BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033737
(112 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3SWN|C Chain C, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|F Chain F, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|O Chain O, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|R Chain R, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
Length = 117
Score = 74.7 bits (182), Expect = 1e-14, Method: Compositional matrix adjust.
Identities = 36/67 (53%), Positives = 51/67 (76%), Gaps = 1/67 (1%)
Query: 36 RKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQ 95
RKE++LDL+++ D+ +Q TGGRQ+TG LKG+DQL+NLVLD+ E LR+ +D K T
Sbjct: 25 RKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLMNLVLDDVEEQLRNPED-GKLTGA 83
Query: 96 TRQLGLI 102
R+LGL+
Sbjct: 84 IRKLGLV 90
>pdb|4EMK|C Chain C, Crystal Structure Of Splsm567
Length = 113
Score = 73.2 bits (178), Expect = 3e-14, Method: Compositional matrix adjust.
Identities = 36/67 (53%), Positives = 50/67 (74%), Gaps = 1/67 (1%)
Query: 36 RKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQ 95
RKE++LDL+++ D+ +Q TGGRQ+TG LKG+DQL NLVLD+ E LR+ +D K T
Sbjct: 21 RKESILDLSRYQDQRIQATFTGGRQITGILKGFDQLXNLVLDDVEEQLRNPED-GKLTGA 79
Query: 96 TRQLGLI 102
R+LGL+
Sbjct: 80 IRKLGLV 86
>pdb|3CW1|G Chain G, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|3 Chain 3, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|4 Chain 4, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|5 Chain 5, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|G Chain G, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|J Chain J, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|G Chain G, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|N Chain N, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|U Chain U, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|G Chain G, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|G Chain G, Macromolecular Machine 6
pdb|4F7U|J Chain J, Macromolecular Machine 6
pdb|1VU2|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU2|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU2|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU2|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU2|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU2|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|1VU2|4 Chain 4, The 8s Snrnp Assembly Intermediate
pdb|1VU3|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|1VU3|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|1VU3|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|1VU3|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|1VU3|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|1VU3|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|P Chain P, The 8s Snrnp Assembly Intermediate
pdb|4F77|H Chain H, The 8s Snrnp Assembly Intermediate
pdb|4F77|X Chain X, The 8s Snrnp Assembly Intermediate
pdb|4F77|FF Chain f, The 8s Snrnp Assembly Intermediate
pdb|4F77|NN Chain n, The 8s Snrnp Assembly Intermediate
pdb|4F77|VV Chain v, The 8s Snrnp Assembly Intermediate
pdb|4F77|4 Chain 4, The 8s Snrnp Assembly Intermediate
Length = 76
Score = 53.1 bits (126), Expect = 3e-08, Method: Compositional matrix adjust.
Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 8/61 (13%)
Query: 42 DLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGL 101
+L KF+DK + +KL GGR V G L+G+D +NLV+DE VE + T+ Q +G+
Sbjct: 8 ELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVE--------MATSGQQNNIGM 59
Query: 102 I 102
+
Sbjct: 60 V 60
>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
Length = 96
Score = 41.2 bits (95), Expect = 2e-04, Method: Compositional matrix adjust.
Identities = 22/45 (48%), Positives = 30/45 (66%), Gaps = 1/45 (2%)
Query: 38 ETVLDLAKF-VDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVE 81
ET LDL K +D+ V +KL G R + GTL+ +D N+VL +AVE
Sbjct: 9 ETPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHCNIVLSDAVE 53
>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
Length = 93
Score = 38.9 bits (89), Expect = 7e-04, Method: Compositional matrix adjust.
Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 3/63 (4%)
Query: 41 LDLAKF-VDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQL 99
LDL + +D+ V VKL G R++ G L YD+ LN VL +A E + DD + TD+ + L
Sbjct: 11 LDLVRLSLDEIVYVKLRGDRELNGRLHAYDEHLNXVLGDAEEIVTIFDD--EETDKDKAL 68
Query: 100 GLI 102
I
Sbjct: 69 KTI 71
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
Length = 81
Score = 38.1 bits (87), Expect = 0.001, Method: Compositional matrix adjust.
Identities = 19/44 (43%), Positives = 28/44 (63%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDA 86
LA+ ++ V VKL G ++V G L+ YDQ +NLVL ++ E D
Sbjct: 14 LAESLNNLVLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSDG 57
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
Length = 77
Score = 35.4 bits (80), Expect = 0.008, Method: Compositional matrix adjust.
Identities = 19/40 (47%), Positives = 25/40 (62%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEF 82
L + + V V+L GGR+ GTL GYD +NLVL +A E
Sbjct: 9 LNRSLKSPVIVRLKGGREFRGTLDGYDIHMNLVLLDAEEI 48
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
Length = 83
Score = 33.9 bits (76), Expect = 0.025, Method: Compositional matrix adjust.
Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLI 102
L ++ V +KL G R+ G LK +D +NLVL++A E L+ + TR+LG +
Sbjct: 20 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE--------LEDGEVTRRLGTV 71
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
Length = 87
Score = 33.9 bits (76), Expect = 0.025, Method: Compositional matrix adjust.
Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLI 102
L ++ V +KL G R+ G LK +D +NLVL++A E L+ + TR+LG +
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE--------LEDGEVTRRLGTV 69
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
Length = 86
Score = 33.9 bits (76), Expect = 0.026, Method: Compositional matrix adjust.
Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLI 102
L ++ V +KL G R+ G LK +D +NLVL++A E L+ + TR+LG +
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE--------LEDGEVTRRLGTV 69
>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
Length = 121
Score = 33.5 bits (75), Expect = 0.027, Method: Compositional matrix adjust.
Identities = 13/38 (34%), Positives = 26/38 (68%)
Query: 51 VQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADD 88
+ V + G ++ +G L+G+D+ +N+VLD+ E+ AD+
Sbjct: 41 IYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFKADE 78
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit
Length = 85
Score = 33.5 bits (75), Expect = 0.028, Method: Compositional matrix adjust.
Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 8/60 (13%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLI 102
L ++ V +KL G R+ G LK +D +NLVL++A E L+ + TR+LG +
Sbjct: 18 LGNSLNSPVIIKLKGDREFRGVLKSFDLHMNLVLNDAEE--------LEDGEVTRRLGTV 69
>pdb|3I45|A Chain A, Crystal Structure Of Putative Twin-Arginine Translocation
Pathway Signal Protein From Rhodospirillum Rubrum Atcc
11170
Length = 387
Score = 33.5 bits (75), Expect = 0.034, Method: Composition-based stats.
Identities = 19/40 (47%), Positives = 22/40 (55%)
Query: 42 DLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVE 81
DL KFV +G L GRQV L G + LN + DEA E
Sbjct: 211 DLPKFVREGRVRGLFAGRQVVSMLTGEPEYLNPLKDEAPE 250
>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
Length = 81
Score = 31.6 bits (70), Expect = 0.13, Method: Compositional matrix adjust.
Identities = 14/37 (37%), Positives = 24/37 (64%)
Query: 47 VDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFL 83
+ K V VKL ++ G L+ +DQ +NL+L++A E +
Sbjct: 20 IGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEII 56
>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
Length = 95
Score = 30.0 bits (66), Expect = 0.36, Method: Compositional matrix adjust.
Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEF--LRDADDPLKTTDQTRQLG 100
+ + +D ++ L GR GT K +D+ +NL+L + EF ++ + ++ R LG
Sbjct: 9 MLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLG 68
Query: 101 LI 102
L+
Sbjct: 69 LV 70
>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human Core
Snrnp Domain At 2.0a Resolution
pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human Core
Snrnp Domain At 2.0a Resolution
pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human Core
Snrnp Domain At 2.0a Resolution
pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human Core
Snrnp Domain At 2.0a Resolution
pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human Core
Snrnp Domain At 2.0a Resolution
pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human Core
Snrnp Domain At 2.0a Resolution
Length = 91
Score = 29.6 bits (65), Expect = 0.42, Method: Compositional matrix adjust.
Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEF--LRDADDPLKTTDQTRQLG 100
+ + +D ++ L GR GT K +D+ +NL+L + EF ++ + ++ R LG
Sbjct: 9 MLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLG 68
Query: 101 LI 102
L+
Sbjct: 69 LV 70
>pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|D Chain D, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|P Chain P, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
pdb|3SWN|S Chain S, Structure Of The Lsm657 Complex: An Assembly Intermediate
Of The Lsm1 7 And Lsm2 8 Rings
Length = 82
Score = 28.9 bits (63), Expect = 0.72, Method: Compositional matrix adjust.
Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 7/73 (9%)
Query: 35 GRKETVLDLA---KFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLK 91
G T+L L K + + V + R+ GTL G+D +N+VL + E+ D
Sbjct: 2 GMSMTILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEY----DTVTG 57
Query: 92 TTDQTRQLGLIGN 104
T++ ++ L GN
Sbjct: 58 VTEKHSEMLLNGN 70
>pdb|1H64|1 Chain 1, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|2 Chain 2, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|A Chain A, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|B Chain B, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|C Chain C, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|D Chain D, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|E Chain E, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|F Chain F, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|G Chain G, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|H Chain H, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|I Chain I, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|J Chain J, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|K Chain K, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|L Chain L, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|M Chain M, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|N Chain N, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|O Chain O, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|P Chain P, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Q Chain Q, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|R Chain R, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|S Chain S, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|T Chain T, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|U Chain U, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|V Chain V, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|W Chain W, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|X Chain X, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Y Chain Y, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
pdb|1H64|Z Chain Z, Crystal Structure Of The Sm-Related Protein Of P. Abyssi
The Biological Unit Is A Heptamer
Length = 75
Score = 28.5 bits (62), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)
Query: 38 ETVLD-LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDAD 87
E LD + + +DK V V L G + G L GYD LN+VL +A E ++D +
Sbjct: 3 ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADA-EMIQDGE 52
>pdb|1M8V|A Chain A, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|B Chain B, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|C Chain C, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|D Chain D, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|E Chain E, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|F Chain F, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|G Chain G, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|H Chain H, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|I Chain I, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|J Chain J, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|K Chain K, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|L Chain L, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|M Chain M, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
pdb|1M8V|N Chain N, Structure Of Pyrococcus Abyssii Sm Protein In Complex
With A Uridine Heptamer
Length = 77
Score = 28.5 bits (62), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 2/51 (3%)
Query: 38 ETVLD-LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDAD 87
E LD + + +DK V V L G + G L GYD LN+VL +A E ++D +
Sbjct: 5 ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADA-EMIQDGE 54
>pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|W Chain W, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|X Chain X, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|Y Chain Y, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|E Chain E, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|H Chain H, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|E Chain E, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|L Chain L, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|S Chain S, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|E Chain E, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|E Chain E, Macromolecular Machine 6
pdb|4F7U|H Chain H, Macromolecular Machine 6
pdb|1VU2|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|1VU2|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|1VU2|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|1VU2|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|1VU2|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|1VU2|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|1VU2|YY Chain y, The 8s Snrnp Assembly Intermediate
pdb|1VU3|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|1VU3|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|1VU3|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|1VU3|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|1VU3|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|1VU3|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|4F77|K Chain K, The 8s Snrnp Assembly Intermediate
pdb|4F77|C Chain C, The 8s Snrnp Assembly Intermediate
pdb|4F77|S Chain S, The 8s Snrnp Assembly Intermediate
pdb|4F77|AA Chain a, The 8s Snrnp Assembly Intermediate
pdb|4F77|II Chain i, The 8s Snrnp Assembly Intermediate
pdb|4F77|QQ Chain q, The 8s Snrnp Assembly Intermediate
pdb|4F77|YY Chain y, The 8s Snrnp Assembly Intermediate
Length = 92
Score = 27.7 bits (60), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 7/43 (16%)
Query: 60 QVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLI 102
++ G + G+D+ +NLVLD DA++ T +QLG I
Sbjct: 42 RIEGCIIGFDEYMNLVLD-------DAEEIHSKTKSRKQLGRI 77
>pdb|3EEY|A Chain A, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|B Chain B, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|C Chain C, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|D Chain D, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|E Chain E, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|F Chain F, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|G Chain G, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|H Chain H, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|I Chain I, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
pdb|3EEY|J Chain J, Crystal Structure Of Putative Rrna-Methylase From
Clostridium Thermocellum
Length = 197
Score = 27.3 bits (59), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 5/48 (10%)
Query: 13 FIVCRSARVSFNLGFLKS--LKMSGRKETVLDLAKFVDKGVQVKLTGG 58
+I C V FNLG+L S +S R ET + + + K +++ +TGG
Sbjct: 89 YIDCPVKAVMFNLGYLPSGDHSISTRPETTI---QALSKAMELLVTGG 133
>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
Length = 231
Score = 27.3 bits (59), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEF--LRDADDPLKTTDQTRQLG 100
+ + +D ++ L GR GT K +D+ +NL+L + EF ++ + ++ R LG
Sbjct: 9 MLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLG 68
Query: 101 LI 102
L+
Sbjct: 69 LV 70
>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
Length = 174
Score = 26.6 bits (57), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 2/62 (3%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEF--LRDADDPLKTTDQTRQLG 100
+ + +D ++ L GR GT K +D+ +NL+L + EF ++ + ++ R LG
Sbjct: 9 MLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLG 68
Query: 101 LI 102
L+
Sbjct: 69 LV 70
>pdb|4EMK|A Chain A, Crystal Structure Of Splsm567
Length = 94
Score = 26.6 bits (57), Expect = 3.5, Method: Compositional matrix adjust.
Identities = 10/24 (41%), Positives = 16/24 (66%)
Query: 59 RQVTGTLKGYDQLLNLVLDEAVEF 82
R+ GTL G+D +N+VL + E+
Sbjct: 41 REFAGTLVGFDDYVNIVLKDVTEY 64
>pdb|3PIH|A Chain A, T. Maritima Uvra In Complex With Fluorescein-Modified Dna
Length = 916
Score = 26.6 bits (57), Expect = 3.5, Method: Composition-based stats.
Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 7/90 (7%)
Query: 19 ARVSFNLGFLKSLKMSGRKETVLDLAKFVDKGVQVKLTGGR-------QVTGTLKGYDQL 71
+R SFNL + G+ +++ D V+ + G+ ++T K +
Sbjct: 705 SRFSFNLKGGRCEACQGQGYVKIEMLFLPDVYVECDVCKGKRYNRETLEITYKGKNISDI 764
Query: 72 LNLVLDEAVEFLRDADDPLKTTDQTRQLGL 101
L++ +DEA+EF ++ +T +GL
Sbjct: 765 LDMTVDEALEFFKNIPSIKRTLQVLHDVGL 794
>pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human
Snrnp Core Domain
pdb|3CW1|B Chain B, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|M Chain M, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|N Chain N, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|O Chain O, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|X Chain X, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|U Chain U, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|B Chain B, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|I Chain I, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|P Chain P, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|A Chain A, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|A Chain A, Macromolecular Machine 6
pdb|4F7U|C Chain C, Macromolecular Machine 6
pdb|1VU2|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|1VU2|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|1VU2|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|1VU2|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|1VU2|WW Chain w, The 8s Snrnp Assembly Intermediate
pdb|1VU3|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|1VU3|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|1VU3|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|1VU3|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|4F77|I Chain I, The 8s Snrnp Assembly Intermediate
pdb|4F77|A Chain A, The 8s Snrnp Assembly Intermediate
pdb|4F77|Q Chain Q, The 8s Snrnp Assembly Intermediate
pdb|4F77|Y Chain Y, The 8s Snrnp Assembly Intermediate
pdb|4F77|GG Chain g, The 8s Snrnp Assembly Intermediate
pdb|4F77|OO Chain o, The 8s Snrnp Assembly Intermediate
pdb|4F77|WW Chain w, The 8s Snrnp Assembly Intermediate
Length = 119
Score = 26.6 bits (57), Expect = 3.9, Method: Compositional matrix adjust.
Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 5/62 (8%)
Query: 43 LAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLI 102
L K + V ++L G QV GT+ G D +N L +AV+ +P+ Q L +
Sbjct: 7 LMKLSHETVTIELKNGTQVHGTITGVDVSMNTHL-KAVKMTLKNREPV----QLETLSIR 61
Query: 103 GN 104
GN
Sbjct: 62 GN 63
>pdb|1M5Q|A Chain A, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|B Chain B, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|C Chain C, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|D Chain D, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|E Chain E, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|F Chain F, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|G Chain G, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|H Chain H, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|I Chain I, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|J Chain J, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|K Chain K, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|L Chain L, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|M Chain M, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|N Chain N, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|O Chain O, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|P Chain P, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|Q Chain Q, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|R Chain R, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|S Chain S, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|T Chain T, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|U Chain U, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|V Chain V, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|W Chain W, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|X Chain X, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|Y Chain Y, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|Z Chain Z, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|1 Chain 1, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
pdb|1M5Q|2 Chain 2, Crystal Structure Of A Novel Sm-Like Archaeal Protein
From Pyrobaculum Aerophilum
Length = 130
Score = 26.2 bits (56), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 15/40 (37%), Positives = 20/40 (50%)
Query: 40 VLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEA 79
V +L + + VQV L+ G G L D LN+VL A
Sbjct: 2 VAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANA 41
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In
Complex With Glutamate
pdb|2A5T|B Chain B, Crystal Structure Of The Nr1NR2A LIGAND-Binding Cores
Complex
Length = 284
Score = 25.8 bits (55), Expect = 6.6, Method: Compositional matrix adjust.
Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
Query: 30 SLKMSGRKETVLDLA-KFVDKGVQVKLTGGRQVTG 63
SL ++ + V+D + FV+ G+ V ++ G QVTG
Sbjct: 112 SLTINEERSEVVDFSVPFVETGISVMVSRGTQVTG 146
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.139 0.399
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,829,394
Number of Sequences: 62578
Number of extensions: 98769
Number of successful extensions: 260
Number of sequences better than 100.0: 31
Number of HSP's better than 100.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 236
Number of HSP's gapped (non-prelim): 31
length of query: 112
length of database: 14,973,337
effective HSP length: 76
effective length of query: 36
effective length of database: 10,217,409
effective search space: 367826724
effective search space used: 367826724
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)