Citrus Sinensis ID: 033668


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MKLVRFLMKLNNETVSIELKNGTIVHGTITGVDISMNTHLKTVKLTLKGKNPVNLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPVGRGRGRGRGRGRGRGR
ccHHHHHHHccccEEEEEEccccEEEEEEcEEcccccEEEEEEEEECcccccEEccEEEECccEEEEEEccccccHHHHHHHcccccccccccccccccccccccccccccccc
MKLVRFLMKLNNETVSIELKNGTIVHGTITGVDISMNTHLKTVKLTLKGKNPVNLDHLSVRGNNIRYYILPDSLNLETLLV*********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLVRFLMKLNNETVSIELKNGTIVHGTITGVDISMNTHLKTVKLTLKGKNPVNLDHLSVRGNNIRYYILPDSLNLETLLVEETPRVKPKKPTAGRPVGRGRGRGRGRGRGRGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small nuclear ribonucleoprotein Sm D1 May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.probableP62314
Small nuclear ribonucleoprotein Sm D1 May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA.probableP62315
Probable small nuclear ribonucleoprotein Sm D1 Essential for pre-mRNA splicing. Implicated in the formation of stable, biologically active snRNP structures.probableQ9VU02

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B34, chain A
Confidence level:very confident
Coverage over the Query: 2-81
View the alignment between query and template
View the model in PyMOL