Query         033739
Match_columns 112
No_of_seqs    27 out of 29
Neff          3.2 
Searched_HMMs 46136
Date          Fri Mar 29 05:44:49 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033739.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033739hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05821 NDUF_B8:  NADH-ubiquin  84.3     2.5 5.3E-05   33.0   5.0   35   76-112   122-156 (179)
  2 PF08265 YL1_C:  YL1 nuclear pr  52.6     5.7 0.00012   23.1   0.4   18   93-110     7-24  (30)
  3 KOG4481 Uncharacterized conser  47.8      19 0.00042   29.0   2.8   41   41-83     86-127 (194)
  4 KOG0815 60S acidic ribosomal p  43.9      38 0.00082   28.3   4.0   45   54-103   192-236 (245)
  5 PF02935 COX7C:  Cytochrome c o  43.4      43 0.00093   22.0   3.5   31   65-95     28-58  (65)
  6 PF06181 DUF989:  Protein of un  39.2      37 0.00081   29.0   3.4   40   56-95     59-103 (300)
  7 PF12351 Fig1:  Ca2+ regulator   34.0      47   0.001   25.4   3.0   28   71-98    152-180 (182)
  8 PF08285 DPM3:  Dolichol-phosph  32.1      40 0.00086   23.7   2.1   24   80-103    42-68  (91)
  9 PF07622 DUF1583:  Protein of u  28.4      24 0.00053   31.1   0.7   35   48-82     22-57  (399)
 10 PTZ00174 phosphomannomutase; P  27.3      42 0.00092   25.7   1.7   22   64-85    178-199 (247)
 11 COG3748 Predicted membrane pro  26.5      78  0.0017   28.1   3.3   27   69-95     72-100 (407)
 12 KOG4841 Dolichol-phosphate man  26.1      41 0.00088   24.5   1.3   23   81-103    47-72  (95)
 13 KOG2532 Permease of the major   25.7      42 0.00092   28.9   1.6   35   76-110   194-228 (466)
 14 PRK15126 thiamin pyrimidine py  25.7      44 0.00096   25.4   1.6   25   64-88    178-202 (272)
 15 PF08282 Hydrolase_3:  haloacid  25.6      52  0.0011   23.3   1.8   25   62-86    174-198 (254)
 16 PF05116 S6PP:  Sucrose-6F-phos  24.7      53  0.0011   25.5   1.8   24   65-88    156-179 (247)
 17 cd00929 Cyt_c_Oxidase_VIIc Cyt  24.0      74  0.0016   20.0   2.1   20   76-95     21-40  (46)
 18 TIGR02471 sucr_syn_bact_C sucr  23.5      55  0.0012   24.4   1.7   24   64-87    149-172 (236)
 19 TIGR01482 SPP-subfamily Sucros  23.5      57  0.0012   23.6   1.7   23   65-87    140-162 (225)
 20 PRK10976 putative hydrolase; P  23.3      50  0.0011   24.9   1.4   24   64-87    180-203 (266)
 21 PRK10513 sugar phosphate phosp  23.2      54  0.0012   24.7   1.6   24   64-87    186-209 (270)
 22 PRK13836 conjugal transfer pro  21.9      48   0.001   25.6   1.1   33   76-108    27-63  (220)
 23 PRK03669 mannosyl-3-phosphogly  21.8      83  0.0018   24.2   2.4   25   64-88    177-201 (271)
 24 PF08802 CytB6-F_Fe-S:  Cytochr  21.3 1.2E+02  0.0027   18.6   2.6   21   71-91      4-24  (39)
 25 COG3920 Signal transduction hi  20.4      56  0.0012   25.5   1.2   14   50-63    160-173 (221)
 26 PF00976 ACTH_domain:  Corticot  20.1      77  0.0017   19.8   1.5   20   33-52      9-28  (39)

No 1  
>PF05821 NDUF_B8:  NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8);  InterPro: IPR008699  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This family consists of several eukaryotic NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI) proteins. NADH:ubiquinone oxidoreductase (complex I) is an extremely complicated multiprotein complex located in the inner mitochondrial membrane. Its main function is the transport of electrons from NADH to ubiquinone, which is accompanied by translocation of protons from the mitochondrial matrix to the intermembrane space. Human complex I appears to consist of 41 subunits [].; GO: 0003954 NADH dehydrogenase activity, 0008137 NADH dehydrogenase (ubiquinone) activity, 0005739 mitochondrion
Probab=84.32  E-value=2.5  Score=33.02  Aligned_cols=35  Identities=23%  Similarity=0.233  Sum_probs=23.3

Q ss_pred             HHHHHHHHhHHHHHHHhhhhheecCCCCCCCCCCCCC
Q 033739           76 YEALGWLLGGLGFFASLGALAVWNDKASKIPFVSRSL  112 (112)
Q Consensus        76 yeAl~wl~gGL~ffa~l~~la~~~Dk~Sk~p~~pk~~  112 (112)
                      ...+.++++-|||+..++++...  -.+-+|.+||+.
T Consensus       122 ~~~~~~l~~flg~~~~~~~~~~~--~~~~~P~~pKqY  156 (179)
T PF05821_consen  122 QSMLKQLFGFLGFMLFMFYLGEM--YPPYRPVMPKQY  156 (179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhh--ccCCCCCCcccC
Confidence            44567777777777777666443  345589999873


No 2  
>PF08265 YL1_C:  YL1 nuclear protein C-terminal domain;  InterPro: IPR013272 This domain is found at the C terminus in proteins of the YL1 family []. These proteins have been shown to be DNA-binding and may be transcription factors []. This domain is also found in proteins that do not belong to the YL1 family.
Probab=52.57  E-value=5.7  Score=23.06  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=16.2

Q ss_pred             hhhheecCCCCCCCCCCC
Q 033739           93 GALAVWNDKASKIPFVSR  110 (112)
Q Consensus        93 ~~la~~~Dk~Sk~p~~pk  110 (112)
                      ++-|.|.|+.+++||...
T Consensus         7 glpA~Y~DP~T~l~Y~n~   24 (30)
T PF08265_consen    7 GLPARYRDPKTGLPYANS   24 (30)
T ss_pred             CCCccccCCCCCCcccCH
Confidence            778999999999999864


No 3  
>KOG4481 consensus Uncharacterized conserved protein [Function unknown]
Probab=47.82  E-value=19  Score=29.01  Aligned_cols=41  Identities=24%  Similarity=0.153  Sum_probs=32.8

Q ss_pred             CCCCCCCCcccceeecCCCCCCCCccccccC-cccHHHHHHHHH
Q 033739           41 IVPNKPLSVNDELVWDNGTPFPEPCIDRIAD-TVGKYEALGWLL   83 (112)
Q Consensus        41 ~~P~kpLpe~~EL~WDdG~a~PEp~iDf~a~-~i~kyeAl~wl~   83 (112)
                      +.--.++|.+-.+.||.|..  ++-|-+++. +|+--|||.+|=
T Consensus        86 et~q~~fp~e~r~p~~~~f~--~~~i~rIpkgkit~~eAL~~ln  127 (194)
T KOG4481|consen   86 ETRQEEFPKEFRLPKDYHFD--EINIKRIPKGKITIVEALTFLN  127 (194)
T ss_pred             chhcccchhhcCCcccccCC--CcCcccCCCCceeHHHHHHHHh
Confidence            34456789999999998866  666888885 999999998863


No 4  
>KOG0815 consensus 60S acidic ribosomal protein P0 [Translation, ribosomal structure and biogenesis]
Probab=43.89  E-value=38  Score=28.26  Aligned_cols=45  Identities=27%  Similarity=0.405  Sum_probs=37.7

Q ss_pred             eecCCCCCCCCccccccCcccHHHHHHHHHhHHHHHHHhhhhheecCCCC
Q 033739           54 VWDNGTPFPEPCIDRIADTVGKYEALGWLLGGLGFFASLGALAVWNDKAS  103 (112)
Q Consensus        54 ~WDdG~a~PEp~iDf~a~~i~kyeAl~wl~gGL~ffa~l~~la~~~Dk~S  103 (112)
                      +.|||+-|+.-.||     |++.+++..+..|++-++.+.+.+.|-.-+|
T Consensus       192 VyDnGsiy~pevLD-----iteE~l~~~f~~~vs~va~~sL~~~ypt~as  236 (245)
T KOG0815|consen  192 VYDNGSIYNPEVLD-----ITEEDLFSKFLSGVSNVASVSLAAGYPTLAS  236 (245)
T ss_pred             EecCCcccChhhcC-----CcHHHHHHHHHHHHHHHHHHHHhcCCCcccc
Confidence            78999987765555     6888999999999999999988888866555


No 5  
>PF02935 COX7C:  Cytochrome c oxidase subunit VIIc;  InterPro: IPR004202 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  This entry represents cytochrome C subunit 7C. The yeast member of this family is called cytochrome C subunit 8P.; GO: 0004129 cytochrome-c oxidase activity; PDB: 3ABL_Y 3ABM_L 2EIM_L 3ASO_L 3AG3_Y 3AG1_Y 1OCC_Y 2DYS_Y 2OCC_L 1V54_L ....
Probab=43.42  E-value=43  Score=22.05  Aligned_cols=31  Identities=16%  Similarity=0.118  Sum_probs=18.9

Q ss_pred             ccccccCcccHHHHHHHHHhHHHHHHHhhhh
Q 033739           65 CIDRIADTVGKYEALGWLLGGLGFFASLGAL   95 (112)
Q Consensus        65 ~iDf~a~~i~kyeAl~wl~gGL~ffa~l~~l   95 (112)
                      -|=|...+--.+-...|..+|.||.+.++.+
T Consensus        28 NLPF~~~nK~~~~~~~~~f~g~GF~~PF~~~   58 (65)
T PF02935_consen   28 NLPFNVKNKWPFAVKFWGFFGSGFAAPFLIV   58 (65)
T ss_dssp             SSSS--SSHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccCcchhHHHHHHHHHHHHHHHhHHHHH
Confidence            3444444411244677889999999988744


No 6  
>PF06181 DUF989:  Protein of unknown function (DUF989);  InterPro: IPR010389 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=39.20  E-value=37  Score=28.97  Aligned_cols=40  Identities=13%  Similarity=0.173  Sum_probs=29.1

Q ss_pred             cCCCCCCC---CccccccC--cccHHHHHHHHHhHHHHHHHhhhh
Q 033739           56 DNGTPFPE---PCIDRIAD--TVGKYEALGWLLGGLGFFASLGAL   95 (112)
Q Consensus        56 DdG~a~PE---p~iDf~a~--~i~kyeAl~wl~gGL~ffa~l~~l   95 (112)
                      .-|.++.|   .+=+.+++  |--|+|+-..|+.|++++..+|+.
T Consensus        59 GGGFYh~~KY~vaP~~mP~~LhWfkWesY~TWlSGfaLl~~~Yy~  103 (300)
T PF06181_consen   59 GGGFYHVQKYLVAPEKMPEHLHWFKWESYTTWLSGFALLIVVYYF  103 (300)
T ss_pred             cccccchhhhccCcccCCccceeehhHhHHHHHHHHHHHHHHHHh
Confidence            44554444   23345666  448999999999999999999874


No 7  
>PF12351 Fig1:  Ca2+ regulator and membrane fusion protein Fig1
Probab=34.01  E-value=47  Score=25.41  Aligned_cols=28  Identities=29%  Similarity=0.519  Sum_probs=22.5

Q ss_pred             CcccH-HHHHHHHHhHHHHHHHhhhhhee
Q 033739           71 DTVGK-YEALGWLLGGLGFFASLGALAVW   98 (112)
Q Consensus        71 ~~i~k-yeAl~wl~gGL~ffa~l~~la~~   98 (112)
                      -|+++ .|++.|..++|-+..+++....|
T Consensus       152 ~~~G~~a~~l~W~aF~f~~l~~lgl~~~~  180 (182)
T PF12351_consen  152 VKVGKAAMVLGWFAFAFLLLVCLGLWVMY  180 (182)
T ss_pred             eccchhHHhHHHHHHHHHHHHHHHHHHee
Confidence            46766 99999999999888888776654


No 8  
>PF08285 DPM3:  Dolichol-phosphate mannosyltransferase subunit 3 (DPM3);  InterPro: IPR013174 This family corresponds to subunit 3 of dolichol-phosphate mannosyltransferase, an enzyme which generates mannosyl donors for glycosylphosphatidylinositols, N-glycan and protein O- and C-mannosylation. DPM3 is an integral membrane protein and plays a role in stabilising the dolichol-phosphate mannosyl transferase complex [].
Probab=32.12  E-value=40  Score=23.66  Aligned_cols=24  Identities=25%  Similarity=0.293  Sum_probs=15.9

Q ss_pred             HHHHhHHH---HHHHhhhhheecCCCC
Q 033739           80 GWLLGGLG---FFASLGALAVWNDKAS  103 (112)
Q Consensus        80 ~wl~gGL~---ffa~l~~la~~~Dk~S  103 (112)
                      .|++.-||   .+...|.+++|||.+.
T Consensus        42 ~~~Lv~fG~Ysl~~lgy~v~tFnDcpe   68 (91)
T PF08285_consen   42 FYALVSFGCYSLFTLGYGVATFNDCPE   68 (91)
T ss_pred             HHHHHHHHHHHHHHHHHhhhccCCCHH
Confidence            34444444   4445599999999864


No 9  
>PF07622 DUF1583:  Protein of unknown function (DUF1583);  InterPro: IPR011475  Most of the Rhodopirellula baltica hypothetical proteins that have this domain also match PF07619 from PFAM. 
Probab=28.44  E-value=24  Score=31.11  Aligned_cols=35  Identities=20%  Similarity=0.352  Sum_probs=26.8

Q ss_pred             CcccceeecCCCCCCCCccccccCcccH-HHHHHHH
Q 033739           48 SVNDELVWDNGTPFPEPCIDRIADTVGK-YEALGWL   82 (112)
Q Consensus        48 pe~~EL~WDdG~a~PEp~iDf~a~~i~k-yeAl~wl   82 (112)
                      ..+||.+||-|..--.||||++|=-|++ .-+--|+
T Consensus        22 ~ieYeF~~~~~~~~vhPavgR~a~l~~~~gv~~hw~   57 (399)
T PF07622_consen   22 SIEYEFFYDWDKTSVHPAVGRMAFLIDSDGVSEHWI   57 (399)
T ss_pred             eEEEEEEecCCccccccccCceEEEEcCCCceeeEe
Confidence            3589999999999999999999966654 3333343


No 10 
>PTZ00174 phosphomannomutase; Provisional
Probab=27.27  E-value=42  Score=25.66  Aligned_cols=22  Identities=18%  Similarity=0.039  Sum_probs=19.7

Q ss_pred             CccccccCcccHHHHHHHHHhH
Q 033739           64 PCIDRIADTVGKYEALGWLLGG   85 (112)
Q Consensus        64 p~iDf~a~~i~kyeAl~wl~gG   85 (112)
                      .++|..+..++|..|+.||+-=
T Consensus       178 ~~leI~~~gvsKg~al~~L~~~  199 (247)
T PTZ00174        178 ISFDVFPKGWDKTYCLRHLEND  199 (247)
T ss_pred             eEEEeeeCCCcHHHHHHHHHhh
Confidence            4899999999999999999854


No 11 
>COG3748 Predicted membrane protein [Function unknown]
Probab=26.52  E-value=78  Score=28.09  Aligned_cols=27  Identities=19%  Similarity=0.242  Sum_probs=22.9

Q ss_pred             ccCcc--cHHHHHHHHHhHHHHHHHhhhh
Q 033739           69 IADTV--GKYEALGWLLGGLGFFASLGAL   95 (112)
Q Consensus        69 ~a~~i--~kyeAl~wl~gGL~ffa~l~~l   95 (112)
                      +++|.  -|+|+-.-|+.||...+.+|+.
T Consensus        72 mPEhL~WFkWEsY~TWlSGfalL~ivYY~  100 (407)
T COG3748          72 MPEHLHWFKWEAYFTWLSGFALLCIVYYF  100 (407)
T ss_pred             CCccccchhHHHHHHHHHHHHHHHHHHHc
Confidence            56665  6899999999999999999764


No 12 
>KOG4841 consensus Dolichol-phosphate mannosyltransferase, subunit 3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]
Probab=26.07  E-value=41  Score=24.49  Aligned_cols=23  Identities=30%  Similarity=0.332  Sum_probs=15.1

Q ss_pred             HHHhHHHHHHH---hhhhheecCCCC
Q 033739           81 WLLGGLGFFAS---LGALAVWNDKAS  103 (112)
Q Consensus        81 wl~gGL~ffa~---l~~la~~~Dk~S  103 (112)
                      +++-.+|.++.   +|.+|.+||++.
T Consensus        47 ~~~l~~G~Ya~~tv~Y~VATfnDc~e   72 (95)
T KOG4841|consen   47 YLLLSAGCYALGTVGYRVATFNDCEE   72 (95)
T ss_pred             HHHHHHHhHhhhhheeeeeccCCcHH
Confidence            44444454444   399999999863


No 13 
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism]
Probab=25.74  E-value=42  Score=28.95  Aligned_cols=35  Identities=20%  Similarity=0.349  Sum_probs=30.2

Q ss_pred             HHHHHHHHhHHHHHHHhhhhheecCCCCCCCCCCC
Q 033739           76 YEALGWLLGGLGFFASLGALAVWNDKASKIPFVSR  110 (112)
Q Consensus        76 yeAl~wl~gGL~ffa~l~~la~~~Dk~Sk~p~~pk  110 (112)
                      ++...|..|++|++-.+--.-.|.|+++|.|++.+
T Consensus       194 W~sifY~~g~~g~i~~~~w~~~~~d~P~~h~~is~  228 (466)
T KOG2532|consen  194 WPSIFYVFGIVGLIWFILWFLFYSDSPSKHPNISE  228 (466)
T ss_pred             CchHHHHHHHHHHHHHHHHHHHhcCCcccCCCCCH
Confidence            67888999999999999888889999999988643


No 14 
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional
Probab=25.72  E-value=44  Score=25.41  Aligned_cols=25  Identities=28%  Similarity=0.393  Sum_probs=21.6

Q ss_pred             CccccccCcccHHHHHHHHHhHHHH
Q 033739           64 PCIDRIADTVGKYEALGWLLGGLGF   88 (112)
Q Consensus        64 p~iDf~a~~i~kyeAl~wl~gGL~f   88 (112)
                      -++|..+..++|+.|+.|+|-=+++
T Consensus       178 ~~~eI~~~g~sKg~al~~l~~~~gi  202 (272)
T PRK15126        178 DCLEVLPVGCNKGAALAVLSQHLGL  202 (272)
T ss_pred             cEEEeecCCCChHHHHHHHHHHhCC
Confidence            4899999999999999999866553


No 15 
>PF08282 Hydrolase_3:  haloacid dehalogenase-like hydrolase;  InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []. This HAD domain is found in several distinct enzymes including:  Phospholipid-transporting ATPase 1 (3.6.3.1 from EC), a putative lipid-flipping enzyme involved in cold tolerance in Arabidopsis [] 3-deoxy-D-manno-octulosonate (KDO) 8-phosphate phosphatase (3.1.3.45 from EC), which catalyses the final step in the biosynthesis of KDO - a component of lipopolysaccharide in Gram-negative bacteria [] Mannosyl-3-phosphoglycerate phosphatase (3.1.3.70 from EC), which hydrolyzes mannosyl-3-phosphoglycerate to form the osmolyte mannosylglycerate [] Phosphoglycolate phopshatase (3.1.3.18 from EC), which catalyses the dephosphorylation of 2-phosphoglycolate []  ; PDB: 2B30_B 3R4C_A 1XVI_B 3IJ5_B 3MMZ_C 3L7Y_A 1XPJ_C 1RLT_B 1RLM_B 2HF2_A ....
Probab=25.65  E-value=52  Score=23.25  Aligned_cols=25  Identities=24%  Similarity=0.226  Sum_probs=21.2

Q ss_pred             CCCccccccCcccHHHHHHHHHhHH
Q 033739           62 PEPCIDRIADTVGKYEALGWLLGGL   86 (112)
Q Consensus        62 PEp~iDf~a~~i~kyeAl~wl~gGL   86 (112)
                      .+-++|+.+.+++|..|+.+++=-+
T Consensus       174 ~~~~lei~~~~vsK~~ai~~l~~~~  198 (254)
T PF08282_consen  174 SPYFLEITPKGVSKGSAIKYLLEYL  198 (254)
T ss_dssp             ETTEEEEEETTSSHHHHHHHHHHHH
T ss_pred             cccceEEeeCCCCHHHHHHHHhhhc
Confidence            4578999999999999999998433


No 16 
>PF05116 S6PP:  Sucrose-6F-phosphate phosphohydrolase;  InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria []. SPP is a member of the Class IIB subfamily of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases. SPP catalyzes the final step in the biosynthesis of sucrose, a critically important molecule for plants. Sucrose phosphate synthase (SPS), the prior step in the biosynthesis of sucrose contains a domain which exhibits considerable similarity to SPP albeit without conservation of the catalytic residues. The catalytic machinery of the synthase resides in another domain. It seems likely that the phosphatase-like domain is involved in substrate binding, possibly binding both substrates in a "product-like" orientation prior to ligation by the synthase catalytic domain.; PDB: 1TJ5_A 2B1Q_A 1TJ4_A 1S2O_A 1U2T_A 2D2V_A 1TJ3_A 1U2S_A 2B1R_A 3GYG_B ....
Probab=24.73  E-value=53  Score=25.53  Aligned_cols=24  Identities=25%  Similarity=0.356  Sum_probs=20.0

Q ss_pred             ccccccCcccHHHHHHHHHhHHHH
Q 033739           65 CIDRIADTVGKYEALGWLLGGLGF   88 (112)
Q Consensus        65 ~iDf~a~~i~kyeAl~wl~gGL~f   88 (112)
                      .+|+.|...+|..|+.|++-=+++
T Consensus       156 ~ldilP~~a~K~~Al~~L~~~~~~  179 (247)
T PF05116_consen  156 DLDILPKGASKGAALRYLMERWGI  179 (247)
T ss_dssp             EEEEEETT-SHHHHHHHHHHHHT-
T ss_pred             eEEEccCCCCHHHHHHHHHHHhCC
Confidence            599999999999999999987754


No 17 
>cd00929 Cyt_c_Oxidase_VIIc Cytochrome c oxidase subunit VIIc. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. The VIIc subunit is found only in eukaryotes and its specific function remains unclear. Peroxide inactivation of bovine CcO coincides with the direct oxidation of tryptophan (W19) within subunit VIIc, along with other structural changes in other subunits.
Probab=24.02  E-value=74  Score=20.00  Aligned_cols=20  Identities=35%  Similarity=0.311  Sum_probs=15.8

Q ss_pred             HHHHHHHHhHHHHHHHhhhh
Q 033739           76 YEALGWLLGGLGFFASLGAL   95 (112)
Q Consensus        76 yeAl~wl~gGL~ffa~l~~l   95 (112)
                      --+..|+.+|.+|.+.+..+
T Consensus        21 ~~~~~~~ffg~GF~~PF~i~   40 (46)
T cd00929          21 LTALFHLFFGSGFSAPFIVV   40 (46)
T ss_pred             HHHHHHHHHHHHHhhhHHHH
Confidence            45678889999999988754


No 18 
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial. Sucrose phosphate synthase (SPS) and sucrose phosphate phosphatase (SPP) are the last two enzymes of sucrose biosynthesis. In cyanobacteria and plants, the C-terminal region of most or all versions of SPS has a domain homologous to the known SPP. This domain may serve a binding or regulatory rather than catalytic function. Sequences in this family are bacterial C-terminal regions found in all but two of the putative bacterial sucrose phosphate synthases described by TIGR02472.
Probab=23.51  E-value=55  Score=24.42  Aligned_cols=24  Identities=25%  Similarity=0.111  Sum_probs=20.1

Q ss_pred             CccccccCcccHHHHHHHHHhHHH
Q 033739           64 PCIDRIADTVGKYEALGWLLGGLG   87 (112)
Q Consensus        64 p~iDf~a~~i~kyeAl~wl~gGL~   87 (112)
                      -++|+.+..++|.+|+.|++-=++
T Consensus       149 ~~~ei~~~~~~K~~al~~l~~~~g  172 (236)
T TIGR02471       149 WFLDVLPLRASKGLALRYLSYRWG  172 (236)
T ss_pred             ceEEEeeCCCChHHHHHHHHHHhC
Confidence            358999999999999999986444


No 19 
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily. catalyze the same reaction as SPP.
Probab=23.45  E-value=57  Score=23.62  Aligned_cols=23  Identities=30%  Similarity=0.190  Sum_probs=19.7

Q ss_pred             ccccccCcccHHHHHHHHHhHHH
Q 033739           65 CIDRIADTVGKYEALGWLLGGLG   87 (112)
Q Consensus        65 ~iDf~a~~i~kyeAl~wl~gGL~   87 (112)
                      ++|..++.++|.+++.|++-=++
T Consensus       140 ~~ei~~~~~~K~~~i~~l~~~~~  162 (225)
T TIGR01482       140 DIHILPQGVNKGVAVKKLKEKLG  162 (225)
T ss_pred             EEEEeeCCCCHHHHHHHHHHHhC
Confidence            78999999999999999986443


No 20 
>PRK10976 putative hydrolase; Provisional
Probab=23.33  E-value=50  Score=24.89  Aligned_cols=24  Identities=33%  Similarity=0.465  Sum_probs=21.0

Q ss_pred             CccccccCcccHHHHHHHHHhHHH
Q 033739           64 PCIDRIADTVGKYEALGWLLGGLG   87 (112)
Q Consensus        64 p~iDf~a~~i~kyeAl~wl~gGL~   87 (112)
                      -++|..+..++|..|+.|+|-=|+
T Consensus       180 ~~~eI~~~gvsKg~al~~l~~~lg  203 (266)
T PRK10976        180 TCLEVMAGGVSKGHALEAVAKKLG  203 (266)
T ss_pred             ceEEEEcCCCChHHHHHHHHHHcC
Confidence            489999999999999999986554


No 21 
>PRK10513 sugar phosphate phosphatase; Provisional
Probab=23.22  E-value=54  Score=24.71  Aligned_cols=24  Identities=21%  Similarity=0.196  Sum_probs=20.8

Q ss_pred             CccccccCcccHHHHHHHHHhHHH
Q 033739           64 PCIDRIADTVGKYEALGWLLGGLG   87 (112)
Q Consensus        64 p~iDf~a~~i~kyeAl~wl~gGL~   87 (112)
                      -++|..+..++|..|+.|+|-=++
T Consensus       186 ~~~eI~~~gvsKg~al~~l~~~~g  209 (270)
T PRK10513        186 YFLEILDKRVNKGTGVKSLAEHLG  209 (270)
T ss_pred             eeEEEeCCCCChHHHHHHHHHHhC
Confidence            478999999999999999996544


No 22 
>PRK13836 conjugal transfer protein TrbF; Provisional
Probab=21.91  E-value=48  Score=25.64  Aligned_cols=33  Identities=18%  Similarity=0.443  Sum_probs=17.4

Q ss_pred             HHHHHHHHhHH-HHHHHhh-hhh-eecCCCCC-CCCC
Q 033739           76 YEALGWLLGGL-GFFASLG-ALA-VWNDKASK-IPFV  108 (112)
Q Consensus        76 yeAl~wl~gGL-~ffa~l~-~la-~~~Dk~Sk-~p~~  108 (112)
                      ..+.+|.+.++ +++..+. +.+ .|--..|| .||+
T Consensus        27 ~~~~~W~~~a~~~l~~a~~~v~~~~~l~~~~~i~PyV   63 (220)
T PRK13836         27 KAAAAWRIVGILGLTMAVIGFGYALYQSTQVKLVPYI   63 (220)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcccCCeEEeEE
Confidence            34688877777 4433332 221 24444455 7775


No 23 
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed
Probab=21.82  E-value=83  Score=24.20  Aligned_cols=25  Identities=20%  Similarity=0.345  Sum_probs=22.6

Q ss_pred             CccccccCcccHHHHHHHHHhHHHH
Q 033739           64 PCIDRIADTVGKYEALGWLLGGLGF   88 (112)
Q Consensus        64 p~iDf~a~~i~kyeAl~wl~gGL~f   88 (112)
                      .++|..+..++|..|+.++|-=++.
T Consensus       177 ~~iEi~~~g~sKg~al~~l~~~lgi  201 (271)
T PRK03669        177 RFWHVLDASAGKDQAANWLIATYQQ  201 (271)
T ss_pred             eeEEEecCCCCHHHHHHHHHHHHHh
Confidence            4899999999999999999987766


No 24 
>PF08802 CytB6-F_Fe-S:  Cytochrome B6-F complex Fe-S subunit ;  InterPro: IPR014909 The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. The cytochrome b6-f complex has 4 large subunits, these are: cytochrome b6, subunit IV (17 kDa polypeptide, PetD), cytochrome f and the Rieske protein, while the 4 small subunits are: PetG, PetL, PetM and PetN. The complex functions as a dimer.  This protein corresponds to the alpha helical transmembrane domain of the cytochrome b6-f complex Rieske iron-sulphur subunit. ; GO: 0009496 plastoquinol-plastocyanin reductase activity, 0051537 2 iron, 2 sulfur cluster binding, 0055114 oxidation-reduction process, 0042651 thylakoid membrane; PDB: 1Q90_R 1VF5_D 2E75_D 2E74_D 2E76_D 2D2C_Q 2ZT9_D.
Probab=21.33  E-value=1.2e+02  Score=18.60  Aligned_cols=21  Identities=19%  Similarity=0.336  Sum_probs=15.0

Q ss_pred             CcccHHHHHHHHHhHHHHHHH
Q 033739           71 DTVGKYEALGWLLGGLGFFAS   91 (112)
Q Consensus        71 ~~i~kyeAl~wl~gGL~ffa~   91 (112)
                      |.+++.+.+-|+++|-.-...
T Consensus         4 Pdm~RR~lmN~ll~Gava~~a   24 (39)
T PF08802_consen    4 PDMSRRQLMNLLLGGAVAVPA   24 (39)
T ss_dssp             --HHHHHHHHHHHHHHHHHHH
T ss_pred             CChhHHHHHHHHHHhhHHHHH
Confidence            678999999999988654433


No 25 
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms]
Probab=20.44  E-value=56  Score=25.45  Aligned_cols=14  Identities=36%  Similarity=0.425  Sum_probs=11.4

Q ss_pred             ccceeecCCCCCCC
Q 033739           50 NDELVWDNGTPFPE   63 (112)
Q Consensus        50 ~~EL~WDdG~a~PE   63 (112)
                      ..-++||||..+|+
T Consensus       160 ~~l~v~deg~G~~~  173 (221)
T COG3920         160 FLLTVWDEGGGPPV  173 (221)
T ss_pred             EEEEEEECCCCCCC
Confidence            35689999999776


No 26 
>PF00976 ACTH_domain:  Corticotropin ACTH domain;  InterPro: IPR013531 Pro-opiomelanocortin is present in high levels in the pituitary and is processed into 3 major peptide families: adrenocorticotrophin (ACTH); alpha-, beta- and gamma-melanocyte- stimulating hormones (MSH); and beta-endorphin []. ACTH regulates the synthesis and release of glucocorticoids and, to some extent, aldosterone in the adrenal cortex. It is synthesised and released in response to corticotrophin-releasing factor at times of stress (i.e. heat, cold, infection, etc.), its release leading to increased metabolism. The action of MSH in man is poorly understood, but it may be involved in temperature regulation []. Full activity of ACTH resides in the first 20 N-terminal amino acids, the first 13 of which are identical to alpha-MSH [, ]. The function of this region is not known, though it is found near the centre of these proteins.
Probab=20.11  E-value=77  Score=19.78  Aligned_cols=20  Identities=35%  Similarity=0.479  Sum_probs=17.9

Q ss_pred             CCCCCCCCCCCCCCCCcccc
Q 033739           33 MGLPVGKHIVPNKPLSVNDE   52 (112)
Q Consensus        33 ~g~Pv~~~~~P~kpLpe~~E   52 (112)
                      +|-|+++-+.|-|..|...|
T Consensus         9 wgkp~g~KRRPvKVypn~~E   28 (39)
T PF00976_consen    9 WGKPVGRKRRPVKVYPNGAE   28 (39)
T ss_pred             ccCCCCcccCcceeCCCCcc
Confidence            78999999999999888777


Done!