Citrus Sinensis ID: 033737


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MQAFVEINAVSFFIVCRSARVSFNLGFLKSLKMSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLIGNCCDACVTN
ccccEEEcEEEEEEEEEcccEEccccccccccccccccccccHHHHcccEEEEEEcccCEEEEEEEEEcccccEEEccEEEEECcccccccccccCEEEEEEEECccEEECc
***FVEINAVSFFIVCRSARVSFNLGFLKSLKMSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLIGNCCDACV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAFVEINAVSFFIVCRSARVSFNLGFLKSLKMSGRKETVLDLAKFVDKGVQVKLTGGRQVTGTLKGYDQLLNLVLDEAVEFLRDADDPLKTTDQTRQLGLIGNCCDACVTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U6 snRNA-associated Sm-like protein LSm7 Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableQ9UK45
U6 snRNA-associated Sm-like protein LSm7 Binds specifically to the 3'-terminal U-tract of U6 snRNA.probableQ9CQQ8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EMK, chain C
Confidence level:very confident
Coverage over the Query: 47-83,94-98
View the alignment between query and template
View the model in PyMOL