhcCCceecccccccCccceeeEEE
Q 033584           60 GSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIA   97 (116)
Q Consensus        60 GSVt~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG~y~V   97 (116)
                      |.+|..|+++.|++. |+.+.--.|.= +|+.+|...|
T Consensus        17 ~~~~q~eL~~~L~~~-G~~vSqaTisR-Dl~~L~lvKv   52 (149)
T PRK00441         17 EIETQEELAEELKKM-GFDVTQATVSR-DIKELKLIKV   52 (149)
T ss_pred             CCCcHHHHHHHHHhc-CCCcCHHHHHH-HHHHcCcEEe
Confidence            567888999999888 98887554431 2444444433


No 108
>PF04282 DUF438:  Family of unknown function (DUF438);  InterPro: IPR007380 This is a a group of uncharacterised proteins.
Probab=21.87  E-value=36  Score=21.49  Aligned_cols=23  Identities=17%  Similarity=0.411  Sum_probs=16.8

Q ss_pred             eeEeeeCHHHHHHH---HHHhcCCcee
Q 033584           57 QIFGSVTAQDVVDI---IKAQLQRDVD   80 (116)
Q Consensus        57 klfGSVt~~dIa~~---L~~~~g~~id   80 (116)
                      ++|++|++.+|+.+   |-+. |++++
T Consensus        24 ~~~~~Vs~~EI~~~Eq~Li~e-G~~~e   49 (71)
T PF04282_consen   24 KLFSDVSASEISAAEQELIQE-GMPVE   49 (71)
T ss_pred             HHHCCCCHHHHHHHHHHHHHc-CCCHH
Confidence            68999999999875   3344 75543


No 109
>PF10668 Phage_terminase:  Phage terminase small subunit;  InterPro: IPR018925  This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes. Packaging of double-stranded viral DNA concatemers requires interaction of the prohead with virus DNA. This process is mediated by a phage-encoded DNA recognition and terminase protein. The terminase enzymes described so far, which are hetero-oligomers composed of a small and a large subunit, do not have a significant level of sequence homology. The small terminase subunit is thought to form a nucleoprotein structure that helps to position the terminase large subunit at the packaging initiation site [].
Probab=21.85  E-value=58  Score=19.90  Aligned_cols=12  Identities=17%  Similarity=0.598  Sum_probs=10.6

Q ss_pred             eeeCHHHHHHHH
Q 033584           60 GSVTAQDVVDII   71 (116)
Q Consensus        60 GSVt~~dIa~~L   71 (116)
                      |.++.+|||+.|
T Consensus        21 g~i~lkdIA~~L   32 (60)
T PF10668_consen   21 GKIKLKDIAEKL   32 (60)
T ss_pred             CCccHHHHHHHH
Confidence            679999999987


No 110
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic genera
Probab=21.85  E-value=90  Score=20.68  Aligned_cols=21  Identities=14%  Similarity=0.077  Sum_probs=17.6

Q ss_pred             CCCCeeEeeeCHHHHHHHHHH
Q 033584           53 GKGKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        53 g~~GklfGSVt~~dIa~~L~~   73 (116)
                      .++|++.|.||..|+...+..
T Consensus        31 d~~~~~~Giv~~~dl~~~~~~   51 (135)
T cd04621          31 DDNGKPVGVITYRDLAFAEFE   51 (135)
T ss_pred             CCCCCEEEEEeHHHHHHHhhc
Confidence            357899999999999987753


No 111
>KOG2639 consensus Sodium sulfate symporter and related arsenite permeases [Inorganic ion transport and metabolism]
Probab=21.78  E-value=90  Score=27.55  Aligned_cols=33  Identities=18%  Similarity=0.080  Sum_probs=26.3

Q ss_pred             EecCCCCeeEeeeCHHHHHHHHHHhcCCceeccc
Q 033584           50 RKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKI   83 (116)
Q Consensus        50 ~k~g~~GklfGSVt~~dIa~~L~~~~g~~idkk~   83 (116)
                      .-.|.||-|+|| ++.-|+..+.+|||+.+.=.+
T Consensus       623 a~~gGNgTLiGa-sANvv~A~iAeqHGYkltF~~  655 (685)
T KOG2639|consen  623 ACLGGNGTLIGA-SANVVAAGIAEQHGYKLTFTQ  655 (685)
T ss_pred             hhhcCCceeech-hhHHHHHHHHHHcCceEEehh
Confidence            345779999996 677889999999999886443


No 112
>PF01316 Arg_repressor:  Arginine repressor, DNA binding domain;  InterPro: IPR020900 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes, an example of the latter being Giardia lamblia (Giardia intestinalis) []. The three-enzyme anaerobic pathway breaks down L-arginine to form 1 mol of ATP, carbon dioxide and ammonia. In simpler bacteria, the first enzyme, arginine deiminase, can account for up to 10% of total cell protein []. Most prokaryotic arginine deiminase pathways are under the control of a repressor gene, termed ArgR []. This is a negative regulator, and will only release the arginine deiminase operon for expression in the presence of arginine []. The crystal structure of apo-ArgR from Bacillus stearothermophilus has been determined to 2.5A by means of X-ray crystallography []. The protein exists as a hexamer of identical subunits, and is shown to have six DNA-binding domains, clustered around a central oligomeric core when bound to arginine. It predominantly interacts with A.T residues in ARG boxes. This hexameric protein binds DNA at its N terminus to repress arginine biosyntheis or activate arginine catabolism. Some species have several ArgR paralogs. In a neighbour-joining tree, some of these paralogous sequences show long branches and differ significantly from the well-conserved C-terminal region. ; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0006525 arginine metabolic process; PDB: 1AOY_A 3V4G_A 3LAJ_D 3FHZ_A 3LAP_B 3ERE_D 2P5L_C 1F9N_D 2P5K_A 1B4A_A ....
Probab=21.77  E-value=39  Score=21.15  Aligned_cols=34  Identities=12%  Similarity=0.398  Sum_probs=21.6

Q ss_pred             CHHHHHHHHHHhcCCceecccccccCccceeeEEEE
Q 033584           63 TAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQ   98 (116)
Q Consensus        63 t~~dIa~~L~~~~g~~idkk~I~l~~Ik~lG~y~V~   98 (116)
                      |-.|+++.|.+. |+.+.=..|.= +|+.+|...|+
T Consensus        21 sQ~eL~~~L~~~-Gi~vTQaTiSR-DLkeL~~vKv~   54 (70)
T PF01316_consen   21 SQEELVELLEEE-GIEVTQATISR-DLKELGAVKVP   54 (70)
T ss_dssp             SHHHHHHHHHHT-T-T--HHHHHH-HHHHHT-EEEE
T ss_pred             CHHHHHHHHHHc-CCCcchhHHHH-HHHHcCcEEee
Confidence            667899999887 98887554421 48888877765


No 113
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria.  The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generali
Probab=21.76  E-value=1.9e+02  Score=17.09  Aligned_cols=21  Identities=19%  Similarity=0.393  Sum_probs=17.5

Q ss_pred             CCCeeEeeeCHHHHHHHHHHh
Q 033584           54 KGKQIFGSVTAQDVVDIIKAQ   74 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~~~   74 (116)
                      ++|++.|.|+..|+...+...
T Consensus        32 ~~~~~~G~v~~~~l~~~~~~~   52 (113)
T cd02205          32 DDGRLVGIVTERDLLRALAEG   52 (113)
T ss_pred             CCCCEEEEEeHHHHHHHHHhc
Confidence            457999999999999887654


No 114
>cd08512 PBP2_NikA_DppA_OppA_like_7 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=21.72  E-value=1.8e+02  Score=23.44  Aligned_cols=57  Identities=19%  Similarity=0.271  Sum_probs=38.0

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceeccc------c-cccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDKKI------V-DLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idkk~------I-~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|..+-|-   ||..   ||+.|++-.+............      . .+..+..++.|+|.|+|..-
T Consensus        64 ~~tf~LR~~~~wsDG~p---~TA~Dv~~s~~~~~~~~~~~~~~~~~~~~~~i~~v~~~d~~tv~i~l~~p  130 (476)
T cd08512          64 TYTFHLRDGVKFHDGNP---VTAEDVKYSFERALKLNKGPAFILTQTSLNVPETIKAVDDYTVVFKLDKP  130 (476)
T ss_pred             EEEEEeCCCCEecCCCc---CCHHHhHhHHHHHhccCCCCcceeeccccccceeEEEcCCCeEEEEECCC
Confidence            6889888774   7764   8999999988643221111111      1 12247889999999999754


No 115
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains.  It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=21.60  E-value=57  Score=19.95  Aligned_cols=18  Identities=22%  Similarity=0.442  Sum_probs=14.6

Q ss_pred             cCCCCeeEeeeCHHHHHH
Q 033584           52 GGKGKQIFGSVTAQDVVD   69 (116)
Q Consensus        52 ~g~~GklfGSVt~~dIa~   69 (116)
                      ..++|++.|-||..+|..
T Consensus        89 v~~~g~~~Gvi~~~di~~  106 (107)
T cd04610          89 VDENNNLVGIITNTDVIR  106 (107)
T ss_pred             ECCCCeEEEEEEHHHhhc
Confidence            445689999999999864


No 116
>PRK05395 3-dehydroquinate dehydratase; Provisional
Probab=21.56  E-value=82  Score=22.69  Aligned_cols=27  Identities=22%  Similarity=0.427  Sum_probs=20.6

Q ss_pred             eeEeeeCHHHHHHHHHH---hcCCceeccc
Q 033584           57 QIFGSVTAQDVVDIIKA---QLQRDVDKKI   83 (116)
Q Consensus        57 klfGSVt~~dIa~~L~~---~~g~~idkk~   83 (116)
                      .+||+.|-.||.+.+.+   ..|++++=++
T Consensus        21 ~iYG~~tl~~i~~~~~~~a~~~g~~v~~~Q   50 (146)
T PRK05395         21 EIYGSTTLADIEALLEEEAAELGVELEFFQ   50 (146)
T ss_pred             CcCCCCCHHHHHHHHHHHHHHcCCEEEEEe
Confidence            58999999999998875   3477766443


No 117
>PF04552 Sigma54_DBD:  Sigma-54, DNA binding domain;  InterPro: IPR007634 This DNA-binding domain is based on peptide fragmentation data. This domain is proximal to DNA in the promoter/holoenzyme complex. Furthermore, this region contains a putative helix-turn-helix motif. At the C terminus, there is a highly conserved region known as the RpoN box and is the signature of the sigma-54 proteins [].; PDB: 2AHQ_A 2O9L_A 2O8K_A.
Probab=21.56  E-value=39  Score=24.44  Aligned_cols=22  Identities=14%  Similarity=0.511  Sum_probs=14.7

Q ss_pred             eCHHHHHHHHHHhcCCceecccc
Q 033584           62 VTAQDVVDIIKAQLQRDVDKKIV   84 (116)
Q Consensus        62 Vt~~dIa~~L~~~~g~~idkk~I   84 (116)
                      .|-.+|++.|.++ |+.|.||.|
T Consensus       122 lSD~~i~~~L~~~-gi~isRRTV  143 (160)
T PF04552_consen  122 LSDQEIAELLKEE-GIKISRRTV  143 (160)
T ss_dssp             --HHHHHHHHTTT-TS---HHHH
T ss_pred             CCHHHHHHHHHHc-CCCccHHHH
Confidence            5778899999888 999999876


No 118
>PF01835 A2M_N:  MG2 domain;  InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white. A2M-like proteins are able to inhibit all four classes of proteinases by a 'trapping' mechanism. They have a peptide stretch, called the 'bait region', which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein, thus trapping the proteinase. The entrapped enzyme remains active against low molecular weight substrates, whilst its activity toward larger substrates is greatly reduced, due to steric hindrance. Following cleavage in the bait region, a thiol ester bond, formed between the side chains of a cysteine and a glutamine, is cleaved and mediates the covalent binding of the A2M-like protein to the proteinase. This family includes the N-terminal region of the alpha-2-macroglobulin family. The inhibitor domains belong to MEROPS inhibitor family I39.; GO: 0004866 endopeptidase inhibitor activity; PDB: 2B39_B 3KLS_B 3PRX_C 3KM9_B 3PVM_C 3CU7_A 4E0S_A 4A5W_A 4ACQ_C 2P9R_B ....
Probab=21.47  E-value=2.2e+02  Score=17.80  Aligned_cols=31  Identities=19%  Similarity=0.267  Sum_probs=18.2

Q ss_pred             cccccCccceeeEEEEEEec--CCeEEEEEEEE
Q 033584           83 IVDLPEIRETGEYIAQLKLH--PEVTARIRLNV  113 (116)
Q Consensus        83 ~I~l~~Ik~lG~y~V~i~L~--~~V~a~i~v~V  113 (116)
                      .+.||+--.+|.|.|.+...  .+..+.-.+.|
T Consensus        67 ~~~lp~~~~~G~y~i~~~~~~~~~~~~~~~F~V   99 (99)
T PF01835_consen   67 SFQLPDDAPLGTYTIRVKTDDDGGQSFSKTFQV   99 (99)
T ss_dssp             EEE--SS---EEEEEEEEETTTTCEEEEEEEEE
T ss_pred             EEECCCCCCCEeEEEEEEEccCCCCEEEEEEEC
Confidence            36777777899999999993  55555555544


No 119
>cd08489 PBP2_NikA The substrate-binding component of an ABC-type nickel import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel transport system, which functions in the import of nickel and in the control of chemotactic response away from nickel. The ATP-binding cassette (ABC) type nickel transport system is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, the initial nickel receptor. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides,
Probab=21.33  E-value=2.1e+02  Score=23.24  Aligned_cols=58  Identities=17%  Similarity=0.283  Sum_probs=38.5

Q ss_pred             eEEEEEecC---CCCeeEeeeCHHHHHHHHHHhcCCc-eec--ccc-cccCccceeeEEEEEEecCCe
Q 033584           45 AFKVKRKGG---KGKQIFGSVTAQDVVDIIKAQLQRD-VDK--KIV-DLPEIRETGEYIAQLKLHPEV  105 (116)
Q Consensus        45 ~l~i~~k~g---~~GklfGSVt~~dIa~~L~~~~g~~-idk--k~I-~l~~Ik~lG~y~V~i~L~~~V  105 (116)
                      +++|..+-|   .||..   ||+.|++-.+....... -..  ... .+..++.+|.|+|.++|....
T Consensus        57 t~tf~Lr~~~~fsdG~p---vTA~Dv~~s~~r~~~~~~~~~~~~~~~~i~~v~~~d~~tv~~~l~~p~  121 (488)
T cd08489          57 TYTFHLRKGVKFSDGTP---FNAEAVKKNFDAVLANRDRHSWLELVNKIDSVEVVDEYTVRLHLKEPY  121 (488)
T ss_pred             EEEEEeCCCCCccCCCc---CCHHHHHHHHHHHhccCCCCchhhcccceeeEEEccCCEEEEEECCCC
Confidence            688998876   47765   89999999986432211 000  001 123488999999999998753


No 120
>cd05833 Ribosomal_P2 Ribosomal protein P2. This subfamily represents the eukaryotic large ribosomal protein P2. Eukaryotic P1 and P2 are functionally equivalent to the bacterial protein L7/L12, but are not homologous to L7/L12. P2 is located in the L12 stalk, with proteins P1, P0, L11, and 28S rRNA. P1 and P2 are the only proteins in the ribosome to occur as multimers, always appearing as sets of heterodimers. Recent data indicate that eukaryotes have four copies (two heterodimers), while most archaeal species contain six copies of L12p (three homodimers). Bacteria may have four or six copies of L7/L12 (two or three homodimers) depending on the species. Experiments using S. cerevisiae P1 and P2 indicate that P1 proteins are positioned more internally with limited reactivity in the C-terminal domains, while P2 proteins seem to be more externally located and are more likely to interact with other cellular components. In lower eukaryotes, P1 and P2 are further subdivided into P1A, P1B, P2
Probab=21.15  E-value=54  Score=22.31  Aligned_cols=25  Identities=28%  Similarity=0.343  Sum_probs=21.1

Q ss_pred             eeCHHHHHHHHHHhcCCceecccccc
Q 033584           61 SVTAQDVVDIIKAQLQRDVDKKIVDL   86 (116)
Q Consensus        61 SVt~~dIa~~L~~~~g~~idkk~I~l   86 (116)
                      ++|..||...|+.- |+++|...+.+
T Consensus        17 ~pTa~dI~~IL~Aa-GveVe~~~~~l   41 (109)
T cd05833          17 SPSAADVKKILGSV-GVEVDDEKLNK   41 (109)
T ss_pred             CCCHHHHHHHHHHc-CCCccHHHHHH
Confidence            69999999999887 99999876543


No 121
>PRK07539 NADH dehydrogenase subunit E; Validated
Probab=21.06  E-value=90  Score=22.06  Aligned_cols=19  Identities=5%  Similarity=0.384  Sum_probs=16.3

Q ss_pred             CCeeEeeeCHHHHHHHHHH
Q 033584           55 GKQIFGSVTAQDVVDIIKA   73 (116)
Q Consensus        55 ~GklfGSVt~~dIa~~L~~   73 (116)
                      +|.+||.||+.++.+.|.+
T Consensus       134 ~~~~y~~vt~e~v~~il~~  152 (154)
T PRK07539        134 NDDTYEDLTPEKIDELLDE  152 (154)
T ss_pred             CCEEeCCCCHHHHHHHHHh
Confidence            6789999999999887754


No 122
>TIGR02294 nickel_nikA nickel ABC transporter, periplasmic nickel-binding protein. Members of this family are periplasmic nickel-binding proteins of nickel ABC transporters. Nickel is bound specifically, albeit weakly, through water molecules positioned in the binding site. The amino acids whose side chains line the binding site include Tyr-44, Met-49, Trp-122, Arg-159, Trp-420, and Tyr-424 (numbering based on the precursor sequence of E. coli NikA) with the Arg contributing a hydrogen bond indirectly through a water molecule. Sequences that exactly (or mostly) have the same binding site residues score above the trusted (or noise) cutoffs to this model. Most appear to be lipoproteins.
Probab=20.94  E-value=2.2e+02  Score=23.37  Aligned_cols=57  Identities=18%  Similarity=0.249  Sum_probs=37.8

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceecc---cc-cccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDKK---IV-DLPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idkk---~I-~l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|..+-|-   ||..   ||+.|++..+.....-.-...   .. .+..++.++.|+|.|+|..-
T Consensus        64 t~tf~LR~~~kfsDG~p---vTA~Dv~~s~~~~~~~~~~~~~~~~~~~i~~v~~~d~~Tv~i~l~~p  127 (500)
T TIGR02294        64 TYTFKLRDDVKFSDGTP---FDAEAVKKNFDAVLQNSQRHSWLELSNQLDNVKALDKYTFELVLKEA  127 (500)
T ss_pred             EEEEEECCCCCcCCCCC---CCHHHHHHHHHHHhcCCcccchhhccccceeEEecCCCEEEEEECCC
Confidence            6889988764   7765   999999998874322110001   01 12248889999999998764


No 123
>cd08492 PBP2_NikA_DppA_OppA_like_15 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=20.81  E-value=2.6e+02  Score=22.55  Aligned_cols=57  Identities=9%  Similarity=0.177  Sum_probs=37.9

Q ss_pred             eEEEEEecCC---CCeeEeeeCHHHHHHHHHHhcCCceec----cccc-ccCccceeeEEEEEEecCC
Q 033584           45 AFKVKRKGGK---GKQIFGSVTAQDVVDIIKAQLQRDVDK----KIVD-LPEIRETGEYIAQLKLHPE  104 (116)
Q Consensus        45 ~l~i~~k~g~---~GklfGSVt~~dIa~~L~~~~g~~idk----k~I~-l~~Ik~lG~y~V~i~L~~~  104 (116)
                      +++|+.+-|-   ||.   -||+.|++-.+..........    .... +..|..++.|+|.|+|...
T Consensus        61 ~~tf~Lr~~~~wsdG~---pvTA~Dv~~s~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~tv~i~l~~p  125 (484)
T cd08492          61 TYTFHLRDGVTFSDGT---PLDAEAVKANFDRILDGSTKSGLAASYLGPYKSTEVVDPYTVKVHFSEP  125 (484)
T ss_pred             EEEEEeCCCCEecCCC---CCCHHHHHHHHHHhcCCCcCCCccccccccceeEEeccCCEEEEEECCC
Confidence            6888888773   675   499999999987542211111    0111 1238889999999999753


No 124
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC.  SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A ), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus).  SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB.  It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. EriC is involved in inorganic ion transport and metabolism. CBS is a small domain originally identified in cystathionine beta-synthase a
Probab=20.78  E-value=1.1e+02  Score=18.75  Aligned_cols=19  Identities=21%  Similarity=0.445  Sum_probs=15.9

Q ss_pred             CCCeeEeeeCHHHHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~~L~   72 (116)
                      ++|++.|.|+..|+...+.
T Consensus        32 ~~~~~~G~v~~~~l~~~~~   50 (114)
T cd04613          32 DDGRLVGIVSLDDIREILF   50 (114)
T ss_pred             CCCCEEEEEEHHHHHHHHh
Confidence            4579999999999987664


No 125
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown.
Probab=20.52  E-value=1e+02  Score=18.97  Aligned_cols=17  Identities=18%  Similarity=0.497  Sum_probs=14.6

Q ss_pred             CeeEeeeCHHHHHHHHH
Q 033584           56 KQIFGSVTAQDVVDIIK   72 (116)
Q Consensus        56 GklfGSVt~~dIa~~L~   72 (116)
                      |++.|.|+..|+...+.
T Consensus        34 ~~~~G~v~~~dl~~~~~   50 (110)
T cd04595          34 GRVVGIISRRDVEKALR   50 (110)
T ss_pred             CEEEEEEEHHHHHHHHh
Confidence            79999999999987653


No 126
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain.  Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model.  The interface between the two CBS domains forms a cleft that is a potential ligand binding site.
Probab=20.51  E-value=1.5e+02  Score=18.03  Aligned_cols=16  Identities=19%  Similarity=0.349  Sum_probs=12.7

Q ss_pred             CCCeeEeeeCHHHHHH
Q 033584           54 KGKQIFGSVTAQDVVD   69 (116)
Q Consensus        54 ~~GklfGSVt~~dIa~   69 (116)
                      ++|++.|.||..|+..
T Consensus        94 ~~~~~~G~i~~~dl~~  109 (110)
T cd04588          94 DEGRPVGIITRTDILR  109 (110)
T ss_pred             CCCCEEEEEEhHHhhc
Confidence            4578999999988753


No 127
>TIGR01088 aroQ 3-dehydroquinate dehydratase, type II. This model specifies the type II enzyme. The type I enzyme, often found as part of a multifunctional protein, is described by TIGR01093.
Probab=20.29  E-value=79  Score=22.64  Aligned_cols=27  Identities=26%  Similarity=0.470  Sum_probs=20.7

Q ss_pred             eeEeeeCHHHHHHHHHHh---cCCceeccc
Q 033584           57 QIFGSVTAQDVVDIIKAQ---LQRDVDKKI   83 (116)
Q Consensus        57 klfGSVt~~dIa~~L~~~---~g~~idkk~   83 (116)
                      .+||+.|-.||.+.+.+.   .|++++=++
T Consensus        19 ~iYG~~tl~di~~~~~~~a~~~g~~v~~~Q   48 (141)
T TIGR01088        19 GVYGSQTLEEIVEIIETFAAQLNVELEFFQ   48 (141)
T ss_pred             CcCCCCCHHHHHHHHHHHHHHcCCEEEEEe
Confidence            589999999999988864   367776443


No 128
>cd00466 DHQase_II Dehydroquinase (DHQase), type II. Dehydroquinase (or 3-dehydroquinate dehydratase) catalyzes the reversible dehydration of 3-dehydroquinate to form 3-dehydroshikimate. This reaction is part of two metabolic pathways: the biosynthetic shikimate pathway and the catabolic quinate pathway. There are two types of DHQases, which are distinct from each other in amino acid sequence and three-dimensional structure. Type I enzymes usually catalyze the biosynthetic reaction using a syn elimination mechanism. In contrast, type II enzymes, found in the quinate pathway of fungi and in the shikimate pathway of many bacteria, are dodecameric enzymes that employ an anti elimination reaction mechanism.
Probab=20.26  E-value=80  Score=22.58  Aligned_cols=27  Identities=22%  Similarity=0.416  Sum_probs=21.1

Q ss_pred             eeEeeeCHHHHHHHHHHh---cCCceeccc
Q 033584           57 QIFGSVTAQDVVDIIKAQ---LQRDVDKKI   83 (116)
Q Consensus        57 klfGSVt~~dIa~~L~~~---~g~~idkk~   83 (116)
                      .+||+.|-.||.+.+.+.   .|++++=++
T Consensus        19 ~iYG~~tl~~i~~~l~~~a~~~g~~v~~~Q   48 (140)
T cd00466          19 EIYGTTTLADIEALLRELAAELGVEVEFFQ   48 (140)
T ss_pred             CcCCcCCHHHHHHHHHHHHHHcCCEEEEEe
Confidence            699999999999988863   377776444


Done!