BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033736
(112 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4F99|B Chain B, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide
pdb|4F9A|B Chain B, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide
pdb|4F9A|D Chain D, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide
pdb|4F9B|B Chain B, Human Cdc7 Kinase In Complex With Dbf4 And Pha767491
pdb|4F9B|D Chain D, Human Cdc7 Kinase In Complex With Dbf4 And Pha767491
pdb|4F9C|B Chain B, Human Cdc7 Kinase In Complex With Dbf4 And Xl413
Length = 144
Score = 28.5 bits (62), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 12/32 (37%), Positives = 18/32 (56%)
Query: 5 EENSQLFPIFILTIMALPLVPYTILKLCHAFS 36
E+ SQL+ F L + +P + Y+I K C F
Sbjct: 17 EDMSQLYRPFYLQLTNMPFINYSIQKPCSPFD 48
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.134 0.424
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,196,033
Number of Sequences: 62578
Number of extensions: 50802
Number of successful extensions: 95
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 94
Number of HSP's gapped (non-prelim): 1
length of query: 112
length of database: 14,973,337
effective HSP length: 76
effective length of query: 36
effective length of database: 10,217,409
effective search space: 367826724
effective search space used: 367826724
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)