Query         033717
Match_columns 112
No_of_seqs    142 out of 226
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 05:29:03 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033717.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033717hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03222 rapid alkalinization  100.0 1.9E-35   4E-40  213.3   6.2   78   31-111    40-118 (119)
  2 PLN03221 rapid alkalinization  100.0 1.4E-34 3.1E-39  212.7   7.1  102    7-111    13-136 (137)
  3 PF05498 RALF:  Rapid ALkaliniz  99.9 4.8E-27 1.1E-31  154.9   4.6   63   46-111     3-65  (66)
  4 PF07172 GRP:  Glycine rich pro  71.1     5.2 0.00011   27.9   3.0    9    6-14      4-12  (95)
  5 PF07172 GRP:  Glycine rich pro  55.0      21 0.00045   24.8   3.6   16    5-20      6-21  (95)
  6 PF06404 PSK:  Phytosulfokine p  53.0     9.1  0.0002   26.0   1.5   13   55-67     62-74  (81)
  7 TIGR03147 cyt_nit_nrfF cytochr  47.4      21 0.00045   26.3   2.8   12    7-18      2-13  (126)
  8 PF07803 GSG-1:  GSG1-like prot  45.9      25 0.00054   25.9   2.9   21    8-28      9-29  (118)
  9 PF11714 Inhibitor_I53:  Thromb  44.8      21 0.00046   24.4   2.2   18    5-22      1-18  (78)
 10 PF03918 CcmH:  Cytochrome C bi  43.8      14  0.0003   27.5   1.4   27   32-60     44-71  (148)
 11 PF08139 LPAM_1:  Prokaryotic m  43.0      26 0.00056   19.2   2.0   17    5-21      7-23  (25)
 12 PF11106 YjbE:  Exopolysacchari  41.9      25 0.00054   24.3   2.3   19    5-23      1-19  (80)
 13 PF15240 Pro-rich:  Proline-ric  40.2      20 0.00043   28.0   1.8   13    9-21      4-16  (179)
 14 PRK10780 periplasmic chaperone  39.5      34 0.00073   25.2   2.9   13    5-17      1-13  (165)
 15 TIGR02052 MerP mercuric transp  34.8      29 0.00062   20.9   1.6   18    5-22      1-18  (92)
 16 PF07437 YfaZ:  YfaZ precursor;  34.4      31 0.00068   26.4   2.1   18    5-22      1-18  (180)
 17 PF08194 DIM:  DIM protein;  In  33.7      21 0.00046   21.2   0.8    9   11-19      8-16  (36)
 18 PF05279 Asp-B-Hydro_N:  Aspart  31.7      30 0.00066   28.0   1.7   18    5-23     13-30  (243)
 19 PF12276 DUF3617:  Protein of u  31.4      36 0.00078   24.3   1.9   12    6-17      2-13  (162)
 20 COG5510 Predicted small secret  30.6      71  0.0015   19.8   2.8   18    5-22      2-19  (44)
 21 PRK10053 hypothetical protein;  28.3      55  0.0012   24.1   2.4   13    5-17      1-13  (130)
 22 COG0848 ExbD Biopolymer transp  27.7      50  0.0011   24.2   2.1   22    2-23     15-36  (137)
 23 PF11948 DUF3465:  Protein of u  25.2      39 0.00084   25.2   1.1   14    5-18      1-14  (131)
 24 PRK11024 colicin uptake protei  25.1      51  0.0011   23.6   1.7   21    2-22     14-34  (141)
 25 PF15330 SIT:  SHP2-interacting  25.0      88  0.0019   22.2   2.9   17    7-23      5-21  (107)
 26 PF10917 DUF2708:  Protein of u  24.9      47   0.001   20.5   1.3   22   10-37      6-27  (43)
 27 TIGR03038 PS_II_psbM photosyst  24.2      88  0.0019   18.3   2.3   16    1-16      1-16  (33)
 28 TIGR02804 ExbD_2 TonB system t  23.3      85  0.0018   21.8   2.5   21    2-22      3-23  (121)
 29 PRK08457 motB flagellar motor   22.7      66  0.0014   25.6   2.1   14   10-23     27-40  (257)
 30 TIGR02801 tolR TolR protein. T  22.4      71  0.0015   22.2   2.0   20    2-21      4-23  (129)
 31 PRK06667 motB flagellar motor   21.9      65  0.0014   25.3   1.9   14   10-23     29-42  (252)
 32 PRK04989 psbM photosystem II r  21.9   1E+02  0.0023   18.2   2.3   16    1-16      1-16  (35)
 33 PRK14094 psbM photosystem II r  21.2   1E+02  0.0022   19.5   2.3   16    1-16      1-16  (50)
 34 CHL00080 psbM photosystem II p  21.1 1.1E+02  0.0024   18.0   2.3   16    1-16      1-16  (34)
 35 KOG4063 Major epididymal secre  21.0 1.1E+02  0.0024   23.6   2.9    9   72-80     92-100 (158)
 36 PF06585 JHBP:  Haemolymph juve  20.9      43 0.00093   25.4   0.7   16   29-44     27-45  (248)
 37 PF09680 Tiny_TM_bacill:  Prote  20.5      87  0.0019   17.1   1.6   14    5-18      6-19  (24)
 38 PLN03207 stomagen; Provisional  20.4 2.5E+02  0.0055   20.4   4.5   11   53-63     61-71  (113)

No 1  
>PLN03222 rapid alkalinization factor 23-like protein; Provisional
Probab=100.00  E-value=1.9e-35  Score=213.35  Aligned_cols=78  Identities=47%  Similarity=0.859  Sum_probs=70.9

Q ss_pred             CCCccCchhhhhhh-hhhhhcccchhhhhhHhhhcccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccc
Q 033717           31 HGECDGSIAECGEL-AAEEFSMESETSKRVLAAAHKFISPGALRRDAPVCNGGARGDPYSKSCLPPQSNRYQRGCAAYKM  109 (112)
Q Consensus        31 ~~~C~Gsi~EC~~~-~e~E~~m~se~~RR~L~~~~~yISYgAL~~d~vpC~~~~~G~sYy~~C~~~~aNpY~RGCs~i~R  109 (112)
                      ...|+|+++||+++ +|+|++||||++||+|+++ +||||+||++|.+||+  ++|++||+|++++|+|||+|||++|||
T Consensus        40 ~~~C~Gsi~EC~~~~~e~e~~mdSe~sRR~L~~~-rYISYgALrrd~vPCs--rrG~SYynC~~~~~ANPY~RGCs~ITr  116 (119)
T PLN03222         40 DSKCNGTIAECSLSTAEEEFEMDSEINRRILATT-KYISYGALRRNTVPCS--RRGASYYNCRRGAQANPYSRGCSAITR  116 (119)
T ss_pred             CCcCCCCHHHhhcccccchhccccHHHHHHHhhc-CeecHHHhcCCCCCCC--CCCCCccccCCCCCCCCCCCCchhhcc
Confidence            34699999999974 5679999999999999987 9999999999999999  789999965556899999999999999


Q ss_pred             cc
Q 033717          110 CR  111 (112)
Q Consensus       110 Cr  111 (112)
                      ||
T Consensus       117 Cr  118 (119)
T PLN03222        117 CR  118 (119)
T ss_pred             cc
Confidence            98


No 2  
>PLN03221 rapid alkalinization factor 23; Provisional
Probab=100.00  E-value=1.4e-34  Score=212.70  Aligned_cols=102  Identities=39%  Similarity=0.654  Sum_probs=78.9

Q ss_pred             HHHHHHHHHHHHHhhhhhhhhh-------cCCCCccCchhhhhh------h-------hh--hhhcccchhhhhhHhhhc
Q 033717            7 KFCSLCLLLFAVSSVTAAAKES-------YKHGECDGSIAECGE------L-------AA--EEFSMESETSKRVLAAAH   64 (112)
Q Consensus         7 ~~~~l~~ll~~~~~~~~~~~~~-------~~~~~C~Gsi~EC~~------~-------~e--~E~~m~se~~RR~L~~~~   64 (112)
                      -|..|++|.+-+-+|++..|..       +....|+|||+||++      +       +|  +|++||||++||+|+++ 
T Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~GsiaEC~~~~~~~~d~e~~~g~~~~~~e~~MdSE~sRR~L~~~-   91 (137)
T PLN03221         13 IFAILLILAVHFWSVAVSSQSIEFAGDFPPFETECRGTIAECSVSAALGDDGDLFYGGGEMGAEFEMDSEINRRILATR-   91 (137)
T ss_pred             HHHHHHHHHHHHHhheeecccccccccccCCCCcccCCHHHHhhhhccccccccccccchhhhhhhcccHHHHHHHhcC-
Confidence            4555555444445555433222       223469999999973      1       11  37899999999999987 


Q ss_pred             ccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccc
Q 033717           65 KFISPGALRRDAPVCNGGARGDPYSKSCLPPQSNRYQRGCAAYKMCR  111 (112)
Q Consensus        65 ~yISYgAL~~d~vpC~~~~~G~sYy~~C~~~~aNpY~RGCs~i~RCr  111 (112)
                      +||||+||++|.+||+  ++|++||+|++++|+|||+|||++|||||
T Consensus        92 rYISYgALrrd~vPCs--rrG~SYynC~~~~pANPY~RGCs~ITRCr  136 (137)
T PLN03221         92 RYISYGALRRNTIPCS--RRGASYYNCRRGAQANPYSRGCSAITRCR  136 (137)
T ss_pred             CccCHHHhccCCCCCC--CCCCCccccCCCCCCCCCCCCcccccccC
Confidence            8999999999999999  78999997666689999999999999998


No 3  
>PF05498 RALF:  Rapid ALkalinization Factor (RALF) ;  InterPro: IPR008801 RALF, a 5 kDa ubiquitous polypeptide in plants, arrests root growth and development.
Probab=99.93  E-value=4.8e-27  Score=154.89  Aligned_cols=63  Identities=49%  Similarity=0.849  Sum_probs=59.4

Q ss_pred             hhhhcccchhhhhhHhhhcccccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccc
Q 033717           46 AEEFSMESETSKRVLAAAHKFISPGALRRDAPVCNGGARGDPYSKSCLPPQSNRYQRGCAAYKMCR  111 (112)
Q Consensus        46 e~E~~m~se~~RR~L~~~~~yISYgAL~~d~vpC~~~~~G~sYy~~C~~~~aNpY~RGCs~i~RCr  111 (112)
                      |+|+.|+||++||+|+++ +||||+||++|.+||.  .+|.+||++|+++|+|||+|||++|||||
T Consensus         3 e~~~~~~s~~~~R~~a~~-~yIsYgaL~~~~~pc~--~~g~~~~~c~~~~paNpY~RGC~~~~rCr   65 (66)
T PF05498_consen    3 EEEVVMESEASRRILAAR-RYISYGALRRDRVPCS--PRGCSYYNCCPRQPANPYSRGCSKITRCR   65 (66)
T ss_pred             hHHhhhhhHHHHHHHhcC-CeecchhccCCCCCCC--cccCCCcccCCCCCCCCCCCCCCccccCC
Confidence            578899999999999988 9999999999999999  78999997778899999999999999998


No 4  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=71.13  E-value=5.2  Score=27.90  Aligned_cols=9  Identities=56%  Similarity=0.600  Sum_probs=3.6

Q ss_pred             HHHHHHHHH
Q 033717            6 KKFCSLCLL   14 (112)
Q Consensus         6 ~~~~~l~~l   14 (112)
                      |.|++|.||
T Consensus         4 K~~llL~l~   12 (95)
T PF07172_consen    4 KAFLLLGLL   12 (95)
T ss_pred             hHHHHHHHH
Confidence            344444333


No 5  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=55.03  E-value=21  Score=24.83  Aligned_cols=16  Identities=25%  Similarity=0.162  Sum_probs=6.6

Q ss_pred             hHHHHHHHHHHHHHHh
Q 033717            5 MKKFCSLCLLLFAVSS   20 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~   20 (112)
                      |+.+.+|+..||+|||
T Consensus         6 ~llL~l~LA~lLlisS   21 (95)
T PF07172_consen    6 FLLLGLLLAALLLISS   21 (95)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            4445444433333333


No 6  
>PF06404 PSK:  Phytosulfokine precursor protein (PSK);  InterPro: IPR009438 This family consists of several plant specific phytosulfokine precursor proteins. Phytosulfokines, are active as either a pentapeptide or a C-terminally truncated tetrapeptide. These compounds were first isolated because of their ability to stimulate cell division in somatic embryo cultures of Asparagus officinalis [].; GO: 0008083 growth factor activity, 0008283 cell proliferation, 0005576 extracellular region
Probab=52.97  E-value=9.1  Score=26.04  Aligned_cols=13  Identities=38%  Similarity=0.524  Sum_probs=9.1

Q ss_pred             hhhhhHhhhcccc
Q 033717           55 TSKRVLAAAHKFI   67 (112)
Q Consensus        55 ~~RR~L~~~~~yI   67 (112)
                      ..||+|++.-.||
T Consensus        62 L~RRtL~AHlDYI   74 (81)
T PF06404_consen   62 LMRRTLAAHLDYI   74 (81)
T ss_pred             HHHHHHHHHhhhe
Confidence            4799998654555


No 7  
>TIGR03147 cyt_nit_nrfF cytochrome c nitrite reductase, accessory protein NrfF.
Probab=47.43  E-value=21  Score=26.31  Aligned_cols=12  Identities=50%  Similarity=0.736  Sum_probs=8.3

Q ss_pred             HHHHHHHHHHHH
Q 033717            7 KFCSLCLLLFAV   18 (112)
Q Consensus         7 ~~~~l~~ll~~~   18 (112)
                      +|++|++++|+.
T Consensus         2 ~~~~~l~~~~~~   13 (126)
T TIGR03147         2 KFLALLLLLISF   13 (126)
T ss_pred             cHHHHHHHHHHH
Confidence            577777766654


No 8  
>PF07803 GSG-1:  GSG1-like protein;  InterPro: IPR012478 This family contains sequences bearing similarity to a region of GSG1 (Q9Z1H7 from SWISSPROT), a protein specifically expressed in testicular germ cells []. It is possible that over expression of the human homologue may be involved in tumourigenesis of human testicular germ cell tumours []. The region in question has four highly conserved cysteine residues. 
Probab=45.91  E-value=25  Score=25.89  Aligned_cols=21  Identities=38%  Similarity=0.298  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHhhhhhhhhh
Q 033717            8 FCSLCLLLFAVSSVTAAAKES   28 (112)
Q Consensus         8 ~~~l~~ll~~~~~~~~~~~~~   28 (112)
                      +++|++-+||++.++.+...+
T Consensus         9 ~Ls~~ln~LAL~~S~tA~~sS   29 (118)
T PF07803_consen    9 LLSLILNLLALAFSTTALLSS   29 (118)
T ss_pred             HHHHHHHHHHHHHHHHHHhcc
Confidence            566666666655554434333


No 9  
>PF11714 Inhibitor_I53:  Thrombin inhibitor Madanin  ;  InterPro: IPR021716  Members of this family are the peptidase inhibitor madanin proteins. These proteins were isolated from tick saliva []. 
Probab=44.79  E-value=21  Score=24.39  Aligned_cols=18  Identities=39%  Similarity=0.477  Sum_probs=11.1

Q ss_pred             hHHHHHHHHHHHHHHhhh
Q 033717            5 MKKFCSLCLLLFAVSSVT   22 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~~~   22 (112)
                      |+.|..|+++.++.++|-
T Consensus         1 MKhFaiLilavVaSAvVM   18 (78)
T PF11714_consen    1 MKHFAILILAVVASAVVM   18 (78)
T ss_pred             CchHHHHHHHHHHHHHHH
Confidence            577877776665444443


No 10 
>PF03918 CcmH:  Cytochrome C biogenesis protein;  InterPro: IPR005616 Members of this family include NrfF, CcmH, CycL, Ccl2.; PDB: 2KW0_A 2HL7_A.
Probab=43.85  E-value=14  Score=27.54  Aligned_cols=27  Identities=26%  Similarity=0.310  Sum_probs=12.5

Q ss_pred             CCc-cCchhhhhhhhhhhhcccchhhhhhH
Q 033717           32 GEC-DGSIAECGELAAEEFSMESETSKRVL   60 (112)
Q Consensus        32 ~~C-~Gsi~EC~~~~e~E~~m~se~~RR~L   60 (112)
                      +.| +-++++|..+--  -.|..++.+++.
T Consensus        44 p~Cq~qsi~~s~a~~A--~dmR~~I~~~l~   71 (148)
T PF03918_consen   44 PVCQNQSIADSNAPIA--RDMRREIREMLA   71 (148)
T ss_dssp             TTTTS-CTTT--SHHH--HHHHHHHHHHHH
T ss_pred             CCCCCCchhhcCcHHH--HHHHHHHHHHHH
Confidence            356 458999976511  124445555544


No 11 
>PF08139 LPAM_1:  Prokaryotic membrane lipoprotein lipid attachment site;  InterPro: IPR012640  In prokaryotes, membrane lipoproteins are synthesized with a precursor signal peptide, which is cleaved by a specific lipoprotein signal peptidase (signal peptidase II). The peptidase recognises a conserved sequence and cuts upstream of a cysteine residue to which a glyceride-fatty acid lipid is attached [,].  This lipid attachment site is found in homologues of the VirB proteins of type IV secretion systems (T4SS). Conjugal transfer across the cell envelope of Gram-negative bacteria is mediated by a supramolecular structure termed mating pair formation (Mpf) complex. Collectively, secretion pathways ancestrally related to bacterial conjugation systems are now known as T4SS. T4SS are involved in the delivery of effector molecules to eukaryotic target cells; each of these systems exports distinct DNA or protein substrates to effect a myriad of changes in host cell physiology during infection [].
Probab=42.99  E-value=26  Score=19.19  Aligned_cols=17  Identities=35%  Similarity=0.393  Sum_probs=10.0

Q ss_pred             hHHHHHHHHHHHHHHhh
Q 033717            5 MKKFCSLCLLLFAVSSV   21 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~~   21 (112)
                      |++++.+++.++.+|.+
T Consensus         7 mKkil~~l~a~~~LagC   23 (25)
T PF08139_consen    7 MKKILFPLLALFMLAGC   23 (25)
T ss_pred             HHHHHHHHHHHHHHhhc
Confidence            45666666666556554


No 12 
>PF11106 YjbE:  Exopolysaccharide production protein YjbE
Probab=41.92  E-value=25  Score=24.29  Aligned_cols=19  Identities=32%  Similarity=0.331  Sum_probs=12.1

Q ss_pred             hHHHHHHHHHHHHHHhhhh
Q 033717            5 MKKFCSLCLLLFAVSSVTA   23 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~~~~   23 (112)
                      ||+.++++|.+++++++++
T Consensus         1 MKK~~~~~~~i~~l~~~s~   19 (80)
T PF11106_consen    1 MKKIIYGLFAILALASSSA   19 (80)
T ss_pred             ChhHHHHHHHHHHHHhcch
Confidence            5777776666666655554


No 13 
>PF15240 Pro-rich:  Proline-rich
Probab=40.19  E-value=20  Score=28.02  Aligned_cols=13  Identities=38%  Similarity=0.444  Sum_probs=6.4

Q ss_pred             HHHHHHHHHHHhh
Q 033717            9 CSLCLLLFAVSSV   21 (112)
Q Consensus         9 ~~l~~ll~~~~~~   21 (112)
                      ++|+..||||||+
T Consensus         4 VLLSvALLALSSA   16 (179)
T PF15240_consen    4 VLLSVALLALSSA   16 (179)
T ss_pred             HHHHHHHHHhhhc
Confidence            3344455555554


No 14 
>PRK10780 periplasmic chaperone; Provisional
Probab=39.49  E-value=34  Score=25.19  Aligned_cols=13  Identities=38%  Similarity=0.248  Sum_probs=7.9

Q ss_pred             hHHHHHHHHHHHH
Q 033717            5 MKKFCSLCLLLFA   17 (112)
Q Consensus         5 ~~~~~~l~~ll~~   17 (112)
                      |++|+.+++|+|+
T Consensus         1 Mkk~~~~~~l~l~   13 (165)
T PRK10780          1 MKKWLLAAGLGLA   13 (165)
T ss_pred             ChHHHHHHHHHHH
Confidence            5777776655443


No 15 
>TIGR02052 MerP mercuric transport protein periplasmic component. This model represents the periplasmic mercury (II) binding protein of the bacterial mercury detoxification system which passes mercuric ion to the MerT transporter for subsequent reduction to Hg(0) by the mercuric reductase MerA. MerP contains a distinctive GMTCXXC motif associated with metal binding. MerP is related to a larger family of metal binding proteins (pfam00403).
Probab=34.81  E-value=29  Score=20.89  Aligned_cols=18  Identities=33%  Similarity=0.368  Sum_probs=9.4

Q ss_pred             hHHHHHHHHHHHHHHhhh
Q 033717            5 MKKFCSLCLLLFAVSSVT   22 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~~~   22 (112)
                      |+.++.|++|+|.++-.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~   18 (92)
T TIGR02052         1 MKKLATLLALFVLTSLPA   18 (92)
T ss_pred             ChhHHHHHHHHHHhcchh
Confidence            455556655555444443


No 16 
>PF07437 YfaZ:  YfaZ precursor;  InterPro: IPR009998 This family contains the precursor of the bacterial protein YfaZ (approximately 180 residues long). Many members of this family are hypothetical proteins.
Probab=34.44  E-value=31  Score=26.36  Aligned_cols=18  Identities=28%  Similarity=0.276  Sum_probs=10.7

Q ss_pred             hHHHHHHHHHHHHHHhhh
Q 033717            5 MKKFCSLCLLLFAVSSVT   22 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~~~   22 (112)
                      ||+|+++.+++|++.+.+
T Consensus         1 m~k~~~a~~~~l~~~s~~   18 (180)
T PF07437_consen    1 MKKFLLASAAALLLVSAS   18 (180)
T ss_pred             CchHHHHHHHHHHHHhhh
Confidence            677877666555444443


No 17 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=33.75  E-value=21  Score=21.18  Aligned_cols=9  Identities=44%  Similarity=0.807  Sum_probs=4.2

Q ss_pred             HHHHHHHHH
Q 033717           11 LCLLLFAVS   19 (112)
Q Consensus        11 l~~ll~~~~   19 (112)
                      |.|+||+++
T Consensus         8 ~~l~lLal~   16 (36)
T PF08194_consen    8 FALLLLALA   16 (36)
T ss_pred             HHHHHHHHH
Confidence            445555433


No 18 
>PF05279 Asp-B-Hydro_N:  Aspartyl beta-hydroxylase N-terminal region;  InterPro: IPR007943 This domain is found in members of the junctin, junctate and aspartyl beta-hydroxylase protein families. Junctate is an integral ER/SR membrane calcium binding protein, which comes from an alternatively spliced form of the same gene that generates aspartyl beta-hydroxylase and junctin []. Aspartyl beta-hydroxylase catalyses the post-translational hydroxylation of aspartic acid or asparagine residues contained within epidermal growth factor (EGF) domains of proteins []. This domain is also found in several eukaryotic triadin proteins. Triadin is a ryanodine receptor and calsequestrin binding protein located in junctional sarcoplasmic reticulum of striated muscles [].; GO: 0016020 membrane
Probab=31.71  E-value=30  Score=28.05  Aligned_cols=18  Identities=39%  Similarity=0.313  Sum_probs=9.7

Q ss_pred             hHHHHHHHHHHHHHHhhhh
Q 033717            5 MKKFCSLCLLLFAVSSVTA   23 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~~~~   23 (112)
                      |.||++|.||.+ .+++++
T Consensus        13 ~~~~~~~~~~~~-~~~~~~   30 (243)
T PF05279_consen   13 FTWFLVLALLGV-WSSVAV   30 (243)
T ss_pred             HHHHHHHHHHHH-HHhhHh
Confidence            456666555543 455544


No 19 
>PF12276 DUF3617:  Protein of unknown function (DUF3617);  InterPro: IPR022061  This family of proteins is found in bacteria. Proteins in this family are typically between 155 and 179 amino acids in length. There is a single completely conserved residue C that may be functionally important. 
Probab=31.37  E-value=36  Score=24.33  Aligned_cols=12  Identities=33%  Similarity=0.193  Sum_probs=5.1

Q ss_pred             HHHHHHHHHHHH
Q 033717            6 KKFCSLCLLLFA   17 (112)
Q Consensus         6 ~~~~~l~~ll~~   17 (112)
                      ++++++++++++
T Consensus         2 ~~~~~~~~~~~~   13 (162)
T PF12276_consen    2 KRRLLLALALAL   13 (162)
T ss_pred             chHHHHHHHHHH
Confidence            444444444433


No 20 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=30.61  E-value=71  Score=19.78  Aligned_cols=18  Identities=33%  Similarity=0.333  Sum_probs=11.7

Q ss_pred             hHHHHHHHHHHHHHHhhh
Q 033717            5 MKKFCSLCLLLFAVSSVT   22 (112)
Q Consensus         5 ~~~~~~l~~ll~~~~~~~   22 (112)
                      |+++..+.+++++.|...
T Consensus         2 mk~t~l~i~~vll~s~ll   19 (44)
T COG5510           2 MKKTILLIALVLLASTLL   19 (44)
T ss_pred             chHHHHHHHHHHHHHHHH
Confidence            677777776666555554


No 21 
>PRK10053 hypothetical protein; Provisional
Probab=28.29  E-value=55  Score=24.15  Aligned_cols=13  Identities=15%  Similarity=-0.008  Sum_probs=7.5

Q ss_pred             hHHHHHHHHHHHH
Q 033717            5 MKKFCSLCLLLFA   17 (112)
Q Consensus         5 ~~~~~~l~~ll~~   17 (112)
                      |++++++++++++
T Consensus         1 MKK~~~~~~~~~~   13 (130)
T PRK10053          1 MKLQAIALASFLV   13 (130)
T ss_pred             CcHHHHHHHHHHH
Confidence            5666655555544


No 22 
>COG0848 ExbD Biopolymer transport protein [Intracellular trafficking and secretion]
Probab=27.66  E-value=50  Score=24.16  Aligned_cols=22  Identities=32%  Similarity=0.477  Sum_probs=16.1

Q ss_pred             cchhHHHHHHHHHHHHHHhhhh
Q 033717            2 EIDMKKFCSLCLLLFAVSSVTA   23 (112)
Q Consensus         2 ~~~~~~~~~l~~ll~~~~~~~~   23 (112)
                      |||.-+|+=.+|.||++-|+++
T Consensus        15 eINvtPlIDVmLVLLiiFmvta   36 (137)
T COG0848          15 EINVTPLIDVMLVLLIIFMVTA   36 (137)
T ss_pred             ccccccHHHHHHHHHHHHHHhh
Confidence            7888899777777776666654


No 23 
>PF11948 DUF3465:  Protein of unknown function (DUF3465);  InterPro: IPR021856  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 131 to 151 amino acids in length. This protein has a conserved HWTH sequence motif. 
Probab=25.23  E-value=39  Score=25.22  Aligned_cols=14  Identities=36%  Similarity=0.641  Sum_probs=9.8

Q ss_pred             hHHHHHHHHHHHHH
Q 033717            5 MKKFCSLCLLLFAV   18 (112)
Q Consensus         5 ~~~~~~l~~ll~~~   18 (112)
                      ||+|+++++.+|..
T Consensus         1 m~~~~~~~~~~~~~   14 (131)
T PF11948_consen    1 MKRFLALFLSVLSA   14 (131)
T ss_pred             CcchHHHHHHHHHH
Confidence            68888888666543


No 24 
>PRK11024 colicin uptake protein TolR; Provisional
Probab=25.08  E-value=51  Score=23.61  Aligned_cols=21  Identities=24%  Similarity=0.373  Sum_probs=11.7

Q ss_pred             cchhHHHHHHHHHHHHHHhhh
Q 033717            2 EIDMKKFCSLCLLLFAVSSVT   22 (112)
Q Consensus         2 ~~~~~~~~~l~~ll~~~~~~~   22 (112)
                      |||+.++.=.+|+||++-|++
T Consensus        14 ~initPlIDVvfvLLiFFmvt   34 (141)
T PRK11024         14 EINIVPLLDVLLVLLLIFMAT   34 (141)
T ss_pred             ccccCcHHHHHHHHHHHHHhc
Confidence            577777754444444444443


No 25 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=25.01  E-value=88  Score=22.19  Aligned_cols=17  Identities=35%  Similarity=0.321  Sum_probs=8.8

Q ss_pred             HHHHHHHHHHHHHhhhh
Q 033717            7 KFCSLCLLLFAVSSVTA   23 (112)
Q Consensus         7 ~~~~l~~ll~~~~~~~~   23 (112)
                      .++.|+|||+.+++..+
T Consensus         5 ~il~llLll~l~asl~~   21 (107)
T PF15330_consen    5 GILALLLLLSLAASLLA   21 (107)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44555555555555543


No 26 
>PF10917 DUF2708:  Protein of unknown function (DUF2708);  InterPro: IPR024415 This entry represents fungus-induced proteins which may have role in hypoxia response[].
Probab=24.93  E-value=47  Score=20.49  Aligned_cols=22  Identities=32%  Similarity=0.514  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHhhhhhhhhhcCCCCccCc
Q 033717           10 SLCLLLFAVSSVTAAAKESYKHGECDGS   37 (112)
Q Consensus        10 ~l~~ll~~~~~~~~~~~~~~~~~~C~Gs   37 (112)
                      +++|.+|++|+++      .....|.|.
T Consensus         6 vfvFaiLaissvs------~~G~rC~g~   27 (43)
T PF10917_consen    6 VFVFAILAISSVS------GGGHRCRGS   27 (43)
T ss_pred             ehHHHHhhhhccc------ccccccCCC
Confidence            3445566667665      334567543


No 27 
>TIGR03038 PS_II_psbM photosystem II reaction center protein PsbM. Members of this protein family are the photosystem II reaction center M protein, product of the psbM gene, in Cyanobacteria and their derived organelles in plants. This model resembles Pfam model pfam05151 but has cutoffs set to avoid false-positive matches to similar (not necessarily homologous) sequences in species that are not photosynthetic.
Probab=24.22  E-value=88  Score=18.26  Aligned_cols=16  Identities=25%  Similarity=0.573  Sum_probs=12.0

Q ss_pred             CcchhHHHHHHHHHHH
Q 033717            1 MEIDMKKFCSLCLLLF   16 (112)
Q Consensus         1 ~~~~~~~~~~l~~ll~   16 (112)
                      ||.|-+.|++-+++++
T Consensus         1 MEvn~l~fiAt~Lfi~   16 (33)
T TIGR03038         1 MEVNILGFIATLLFIL   16 (33)
T ss_pred             CcccHHHHHHHHHHHH
Confidence            8889888877665554


No 28 
>TIGR02804 ExbD_2 TonB system transport protein ExbD, group 2. Members of this family are Gram-negative bacterial inner membrane proteins, generally designated ExbD, related to the TolR family modeled by TIGRFAMs TIGR02801. Members always are encoded next to a protein designated ExbB (TIGR02797), related to the TolQ family modeled by TIGRFAMs TIGR02796. ExbD and ExbB together form a proton channel through which they can harness the proton-motive force to energize TonB, which in turn energizes TonB-dependent receptors in the outer membrane. TonB-dependent receptors with known specificity tend to import siderophores or vitamin B12. A TonB system and Tol-Pal system often will co-exist in a single bacterial genome.
Probab=23.33  E-value=85  Score=21.81  Aligned_cols=21  Identities=19%  Similarity=0.467  Sum_probs=11.2

Q ss_pred             cchhHHHHHHHHHHHHHHhhh
Q 033717            2 EIDMKKFCSLCLLLFAVSSVT   22 (112)
Q Consensus         2 ~~~~~~~~~l~~ll~~~~~~~   22 (112)
                      |||+.++.=.+|+||++-|++
T Consensus         3 ~initPlIDVvflLLiFFmvt   23 (121)
T TIGR02804         3 GLNIVPFIDIMLVLLAIVLII   23 (121)
T ss_pred             cccchhHHHHHHHHHHHHHHH
Confidence            677777754444444433333


No 29 
>PRK08457 motB flagellar motor protein MotB; Reviewed
Probab=22.74  E-value=66  Score=25.60  Aligned_cols=14  Identities=14%  Similarity=0.135  Sum_probs=6.6

Q ss_pred             HHHHHHHHHHhhhh
Q 033717           10 SLCLLLFAVSSVTA   23 (112)
Q Consensus        10 ~l~~ll~~~~~~~~   23 (112)
                      +|+||+|++||+++
T Consensus        27 LL~FFVlL~smS~v   40 (257)
T PRK08457         27 LLALFIALYAISAV   40 (257)
T ss_pred             HHHHHHHHHHHHhc
Confidence            33444444555554


No 30 
>TIGR02801 tolR TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score.
Probab=22.42  E-value=71  Score=22.19  Aligned_cols=20  Identities=25%  Similarity=0.482  Sum_probs=10.0

Q ss_pred             cchhHHHHHHHHHHHHHHhh
Q 033717            2 EIDMKKFCSLCLLLFAVSSV   21 (112)
Q Consensus         2 ~~~~~~~~~l~~ll~~~~~~   21 (112)
                      |||+.++.=.+|+||++-|+
T Consensus         4 ~inltPlIDVvFlLLiFFmv   23 (129)
T TIGR02801         4 EINVVPYVDVMLVLLIIFMV   23 (129)
T ss_pred             ccccccHHHHHHHHHHHHHh
Confidence            56777664444444443333


No 31 
>PRK06667 motB flagellar motor protein MotB; Validated
Probab=21.94  E-value=65  Score=25.35  Aligned_cols=14  Identities=14%  Similarity=0.491  Sum_probs=6.5

Q ss_pred             HHHHHHHHHHhhhh
Q 033717           10 SLCLLLFAVSSVTA   23 (112)
Q Consensus        10 ~l~~ll~~~~~~~~   23 (112)
                      +|+||+|++||+++
T Consensus        29 LL~FFVlL~smS~~   42 (252)
T PRK06667         29 LLCFFVMLFTTNDV   42 (252)
T ss_pred             HHHHHHHHHHhhhc
Confidence            33344444555543


No 32 
>PRK04989 psbM photosystem II reaction center protein M; Provisional
Probab=21.93  E-value=1e+02  Score=18.19  Aligned_cols=16  Identities=25%  Similarity=0.445  Sum_probs=11.7

Q ss_pred             CcchhHHHHHHHHHHH
Q 033717            1 MEIDMKKFCSLCLLLF   16 (112)
Q Consensus         1 ~~~~~~~~~~l~~ll~   16 (112)
                      ||.|-+.|++-+|+++
T Consensus         1 MevN~lgfiAt~Lfi~   16 (35)
T PRK04989          1 MEVNDLGFVASLLFVL   16 (35)
T ss_pred             CcchHHHHHHHHHHHH
Confidence            8888888876665554


No 33 
>PRK14094 psbM photosystem II reaction center protein M; Provisional
Probab=21.16  E-value=1e+02  Score=19.50  Aligned_cols=16  Identities=25%  Similarity=0.164  Sum_probs=12.0

Q ss_pred             CcchhHHHHHHHHHHH
Q 033717            1 MEIDMKKFCSLCLLLF   16 (112)
Q Consensus         1 ~~~~~~~~~~l~~ll~   16 (112)
                      ||.|-+.|.+-+|+++
T Consensus         1 MEVN~lgfiAtaLFi~   16 (50)
T PRK14094          1 METTNFGFVASLLFVG   16 (50)
T ss_pred             CcchHHHHHHHHHHHH
Confidence            8899988877665554


No 34 
>CHL00080 psbM photosystem II protein M
Probab=21.05  E-value=1.1e+02  Score=17.96  Aligned_cols=16  Identities=25%  Similarity=0.629  Sum_probs=11.9

Q ss_pred             CcchhHHHHHHHHHHH
Q 033717            1 MEIDMKKFCSLCLLLF   16 (112)
Q Consensus         1 ~~~~~~~~~~l~~ll~   16 (112)
                      ||.|-+.|.+-+|+++
T Consensus         1 MEvN~lgfiAt~LFi~   16 (34)
T CHL00080          1 MEVNILAFIATALFIL   16 (34)
T ss_pred             CcccHHHHHHHHHHHH
Confidence            8889888877665554


No 35 
>KOG4063 consensus Major epididymal secretory protein HE1 [Function unknown]
Probab=21.03  E-value=1.1e+02  Score=23.58  Aligned_cols=9  Identities=44%  Similarity=0.600  Sum_probs=4.3

Q ss_pred             cCCCCCCCC
Q 033717           72 LRRDAPVCN   80 (112)
Q Consensus        72 L~~d~vpC~   80 (112)
                      -..|.-+|+
T Consensus        92 ~~~dacv~~  100 (158)
T KOG4063|consen   92 PASDACVCG  100 (158)
T ss_pred             CCCcccccc
Confidence            344445555


No 36 
>PF06585 JHBP:  Haemolymph juvenile hormone binding protein (JHBP);  InterPro: IPR010562 This family consists of several insect specific haemolymph juvenile hormone binding proteins (JHBP). Juvenile hormone (JH) has a profound effect on insects. It regulates embryogenesis, maintains the status quo of larva development and stimulates reproductive maturation in the adult forms. JH is transported from the sites of its synthesis to target tissues by a haemolymph carrier called juvenile hormone-binding protein (JHBP). JHBP protects the JH molecules from hydrolysis by non-specific esterases present in the insect haemolymph []. The crystal structure of the JHBP from Galleria mellonella (Wax moth) shows an unusual fold consisting of a long alpha-helix wrapped in a much curved antiparallel beta-sheet. The folding pattern for this structure closely resembles that found in some tandem-repeat mammalian lipid-binding and bactericidal permeability-increasing proteins, with a similar organisation of the major cavity and a disulphide bond linking the long helix and the beta-sheet. It would appear that JHBP forms two cavities, only one of which, the one near the N- and C-termini, binds the hormone; binding induces a conformational change, of unknown significance [, ].; PDB: 3A1Z_D 3AOS_B 3AOT_A 2RQF_A 2RCK_A 3E8W_A 3E8T_A.
Probab=20.95  E-value=43  Score=25.39  Aligned_cols=16  Identities=25%  Similarity=0.339  Sum_probs=7.0

Q ss_pred             cCCCCccCc---hhhhhhh
Q 033717           29 YKHGECDGS---IAECGEL   44 (112)
Q Consensus        29 ~~~~~C~Gs---i~EC~~~   44 (112)
                      ..-..|.-+   ..+|+.+
T Consensus        27 ~~~~~C~~~~~~~~~cl~~   45 (248)
T PF06585_consen   27 SYIKPCKRSDPNLNECLRE   45 (248)
T ss_dssp             -S---BBTT----HHHHHH
T ss_pred             cccCcCCCCCccHHHHHHH
Confidence            334578654   6778754


No 37 
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=20.54  E-value=87  Score=17.09  Aligned_cols=14  Identities=29%  Similarity=0.399  Sum_probs=7.3

Q ss_pred             hHHHHHHHHHHHHH
Q 033717            5 MKKFCSLCLLLFAV   18 (112)
Q Consensus         5 ~~~~~~l~~ll~~~   18 (112)
                      |+..++|++||.++
T Consensus         6 FalivVLFILLiIv   19 (24)
T PF09680_consen    6 FALIVVLFILLIIV   19 (24)
T ss_pred             chhHHHHHHHHHHh
Confidence            34445566666544


No 38 
>PLN03207 stomagen; Provisional
Probab=20.36  E-value=2.5e+02  Score=20.41  Aligned_cols=11  Identities=27%  Similarity=0.604  Sum_probs=7.0

Q ss_pred             chhhhhhHhhh
Q 033717           53 SETSKRVLAAA   63 (112)
Q Consensus        53 se~~RR~L~~~   63 (112)
                      +..+||++-+.
T Consensus        61 ~k~srr~~igs   71 (113)
T PLN03207         61 SKSSRRLMIGS   71 (113)
T ss_pred             chhhhhhhhcC
Confidence            44578887544


Done!