BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033604
         (115 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent
           Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In
           Complex With Sto-609
          Length = 298

 Score = 28.9 bits (63), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 40/97 (41%), Gaps = 19/97 (19%)

Query: 7   RGNSNPAATLAALVSKRSRF--QDELRNIENQVYEL--------------ETSYLQDIGQ 50
           +G      TL  L   ++RF  QD ++ IE   Y+               E  +++ I  
Sbjct: 122 QGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIK-IAD 180

Query: 51  FG--NAFKGFEGFLSSGKNTSNFKRPRKLQPEDRIFS 85
           FG  N FKG +  LS+   T  F  P  L    +IFS
Sbjct: 181 FGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFS 217


>pdb|1S72|L Chain L, Refined Crystal Structure Of The Haloarcula Marismortui
           Large Ribosomal Subunit At 2.4 Angstrom Resolution
 pdb|1YHQ|L Chain L, Crystal Structure Of Azithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YI2|L Chain L, Crystal Structure Of Erythromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIJ|L Chain L, Crystal Structure Of Telithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIT|L Chain L, Crystal Structure Of Virginiamycin M And S Bound To The
           50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJ9|L Chain L, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of
           Haloarcula Marismortui Containing A Three Residue
           Deletion In L22
 pdb|1YJN|L Chain L, Crystal Structure Of Clindamycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJW|L Chain L, Crystal Structure Of Quinupristin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ4|L Chain L, The Structure Of The Transition State Analogue "daa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ5|L Chain L, The Structure Of The Transition State Analogue "raa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ6|L Chain L, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ7|L Chain L, The Structure Of The Transition State Analogue "dca" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ8|L Chain L, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQ9|L Chain L, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQK|L Chain L, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of
           The Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQL|L Chain L, The Structure Of The Transition State Analogue "dcsn"
           Bound To The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1VQM|L Chain L, The Structure Of The Transition State Analogue "dan" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQN|L Chain L, The Structure Of Cc-hpmn And Cca-phe-cap-bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQO|L Chain L, The Structure Of Ccpmn Bound To The Large Ribosomal
           Subunit Haloarcula Marismortui
 pdb|1VQP|L Chain L, The Structure Of The Transition State Analogue "rap" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2OTJ|L Chain L, 13-Deoxytedanolide Bound To The Large Subunit Of
           Haloarcula Marismortui
 pdb|2OTL|L Chain L, Girodazole Bound To The Large Subunit Of Haloarcula
           Marismortui
 pdb|2QA4|L Chain L, A More Complete Structure Of The The L7L12 STALK OF THE
           Haloarcula Marismortui 50s Large Ribosomal Subunit
 pdb|3CC2|L Chain L, The Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution With Rrna Sequence For The 23s Rrna And
           Genome-Derived Sequences For R-Proteins
 pdb|3CC4|L Chain L, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|3CC7|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2487u
 pdb|3CCE|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535a
 pdb|3CCJ|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2534u
 pdb|3CCL|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535c. Density For Anisomycin Is
           Visible But Not Included In Model.
 pdb|3CCM|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2611u
 pdb|3CCQ|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488u
 pdb|3CCR|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488c. Density For Anisomycin Is
           Visible But Not Included In The Model.
 pdb|3CCS|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482a
 pdb|3CCU|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482c
 pdb|3CCV|L Chain L, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2616a
 pdb|3CD6|L Chain L, Co-cystal Of Large Ribosomal Subunit Mutant G2616a With
           Cc-puromycin
 pdb|3CPW|K Chain K, The Structure Of The Antibiotic Linezolid Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CMA|L Chain L, The Structure Of Cca And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CME|L Chain L, The Structure Of Ca And Cca-Phe-Cap-Bio Bound To The Large
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2QEX|L Chain L, Negamycin Binds To The Wall Of The Nascent Chain Exit
           Tunnel Of The 50s Ribosomal Subunit
 pdb|3G4S|L Chain L, Co-Crystal Structure Of Tiamulin Bound To The Large
           Ribosomal Subunit
 pdb|3G6E|L Chain L, Co-Crystal Structure Of Homoharringtonine Bound To The
           Large Ribosomal Subunit
 pdb|3G71|L Chain L, Co-crystal Structure Of Bruceantin Bound To The Large
           Ribosomal Subunit
 pdb|3I55|L Chain L, Co-Crystal Structure Of Mycalamide A Bound To The Large
           Ribosomal Subunit
 pdb|3I56|L Chain L, Co-Crystal Structure Of Triacetyloleandomcyin Bound To The
           Large Ribosomal Subunit
 pdb|4ADX|L Chain L, The Cryo-Em Structure Of The Archaeal 50s Ribosomal
           Subunit In Complex With Initiation Factor 6
          Length = 165

 Score = 28.9 bits (63), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%)

Query: 69  SNFKRPRKLQPEDRIFSLSSVTSPAVCTKLLSDDYLPWNVGSFSNDV 115
           S FKRP+K+Q E     +  +      T L +DD      G F  DV
Sbjct: 50  SGFKRPQKVQEEAATIDVREIDEN--VTLLAADDVAEVEDGGFRVDV 94


>pdb|1FFK|J Chain J, Crystal Structure Of The Large Ribosomal Subunit From
           Haloarcula Marismortui At 2.4 Angstrom Resolution
 pdb|1GIY|O Chain O, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1giy, Contains The 50s Ribosome Subunit. The
           30s Ribosome Subunit, Three Trna, And Mrna Molecules Are
           In The File 1gix
 pdb|1JJ2|K Chain K, Fully Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution
 pdb|1KQS|K Chain K, The Haloarcula Marismortui 50s Complexed With A
           Pretranslocational Intermediate In Protein Synthesis
 pdb|1K8A|M Chain M, Co-Crystal Structure Of Carbomycin A Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1K9M|M Chain M, Co-Crystal Structure Of Tylosin Bound To The 50s Ribosomal
           Subunit Of Haloarcula Marismortui
 pdb|1KD1|M Chain M, Co-crystal Structure Of Spiramycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M1K|M Chain M, Co-Crystal Structure Of Azithromycin Bound To The 50s
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1M90|M Chain M, Co-Crystal Structure Of Cca-Phe-Caproic Acid-Biotin And
           Sparsomycin Bound To The 50s Ribosomal Subunit
 pdb|1ML5|OO Chain o, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 pdb|1K73|M Chain M, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|1KC8|M Chain M, Co-Crystal Structure Of Blasticidin S Bound To The 50s
           Ribosomal Subunit
 pdb|1N8R|M Chain M, Structure Of Large Ribosomal Subunit In Complex With
           Virginiamycin M
 pdb|1NJI|M Chain M, Structure Of Chloramphenicol Bound To The 50s Ribosomal
           Subunit
 pdb|1Q7Y|M Chain M, Crystal Structure Of Ccdap-puromycin Bound At The Peptidyl
           Transferase Center Of The 50s Ribosomal Subunit
 pdb|1Q81|M Chain M, Crystal Structure Of Minihelix With 3' Puromycin Bound To
           A- Site Of The 50s Ribosomal Subunit.
 pdb|1Q82|M Chain M, Crystal Structure Of Cc-Puromycin Bound To The A-Site Of
           The 50s Ribosomal Subunit
 pdb|1Q86|M Chain M, Crystal Structure Of Cca-Phe-Cap-Biotin Bound
           Simultaneously At Half Occupancy To Both The A-Site And
           P- Site Of The The 50s Ribosomal Subunit.
 pdb|1QVF|K Chain K, Structure Of A Deacylated Trna Minihelix Bound To The E
           Site Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1QVG|K Chain K, Structure Of Cca Oligonucleotide Bound To The Trna Binding
           Sites Of The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1W2B|K Chain K, Trigger Factor Ribosome Binding Domain In Complex With 50s
 pdb|1YL3|O Chain O, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. Large Subunit. The Coordinates For The Small
           Subunit Are In The Pdb Entry 1yl4.
 pdb|2B66|P Chain P, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf1, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400
 pdb|2B9N|P Chain P, 50s Ribosomal Subunit From A Crystal Structure Of Release
           Factor Rf2, Trnas And Mrna Bound To The Ribosome. This
           File Contains The 50s Subunit From A Crystal Structure
           Of Release Factor Rf1, Trnas And Mrna Bound To The
           Ribosome And Is Described In Remark 400.
 pdb|2B9P|P Chain P, 50s Ribosomal Subunit From A Crystal Structure Of The
           Ribosome In Complex With Trnas And Mrna With A Stop
           Codon In The A-Site. This File Contains The 50s Subunit
           From A Crystal Structure Of The Ribosome In Complex With
           Trnas And Mrna With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 pdb|3CXC|K Chain K, The Structure Of An Enhanced Oxazolidinone Inhibitor Bound
           To The 50s Ribosomal Subunit Of H. Marismortui
          Length = 164

 Score = 28.5 bits (62), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%)

Query: 69  SNFKRPRKLQPEDRIFSLSSVTSPAVCTKLLSDDYLPWNVGSFSNDV 115
           S FKRP+K+Q E     +  +      T L +DD      G F  DV
Sbjct: 49  SGFKRPQKVQEEAATIDVREIDEN--VTLLAADDVAEVEDGGFRVDV 93


>pdb|3OW2|K Chain K, Crystal Structure Of Enhanced Macrolide Bound To 50s
           Ribosomal Subunit
          Length = 150

 Score = 28.5 bits (62), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 2/47 (4%)

Query: 69  SNFKRPRKLQPEDRIFSLSSVTSPAVCTKLLSDDYLPWNVGSFSNDV 115
           S FKRP+K+Q E     +  +      T L +DD      G F  DV
Sbjct: 49  SGFKRPQKVQEEAATIDVREIDEN--VTLLAADDVAEVEDGGFRVDV 93


>pdb|1L8D|A Chain A, Rad50 Coiled-Coil Zn Hook
 pdb|1L8D|B Chain B, Rad50 Coiled-Coil Zn Hook
          Length = 112

 Score = 25.8 bits (55), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 19/31 (61%)

Query: 10  SNPAATLAALVSKRSRFQDELRNIENQVYEL 40
           +N   TLA L+ ++S  + ELR I+ ++  L
Sbjct: 74  NNSKNTLAKLIDRKSELERELRRIDMEIKRL 104


>pdb|1Y1E|X Chain X, Human Formylglycine Generating Enzyme
 pdb|1Y1H|X Chain X, Human Formylglycine Generating Enzyme, Oxidised Cys
          Refined As Hydroperoxide
 pdb|1Y1I|X Chain X, Hyuman Formylglycine Generating Enzyme, Reduced Form
          Length = 311

 Score = 25.8 bits (55), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 29 ELRNIENQVYELETSYLQDIGQFGNAFKGFEGFLS 63
          E+ N E + +   T YL +  +FG++F  FEG LS
Sbjct: 58 EVSNTEFEKFVNSTGYLTEAEKFGDSFV-FEGMLS 91


>pdb|1Y1F|X Chain X, Human Formylglycine Generating Enzyme With Cysteine
          Sulfenic Acid
 pdb|1Y1J|X Chain X, Human Formylglycine Generating Enzyme, Sulfonic
          AcidDESULFURATED FORM
          Length = 311

 Score = 25.8 bits (55), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 29 ELRNIENQVYELETSYLQDIGQFGNAFKGFEGFLS 63
          E+ N E + +   T YL +  +FG++F  FEG LS
Sbjct: 58 EVSNTEFEKFVNSTGYLTEAEKFGDSFV-FEGMLS 91


>pdb|1Y1G|X Chain X, Human Formylglycine Generating Enzyme, Double Sulfonic
          Acid Form
 pdb|1Z70|X Chain X, 1.15a Resolution Structure Of The Formylglycine
          Generating Enzyme Fge
          Length = 311

 Score = 25.8 bits (55), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 29 ELRNIENQVYELETSYLQDIGQFGNAFKGFEGFLS 63
          E+ N E + +   T YL +  +FG++F  FEG LS
Sbjct: 58 EVSNTEFEKFVNSTGYLTEAEKFGDSFV-FEGMLS 91


>pdb|2AFT|X Chain X, Formylglycine Generating Enzyme C336s Mutant
 pdb|2AIJ|X Chain X, Formylglycine Generating Enzyme C336s Mutant Covalently
          Bound To Substrate Peptide Ctpsr
 pdb|2AIK|X Chain X, Formylglycine Generating Enzyme C336s Mutant Covalently
          Bound To Substrate Peptide Lctpsra
 pdb|2HI8|X Chain X, Human Formylglycine Generating Enzyme, C336s Mutant,
          Bromide Co- Crystallization
 pdb|2HIB|X Chain X, Human Formylglycine Generating Enzyme, C336s Mutant,
          Iodide Co- Crystallization
          Length = 286

 Score = 25.8 bits (55), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 29 ELRNIENQVYELETSYLQDIGQFGNAFKGFEGFLS 63
          E+ N E + +   T YL +  +FG++F  FEG LS
Sbjct: 45 EVSNTEFEKFVNSTGYLTEAEKFGDSFV-FEGMLS 78


>pdb|2AII|X Chain X, Wild-Type Formylglycine Generating Enzyme Reacted With
          Iodoacetamide
          Length = 286

 Score = 25.8 bits (55), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 29 ELRNIENQVYELETSYLQDIGQFGNAFKGFEGFLS 63
          E+ N E + +   T YL +  +FG++F  FEG LS
Sbjct: 45 EVSNTEFEKFVNSTGYLTEAEKFGDSFV-FEGMLS 78


>pdb|2AFY|X Chain X, Formylglycine Generating Enzyme C341s Mutant
          Length = 286

 Score = 25.4 bits (54), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 29 ELRNIENQVYELETSYLQDIGQFGNAFKGFEGFLS 63
          E+ N E + +   T YL +  +FG++F  FEG LS
Sbjct: 45 EVSNTEFEKFVNSTGYLTEAEKFGDSFV-FEGMLS 78


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.131    0.371 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,349,537
Number of Sequences: 62578
Number of extensions: 124152
Number of successful extensions: 295
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 12
Number of HSP's that attempted gapping in prelim test: 291
Number of HSP's gapped (non-prelim): 16
length of query: 115
length of database: 14,973,337
effective HSP length: 78
effective length of query: 37
effective length of database: 10,092,253
effective search space: 373413361
effective search space used: 373413361
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)