Citrus Sinensis ID: 033748


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MARIKVHELRQKSKVDLLNQLKELKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIRRRLTKHQVLFLLLLFFLIFF
cccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccHHHHHHHHHHHHHHHc
***IKVH*L******DLLNQLKELKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIRRRLTKHQVLFLLLLFFLIFF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARIKVHELRQKSxxxxxxxxxxxxxxxxxxxxxKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKAALREAYKNKKFLPLDLRPKKTRAIRRRLTKHQVLFLLLLFFLIFF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L35-2 confidentO80626
60S ribosomal protein L35-4 confidentQ9LZ41
60S ribosomal protein L35-1 confidentQ9SF53

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain v
Confidence level:very confident
Coverage over the Query: 29-64
View the alignment between query and template
View the model in PyMOL