Query         033754
Match_columns 112
No_of_seqs    106 out of 460
Neff          3.9 
Searched_HMMs 46136
Date          Fri Mar 29 05:55:40 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033754.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033754hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR00030 S21p ribosomal prote  99.9 1.6E-21 3.4E-26  126.6   6.5   56   38-94      1-57  (58)
  2 PRK00270 rpsU 30S ribosomal pr  99.8   4E-20 8.6E-25  122.1   7.1   57   38-95      2-59  (64)
  3 COG0828 RpsU Ribosomal protein  99.8 1.2E-18 2.7E-23  116.8   7.8   56   38-94      2-58  (67)
  4 PF01165 Ribosomal_S21:  Riboso  99.6 3.4E-19 7.4E-24  113.8  -9.4   56   38-94      1-57  (57)
  5 TIGR03595 Obg_CgtA_exten Obg f  70.8     5.1 0.00011   26.3   2.8   25   46-70     28-52  (69)
  6 PF09269 DUF1967:  Domain of un  68.7     3.6 7.9E-05   26.9   1.7   25   46-70     28-52  (69)
  7 cd04937 ACT_AKi-DapG-BS_2 ACT   67.5     3.1 6.7E-05   25.8   1.1   47   12-58     12-62  (64)
  8 PF00472 RF-1:  RF-1 domain;  I  60.9      14 0.00031   26.1   3.7   51   11-62     18-74  (113)
  9 PRK09256 hypothetical protein;  55.7      52  0.0011   24.5   6.0   49   36-88     68-121 (138)
 10 TIGR00756 PPR pentatricopeptid  55.4      11 0.00024   19.1   1.8   21   42-63     11-31  (35)
 11 PF07660 STN:  Secretin and Ton  45.8      15 0.00032   21.7   1.5   26   29-54      7-32  (52)
 12 PRK00286 xseA exodeoxyribonucl  40.6      18  0.0004   30.4   1.8   26   45-70    104-129 (438)
 13 COG1570 XseA Exonuclease VII,   40.3      13 0.00029   32.8   0.9   47   24-70     83-129 (440)
 14 PF03799 FtsQ:  Cell division p  36.9      57  0.0012   21.3   3.4   32   30-61     72-103 (117)
 15 PF13812 PPR_3:  Pentatricopept  36.7      37  0.0008   17.4   2.0   21   42-63     12-32  (34)
 16 COG0370 FeoB Fe2+ transport sy  34.5      16 0.00035   33.8   0.5   34   12-45      9-43  (653)
 17 PF13840 ACT_7:  ACT domain ; P  34.4      42 0.00091   21.1   2.3   22   35-56     44-65  (65)
 18 TIGR03884 sel_bind_Methan sele  33.0      67  0.0014   22.1   3.3   32   31-62      5-42  (74)
 19 PF09413 DUF2007:  Domain of un  32.5      52  0.0011   20.3   2.5   18   38-55     46-63  (67)
 20 PF12854 PPR_1:  PPR repeat      32.4      40 0.00087   18.6   1.8   15   42-56     18-32  (34)
 21 PF01535 PPR:  PPR repeat;  Int  32.0      43 0.00093   16.7   1.8   18   42-59     11-28  (31)
 22 PF14559 TPR_19:  Tetratricopep  31.5      33 0.00071   20.3   1.4   20   43-62      3-22  (68)
 23 TIGR00237 xseA exodeoxyribonuc  30.6      24 0.00052   30.2   1.0   26   45-70     98-123 (432)
 24 PF02421 FeoB_N:  Ferrous iron   30.0      10 0.00022   28.4  -1.2   28   19-46     14-41  (156)
 25 PF13041 PPR_2:  PPR repeat fam  29.8      52  0.0011   18.9   2.1   21   42-63     14-34  (50)
 26 smart00804 TAP_C C-terminal do  28.3      45 0.00097   21.8   1.7   24   43-66     36-60  (63)
 27 cd04917 ACT_AKiii-LysC-EC_2 AC  28.2      51  0.0011   20.0   1.9   22   37-58     41-62  (64)
 28 PF11393 IcmL:  Macrophage kill  28.1      64  0.0014   22.5   2.6   27   48-75     52-78  (108)
 29 cd04915 ACT_AK-Ectoine_2 ACT d  27.6      55  0.0012   20.5   2.0   22   37-58     43-64  (66)
 30 COG1433 Uncharacterized conser  27.5      54  0.0012   24.0   2.2   32   25-56     74-106 (121)
 31 PF02579 Nitro_FeMo-Co:  Dinitr  27.2      77  0.0017   20.1   2.7   26   30-55     67-93  (94)
 32 cd04936 ACT_AKii-LysC-BS-like_  26.1      59  0.0013   18.7   1.9   23   36-58     39-61  (63)
 33 PF12221 HflK_N:  Bacterial mem  25.9      64  0.0014   19.7   2.0   15   46-60     22-36  (42)
 34 PRK13780 phosphocarrier protei  25.4 1.1E+02  0.0025   20.6   3.4   32   32-63     55-86  (88)
 35 PF13428 TPR_14:  Tetratricopep  25.2      78  0.0017   17.9   2.2   20   43-62     13-32  (44)
 36 TIGR03072 release_prfH putativ  25.1   2E+02  0.0044   22.7   5.2   50   12-61    113-167 (200)
 37 cd04920 ACT_AKiii-DAPDC_2 ACT   23.4      71  0.0015   19.7   2.0   23   36-58     39-61  (63)
 38 PF13181 TPR_8:  Tetratricopept  23.1   1E+02  0.0023   15.8   2.3   17   44-60     14-30  (34)
 39 PF02996 Prefoldin:  Prefoldin   22.4 1.2E+02  0.0026   20.5   3.1   31   30-60     53-88  (120)
 40 PF04108 APG17:  Autophagy prot  22.3 1.5E+02  0.0032   25.3   4.2   44   61-105   349-392 (412)
 41 TIGR02663 nifX nitrogen fixati  22.2      80  0.0017   21.9   2.2   33   30-62     77-111 (119)
 42 cd04918 ACT_AK1-AT_2 ACT domai  21.8      78  0.0017   19.5   1.9   22   37-58     42-63  (65)
 43 PF00486 Trans_reg_C:  Transcri  21.6      46 0.00099   20.4   0.8   22   41-62     40-61  (77)
 44 cd08003 WGR_PARP2_like WGR dom  21.2      90   0.002   21.9   2.3   29   46-77     63-92  (103)
 45 TIGR00019 prfA peptide chain r  21.0 2.5E+02  0.0053   24.2   5.3   51   12-62    228-283 (360)
 46 TIGR00293 prefoldin, archaeal   21.0 1.6E+02  0.0034   20.4   3.5   31   30-60     62-97  (126)
 47 PF00625 Guanylate_kin:  Guanyl  20.9 1.3E+02  0.0028   21.8   3.2   24   38-61    160-183 (183)
 48 cd00584 Prefoldin_alpha Prefol  20.7 1.5E+02  0.0033   20.5   3.4   31   30-60     63-98  (129)
 49 smart00862 Trans_reg_C Transcr  20.3      35 0.00077   20.8   0.1   20   43-62     43-62  (78)
 50 PF11172 DUF2959:  Protein of u  20.3 4.6E+02    0.01   21.1   7.0   52   41-92     56-126 (201)
 51 PRK05783 hypothetical protein;  20.1 1.7E+02  0.0037   20.1   3.5   35   26-60     32-66  (84)

No 1  
>TIGR00030 S21p ribosomal protein S21. This model describes bacterial ribosomal protein S21 and most mitochondrial and chloroplast equivalents.
Probab=99.85  E-value=1.6e-21  Score=126.59  Aligned_cols=56  Identities=36%  Similarity=0.489  Sum_probs=52.9

Q ss_pred             eEEEecCC-CHHHHHHHHHHhHhhhhhHHHHHhhhcccCCchHHHHHHHHHHHHHHHh
Q 033754           38 IRVKVFNG-NLEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKIRS   94 (112)
Q Consensus        38 i~V~V~~g-~IE~ALRrfKRk~~keGIl~eiK~R~~~YeKPSekRrrk~~ea~rR~rk   94 (112)
                      ++|.|+|| |||+||++||++|+++||+.|+|+| +||||||++|+++..+|.+++++
T Consensus         1 ~~V~V~~~e~ie~alrrfkr~~~~~gil~e~r~r-~~yeKPs~krkrk~~~a~rr~~k   57 (58)
T TIGR00030         1 PTVKVKEGESIDSALRRFKRKLEKEGILRELKKR-RYYEKPSERRRRKEKAAAKRIRK   57 (58)
T ss_pred             CeeEeCCCCcHHHHHHHHHHHHHHcchHHHHHHH-HhhcCHHHHHHHHHHHHHHHHhc
Confidence            46889998 6999999999999999999999999 99999999999999999999875


No 2  
>PRK00270 rpsU 30S ribosomal protein S21; Reviewed
Probab=99.82  E-value=4e-20  Score=122.05  Aligned_cols=57  Identities=30%  Similarity=0.427  Sum_probs=53.7

Q ss_pred             eEEEecCC-CHHHHHHHHHHhHhhhhhHHHHHhhhcccCCchHHHHHHHHHHHHHHHhH
Q 033754           38 IRVKVFNG-NLEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKIRSQ   95 (112)
Q Consensus        38 i~V~V~~g-~IE~ALRrfKRk~~keGIl~eiK~R~~~YeKPSekRrrk~~ea~rR~rkq   95 (112)
                      +.|.|+|| |||.||++||++|+++||+.|+|++ +||||||++|+++..+|.++.++.
T Consensus         2 ~~V~V~~~e~ie~Alrrfkr~~~k~gil~e~r~r-~~yekPs~krkrk~~~a~rr~~k~   59 (64)
T PRK00270          2 PQVKVRENESIDKALRRFKRKVEKAGILRELRRR-EFYEKPSEKRKRKKAAARKRRRKK   59 (64)
T ss_pred             CeeEeCCCChHHHHHHHHHHHHHHcchHHHHHHH-HhhcCHHHHHHHHHHHHHHHHHHH
Confidence            57889998 6999999999999999999999999 999999999999999999998773


No 3  
>COG0828 RpsU Ribosomal protein S21 [Translation, ribosomal structure and biogenesis]
Probab=99.77  E-value=1.2e-18  Score=116.76  Aligned_cols=56  Identities=30%  Similarity=0.348  Sum_probs=52.5

Q ss_pred             eEEEecCC-CHHHHHHHHHHhHhhhhhHHHHHhhhcccCCchHHHHHHHHHHHHHHHh
Q 033754           38 IRVKVFNG-NLEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKIRS   94 (112)
Q Consensus        38 i~V~V~~g-~IE~ALRrfKRk~~keGIl~eiK~R~~~YeKPSekRrrk~~ea~rR~rk   94 (112)
                      ..|.|++| +||.||++||++++++||+.|++.+ +||||||++++++..+|.++..+
T Consensus         2 ~~v~V~ene~~d~ALrrFKr~~~k~gil~e~k~r-~~yEkPs~krkrK~a~a~kr~~k   58 (67)
T COG0828           2 PQVKVRENEPLDKALRRFKRKVEKEGILREMKER-EFYEKPSEKRKRKKAAARKRKFK   58 (67)
T ss_pred             CeeeecCCChHHHHHHHHHHHHHHHHHHHHHHHH-HhccCchHHHHHHHHHHHHHHHH
Confidence            46788888 5999999999999999999999999 99999999999999999998877


No 4  
>PF01165 Ribosomal_S21:  Ribosomal protein S21;  InterPro: IPR001911 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Evidence suggests that, in prokaryotes, the peptidyl transferase reaction is performed by the large subunit 23S rRNA, whereas proteins probably have a greater role in eukaryote ribosomes. Most of the proteins lie close to, or on the surface of, the 30S subunit, arranged peripherally around the rRNA []. The small subunit ribosomal proteins can be categorised as primary binding proteins, which bind directly and independently to 16S rRNA; secondary binding proteins, which display no specific affinity for 16S rRNA, but its assembly is contingent upon the presence of one or more primary binding proteins; and tertiary binding proteins, which require the presence of one or more secondary binding proteins and sometimes other tertiary binding proteins. The small ribosomal subunit protein S21 contains 55-70 amino acid residues, and has only been found in eubacteria to date, though it has been reported that plant chloroplasts and mammalian mitochondria contain ribosomal subunit protein S21. Experimental evidence has revealed that S21 is well exposed on the surface of the Escherichia coli ribosome [], and is one of the 'split proteins': these are a discrete group that are selectively removed from 30S subunits under low salt conditions and are required for the formation of activated 30S reconstitution intermediate (RI*) particles.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2VHO_U 3J18_U 2AVY_U 3OFO_U 3OFP_U 2WWL_U 3J0X_X 3IZV_Y 3ORA_U 3IZW_Y ....
Probab=99.63  E-value=3.4e-19  Score=113.75  Aligned_cols=56  Identities=34%  Similarity=0.452  Sum_probs=49.3

Q ss_pred             eEEEecCC-CHHHHHHHHHHhHhhhhhHHHHHhhhcccCCchHHHHHHHHHHHHHHHh
Q 033754           38 IRVKVFNG-NLEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNLERKIRS   94 (112)
Q Consensus        38 i~V~V~~g-~IE~ALRrfKRk~~keGIl~eiK~R~~~YeKPSekRrrk~~ea~rR~rk   94 (112)
                      |+|.|.+| |+|.||++|+++|+++||+.|++.+ +||||||++|+++..++.+++++
T Consensus         1 v~V~V~~~~~~e~Alrr~~r~~~~~gi~~~~r~r-~~yekps~kRkrk~~~~~rr~~k   57 (57)
T PF01165_consen    1 VTVKVRDGEDVERALRRFKRKVRRNGILKELRKR-RFYEKPSEKRKRKRSERWRRRFK   57 (57)
T ss_dssp             ---EEESSSSSSSSSGTTCCTSSTTHHHTTTSSS-B-SSSCCCCTTHCCCCCTHHHHH
T ss_pred             CeeecCCCCCHHHHHHHHHHHHHHcChHHHHHHH-HhcCCHHHHHHHHHHHHHHHHhC
Confidence            67999888 7999999999999999999999999 99999999999999999988764


No 5  
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension. CgtA (see model TIGR02729) is a broadly conserved member of the obg family of GTPases associated with ribosome maturation. This model represents a unique C-terminal domain found in some but not all sequences of CgtA. This region is preceded, and may be followed, by a region of low-complexity sequence.
Probab=70.83  E-value=5.1  Score=26.27  Aligned_cols=25  Identities=24%  Similarity=0.517  Sum_probs=22.6

Q ss_pred             CHHHHHHHHHHhHhhhhhHHHHHhh
Q 033754           46 NLEQALSWMQRKMQSSGIERLIKRE   70 (112)
Q Consensus        46 ~IE~ALRrfKRk~~keGIl~eiK~R   70 (112)
                      +-+.|+++|.+.|.+.||.+.|++.
T Consensus        28 ~~~e~~~~f~~~L~~~Gv~~~L~~~   52 (69)
T TIGR03595        28 NNDENLRRFARKLKKLGVEDALRKA   52 (69)
T ss_pred             CCHHHHHHHHHHHHHCCHHHHHHHc
Confidence            6678999999999999999999874


No 6  
>PF09269 DUF1967:  Domain of unknown function (DUF1967);  InterPro: IPR015349 The Obg family comprises a group of ancient P-loop small G proteins (GTPases) belonging to the TRAFAC (for translation factors) class and can be subdivided into several distinct protein subfamilies []. OBG GTPases have been found in both prokaryotes and eukaryotes []. The structure of the OBG GTPase from Thermus thermophilus has been determined []. This entry represents a C-terminal domain found in certain OBG GTPases. This domain contains a four-stranded beta sheet and three alpha helices flanked by an additional beta strand. It is predominantly found in the bacterial GTP-binding protein Obg, and is functionally uncharacterised. ; GO: 0000166 nucleotide binding; PDB: 1UDX_A.
Probab=68.73  E-value=3.6  Score=26.94  Aligned_cols=25  Identities=28%  Similarity=0.601  Sum_probs=21.4

Q ss_pred             CHHHHHHHHHHhHhhhhhHHHHHhh
Q 033754           46 NLEQALSWMQRKMQSSGIERLIKRE   70 (112)
Q Consensus        46 ~IE~ALRrfKRk~~keGIl~eiK~R   70 (112)
                      +-+.|+.+|.++|.+.||.++|++.
T Consensus        28 ~~~e~~~rf~~~L~~~Gv~~~L~~~   52 (69)
T PF09269_consen   28 DDEESLRRFQRKLKKMGVEKALRKA   52 (69)
T ss_dssp             -TGGGHHHHHHHHHHTTHHHHHHTT
T ss_pred             CCHHHHHHHHHHHHHCCHHHHHHHc
Confidence            4457899999999999999999874


No 7  
>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI. This CD includes the C-terminal of the two ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI, a monofunctional class enzyme found in Bacilli (Bacillus subtilis (BS) strain 168), Clostridia, and Actinobacteria bacterial species. In B. subtilis, the regulation of the diaminopimelate-lysine biosynthetic pathway involves dual control by diaminopimelate and lysine, effected through separate diaminopimelate- and lysine-sensitive AK isoenzymes. AKI activity is invariant during the exponential and stationary phases of growth and is not altered by addition of amino acids to the growth medium. The role of this isoenzyme is most likely to provide a constant level of aspartyl-beta-phosphate for the biosynthesis of diaminopimelate for peptidoglycan synthesis and dipicolinate during sporulation. The BS AKI is tetrameric consisting of two alpha and two beta subunits; th
Probab=67.49  E-value=3.1  Score=25.76  Aligned_cols=47  Identities=9%  Similarity=0.087  Sum_probs=29.5

Q ss_pred             ccCCCCcccccccccccccccc----cccceEEEecCCCHHHHHHHHHHhH
Q 033754           12 LTQPSQGLNLFSRNQCQRHQVQ----QWRGIRVKVFNGNLEQALSWMQRKM   58 (112)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~v~----q~~gi~V~V~~g~IE~ALRrfKRk~   58 (112)
                      ...|+-....|+.++-..-.+.    .-..|.+.|.+++.++|++.+.+.+
T Consensus        12 ~~~~gi~~~if~aL~~~~I~v~~~~~Se~~is~~v~~~~~~~av~~Lh~~f   62 (64)
T cd04937          12 RGVPGVMAKIVGALSKEGIEILQTADSHTTISCLVSEDDVKEAVNALHEAF   62 (64)
T ss_pred             cCCcCHHHHHHHHHHHCCCCEEEEEcCccEEEEEEcHHHHHHHHHHHHHHh
Confidence            3444445555555543322232    2336778888889999999998765


No 8  
>PF00472 RF-1:  RF-1 domain;  InterPro: IPR000352 Peptide chain release factors (RFs) are required for the termination of protein biosynthesis []. At present two classes of RFs can be distinguished. Class I RFs bind to ribosomes that have encountered a stop codon at their decoding site and induce release of the nascent polypeptide. Class II RFs are GTP-binding proteins that interact with class I RFs and enhance class I RF activity. In prokaryotes there are two class I RFs that act in a codon specific manner []: RF-1 (gene prfA) mediates UAA and UAG-dependent termination while RF-2 (gene prfB) mediates UAA and UGA-dependent termination. RF-1 and RF-2 are structurally and evolutionary related proteins which have been shown to be part of a larger family [].; GO: 0003747 translation release factor activity, 0006415 translational termination; PDB: 2JY9_A 1ZBT_A 1GQE_A 3F1G_X 3F1E_X 1RQ0_C 4DH9_Y 2JVA_A 1J26_A 3D5A_X ....
Probab=60.87  E-value=14  Score=26.08  Aligned_cols=51  Identities=20%  Similarity=0.279  Sum_probs=37.2

Q ss_pred             cccCCCCccccccccccccccccccc-ceEEEecCC-----CHHHHHHHHHHhHhhhh
Q 033754           11 YLTQPSQGLNLFSRNQCQRHQVQQWR-GIRVKVFNG-----NLEQALSWMQRKMQSSG   62 (112)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~v~q~~-gi~V~V~~g-----~IE~ALRrfKRk~~keG   62 (112)
                      ++++.|.|-|-+|...-.-. +...| ||+|.+.+.     |.+.||.+|.-++...-
T Consensus        18 ~~RssGpGGQ~VNk~~s~V~-l~h~ptgi~v~~~~~Rsq~~Nr~~A~~~L~~~l~~~~   74 (113)
T PF00472_consen   18 FSRSSGPGGQNVNKTNSKVR-LRHIPTGIVVKCQESRSQHQNREDALEKLREKLDEAY   74 (113)
T ss_dssp             EEESSSSSSCHHHSSSEEEE-EEETTTTEEEEEESSSSHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEecCCCCCCcccccCCEEE-EEEecccEEEEEcccCCHHHHHHHHHHHHHHHHHHHH
Confidence            46677777788877544422 33334 899999863     99999999999998765


No 9  
>PRK09256 hypothetical protein; Provisional
Probab=55.75  E-value=52  Score=24.47  Aligned_cols=49  Identities=20%  Similarity=0.093  Sum_probs=33.8

Q ss_pred             cceEEEecCC-----CHHHHHHHHHHhHhhhhhHHHHHhhhcccCCchHHHHHHHHHH
Q 033754           36 RGIRVKVFNG-----NLEQALSWMQRKMQSSGIERLIKREQRHHIKNSEKRVLARKNL   88 (112)
Q Consensus        36 ~gi~V~V~~g-----~IE~ALRrfKRk~~keGIl~eiK~R~~~YeKPSekRrrk~~ea   88 (112)
                      ..++|.+.+.     |.+.||.+|..++...-...  ++  +--.||+..-++++.+.
T Consensus        68 g~l~i~~~~~RSQ~~Nr~~al~kL~~~i~~~~~~p--~~--r~~tk~~~~~~~rRl~~  121 (138)
T PRK09256         68 GVIVIKAQEFRSQERNREDALERLVALIREALKPP--KK--RRATKPTRGSKERRLES  121 (138)
T ss_pred             CcEEEEECCcCCHHHHHHHHHHHHHHHHHHHhhcc--cc--ccCCcccHHHHHHHHHH
Confidence            3588888873     99999999999999876533  22  33577876554444443


No 10 
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif). This family has a similar consensus to the TPR domain (tetratricopeptide), pfam pfam00515, a 33-residue repeat. It is predicted to form a pair of antiparallel helices similar to that of TPR.
Probab=55.43  E-value=11  Score=19.09  Aligned_cols=21  Identities=29%  Similarity=0.506  Sum_probs=15.7

Q ss_pred             ecCCCHHHHHHHHHHhHhhhhh
Q 033754           42 VFNGNLEQALSWMQRKMQSSGI   63 (112)
Q Consensus        42 V~~g~IE~ALRrfKRk~~keGI   63 (112)
                      ++.|++|+|+..|.... +.|+
T Consensus        11 ~~~~~~~~a~~~~~~M~-~~g~   31 (35)
T TIGR00756        11 CKAGRVEEALELFKEML-ERGI   31 (35)
T ss_pred             HHCCCHHHHHHHHHHHH-HcCC
Confidence            46789999999998754 4453


No 11 
>PF07660 STN:  Secretin and TonB N terminus short domain;  InterPro: IPR011662 This is a conserved region found at the N-terminal region of bacterial proteins involved in either protein secretion or the uptake of selective substrates, including:   Bundle-forming pilus protein B, an outer-membrane protein absolutely required for pilus biogenesis, and for enteropathogenic Escherichia coli localized adherence and autoaggregation []. PilQ, which is required for type IV pilus biogenesis and competence and is thought to function both as a pore for exit of the pilus and as a channel for entry of haem and antimicrobial agents and uptake of transforming DNA []. PupB, a specific receptor for the siderophores ferric pseudobactin BN8 and ferric pseudobactin BN7, iron chelating molecules that allow the organism to extract iron from the environment, especially under iron-restricted conditions []. TonB, which couples the electrochemical potential of the cytoplasmic membrane to the active transport of iron-siderophores and vitamin B12 across the outer membrane [].  ; GO: 0019867 outer membrane; PDB: 2D1U_A 1ZZV_A 2W75_B 2O5P_A 2W77_A 2W16_A 2W6U_B 2W6T_A 2W76_B 2W78_B ....
Probab=45.79  E-value=15  Score=21.72  Aligned_cols=26  Identities=27%  Similarity=0.322  Sum_probs=16.2

Q ss_pred             ccccccccceEEEecCCCHHHHHHHH
Q 033754           29 RHQVQQWRGIRVKVFNGNLEQALSWM   54 (112)
Q Consensus        29 ~~~v~q~~gi~V~V~~g~IE~ALRrf   54 (112)
                      +..+...+.+.|.+++-++|+||..+
T Consensus         7 ~~~v~~~~~vsl~~~~~~~~~~L~~l   32 (52)
T PF07660_consen    7 DDDVNGKKKVSLDVKNMSLEEALDQL   32 (52)
T ss_dssp             CCCCTT-BE--EE-EEE-HHHHHHHH
T ss_pred             HHHhCCCcceeEEcCCcCHHHHHHHH
Confidence            35577778888988788999999764


No 12 
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed
Probab=40.57  E-value=18  Score=30.41  Aligned_cols=26  Identities=19%  Similarity=0.394  Sum_probs=23.5

Q ss_pred             CCHHHHHHHHHHhHhhhhhHHHHHhh
Q 033754           45 GNLEQALSWMQRKMQSSGIERLIKRE   70 (112)
Q Consensus        45 g~IE~ALRrfKRk~~keGIl~eiK~R   70 (112)
                      |++..++..+|++|+++|++..-+++
T Consensus       104 G~l~~~~~~lk~~L~~eGlfd~~~k~  129 (438)
T PRK00286        104 GALAAAFEQLKEKLAAEGLFDPERKK  129 (438)
T ss_pred             cHHHHHHHHHHHHHHHCCCCChhhcC
Confidence            69999999999999999999877665


No 13 
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair]
Probab=40.31  E-value=13  Score=32.76  Aligned_cols=47  Identities=15%  Similarity=0.025  Sum_probs=32.4

Q ss_pred             cccccccccccccceEEEecCCCHHHHHHHHHHhHhhhhhHHHHHhh
Q 033754           24 RNQCQRHQVQQWRGIRVKVFNGNLEQALSWMQRKMQSSGIERLIKRE   70 (112)
Q Consensus        24 ~~~~~~~~v~q~~gi~V~V~~g~IE~ALRrfKRk~~keGIl~eiK~R   70 (112)
                      ++|-+++.-|-.-.-......|++-.++-.+|++|..||++.+-+++
T Consensus        83 s~Y~~rG~YQi~~~~~~p~G~G~L~~~~E~lK~kL~aEGlFd~~~Kk  129 (440)
T COG1570          83 SLYEPRGDYQIVAESMEPAGLGALYLAFEQLKAKLAAEGLFDPERKK  129 (440)
T ss_pred             EEEcCCCceEEEEecCCcCChhHHHHHHHHHHHHHHhCCCcChhhcC
Confidence            34444444443322223344469999999999999999999987765


No 14 
>PF03799 FtsQ:  Cell division protein FtsQ;  InterPro: IPR005548 FtsQ is one of several cell division proteins. FtsQ interacts with other Fts proteins, reviewed in []. The precise function of FtsQ is unknown.; PDB: 2VH1_B 2VH2_B 2ALJ_A 1YR1_A.
Probab=36.90  E-value=57  Score=21.28  Aligned_cols=32  Identities=16%  Similarity=0.199  Sum_probs=25.5

Q ss_pred             cccccccceEEEecCCCHHHHHHHHHHhHhhh
Q 033754           30 HQVQQWRGIRVKVFNGNLEQALSWMQRKMQSS   61 (112)
Q Consensus        30 ~~v~q~~gi~V~V~~g~IE~ALRrfKRk~~ke   61 (112)
                      =+++-..|++|.+...+++..|.+|...+.+-
T Consensus        72 ~~l~l~dg~~V~lg~~~~~~kl~~~~~i~~~~  103 (117)
T PF03799_consen   72 WTLYLDDGVEVKLGRSDLAEKLQRLVKILPQL  103 (117)
T ss_dssp             EEEE-SSS-EEEEESSTHHHHHHHHHHHHHCC
T ss_pred             EEEEECCCcEEEEcCcCHHHHHHHHHHHHHHH
Confidence            34777789999999999999999999888754


No 15 
>PF13812 PPR_3:  Pentatricopeptide repeat domain
Probab=36.74  E-value=37  Score=17.40  Aligned_cols=21  Identities=19%  Similarity=0.368  Sum_probs=15.6

Q ss_pred             ecCCCHHHHHHHHHHhHhhhhh
Q 033754           42 VFNGNLEQALSWMQRKMQSSGI   63 (112)
Q Consensus        42 V~~g~IE~ALRrfKRk~~keGI   63 (112)
                      ++.|++|.|+..|....+ .||
T Consensus        12 ~~~g~~~~a~~~~~~M~~-~gv   32 (34)
T PF13812_consen   12 AKAGDPDAALQLFDEMKE-QGV   32 (34)
T ss_pred             HHCCCHHHHHHHHHHHHH-hCC
Confidence            356899999999987544 564


No 16 
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]
Probab=34.46  E-value=16  Score=33.79  Aligned_cols=34  Identities=24%  Similarity=0.477  Sum_probs=27.0

Q ss_pred             ccCCCC-cccccccccccccccccccceEEEecCC
Q 033754           12 LTQPSQ-GLNLFSRNQCQRHQVQQWRGIRVKVFNG   45 (112)
Q Consensus        12 ~~~~~~-~~~~~~~~~~~~~~v~q~~gi~V~V~~g   45 (112)
                      +-.|.. ---+||-+.|..-.|-+|||+||.-++|
T Consensus         9 vGNPNvGKTtlFN~LTG~~q~VgNwpGvTVEkkeg   43 (653)
T COG0370           9 VGNPNVGKTTLFNALTGANQKVGNWPGVTVEKKEG   43 (653)
T ss_pred             ecCCCccHHHHHHHHhccCceecCCCCeeEEEEEE
Confidence            334444 3468999999999999999999997776


No 17 
>PF13840 ACT_7:  ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D.
Probab=34.36  E-value=42  Score=21.09  Aligned_cols=22  Identities=23%  Similarity=0.232  Sum_probs=18.6

Q ss_pred             ccceEEEecCCCHHHHHHHHHH
Q 033754           35 WRGIRVKVFNGNLEQALSWMQR   56 (112)
Q Consensus        35 ~~gi~V~V~~g~IE~ALRrfKR   56 (112)
                      ...+.+.|++.++|+|++.|++
T Consensus        44 ~~~~~ilV~~~~~~~A~~~L~~   65 (65)
T PF13840_consen   44 EISISILVKEEDLEKAVEALHE   65 (65)
T ss_dssp             SSEEEEEEEGGGHHHHHHHHHH
T ss_pred             eeeEEEEEeHHHHHHHHHHhcC
Confidence            4578899999999999998864


No 18 
>TIGR03884 sel_bind_Methan selenium-binding protein. This model describes a homopentameric selenium-binding protein with a suggested role in selenium transport and delivery to selenophosphate synthase, the SelD protein. This protein family is closely related to pfam01906, but is shorter because of several deleted regions. It is restricted to the archaeal genus Methanococcus.
Probab=33.02  E-value=67  Score=22.11  Aligned_cols=32  Identities=13%  Similarity=0.367  Sum_probs=20.8

Q ss_pred             ccccccceEEE-----ecCC-CHHHHHHHHHHhHhhhh
Q 033754           31 QVQQWRGIRVK-----VFNG-NLEQALSWMQRKMQSSG   62 (112)
Q Consensus        31 ~v~q~~gi~V~-----V~~g-~IE~ALRrfKRk~~keG   62 (112)
                      |..+-||+.+.     ...+ |+|+|+.+|...-++-|
T Consensus         5 T~~~i~G~ei~yl~iv~~~~~d~d~Al~eM~e~A~~lG   42 (74)
T TIGR03884         5 TADEIPGLQLYYLGIVSTESDNVDEIVENLREKVKAKG   42 (74)
T ss_pred             ecccCCCeEEEEEEEEEEecCCHHHHHHHHHHHHHHcC
Confidence            44555666543     2234 99999999987765543


No 19 
>PF09413 DUF2007:  Domain of unknown function (DUF2007);  InterPro: IPR018551  This is a family of proteins with unknown function. ; PDB: 2HFV_A.
Probab=32.51  E-value=52  Score=20.30  Aligned_cols=18  Identities=22%  Similarity=0.278  Sum_probs=16.2

Q ss_pred             eEEEecCCCHHHHHHHHH
Q 033754           38 IRVKVFNGNLEQALSWMQ   55 (112)
Q Consensus        38 i~V~V~~g~IE~ALRrfK   55 (112)
                      +.|.|.+.++|+|...+.
T Consensus        46 ~~v~V~~~d~~~A~~il~   63 (67)
T PF09413_consen   46 VEVYVPEEDYERAREILE   63 (67)
T ss_dssp             EEEEEEGGGHHHHHHHHH
T ss_pred             eEEEECHHHHHHHHHHHH
Confidence            899999999999988765


No 20 
>PF12854 PPR_1:  PPR repeat
Probab=32.40  E-value=40  Score=18.63  Aligned_cols=15  Identities=13%  Similarity=0.364  Sum_probs=12.6

Q ss_pred             ecCCCHHHHHHHHHH
Q 033754           42 VFNGNLEQALSWMQR   56 (112)
Q Consensus        42 V~~g~IE~ALRrfKR   56 (112)
                      .+.|.+|.|++.|.+
T Consensus        18 Ck~G~~~~A~~l~~~   32 (34)
T PF12854_consen   18 CKAGRVDEAFELFDE   32 (34)
T ss_pred             HHCCCHHHHHHHHHh
Confidence            467899999999875


No 21 
>PF01535 PPR:  PPR repeat;  InterPro: IPR002885 This entry represents the PPR repeat. Pentatricopeptide repeat (PPR) proteins are characterised by tandem repeats of a degenerate 35 amino acid motif []. Most of PPR proteins have roles in mitochondria or plastid []. PPR repeats were discovered while screening Arabidopsis proteins for those predicted to be targeted to mitochondria or chloroplast [, ]. Some of these proteins have been shown to play a role in post-transcriptional processes within organelles and they are thought to be sequence-specific RNA-binding proteins [, , ]. Plant genomes have between one hundred to five hundred PPR genes per genome whereas non-plant genomes encode two to six PPR proteins. Although no PPR structures are yet known, the motif is predicted to fold into a helix-turn-helix structure similar to those found in the tetratricopeptide repeat (TPR) family (see PDOC50005 from PROSITEDOC) [].  The plant PPR protein family has been divided in two subfamilies on the basis of their motif content and organisation [, ]. Examples of PPR repeat-containing proteins include PET309 P32522 from SWISSPROT, which may be involved in RNA stabilisation [], and crp1, which is involved in RNA processing []. The repeat is associated with a predicted plant protein O49549 from SWISSPROT that has a domain organisation similar to the human BRCA1 protein.
Probab=31.95  E-value=43  Score=16.67  Aligned_cols=18  Identities=22%  Similarity=0.272  Sum_probs=14.1

Q ss_pred             ecCCCHHHHHHHHHHhHh
Q 033754           42 VFNGNLEQALSWMQRKMQ   59 (112)
Q Consensus        42 V~~g~IE~ALRrfKRk~~   59 (112)
                      .+.|++|+|+..|++..+
T Consensus        11 ~~~~~~~~a~~~~~~M~~   28 (31)
T PF01535_consen   11 CKMGQFEEALEVFDEMRE   28 (31)
T ss_pred             HccchHHHHHHHHHHHhH
Confidence            356799999999987654


No 22 
>PF14559 TPR_19:  Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A ....
Probab=31.48  E-value=33  Score=20.27  Aligned_cols=20  Identities=15%  Similarity=0.446  Sum_probs=15.3

Q ss_pred             cCCCHHHHHHHHHHhHhhhh
Q 033754           43 FNGNLEQALSWMQRKMQSSG   62 (112)
Q Consensus        43 ~~g~IE~ALRrfKRk~~keG   62 (112)
                      ..|+++.|+..|++-++.+.
T Consensus         3 ~~~~~~~A~~~~~~~l~~~p   22 (68)
T PF14559_consen    3 KQGDYDEAIELLEKALQRNP   22 (68)
T ss_dssp             HTTHHHHHHHHHHHHHHHTT
T ss_pred             hccCHHHHHHHHHHHHHHCC
Confidence            46788888888888877644


No 23 
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit. This family consist of exodeoxyribonuclease VII, large subunit XseA which catalyses exonucleolytic cleavage in either the 5'-3' or 3'-5' direction to yield 5'-phosphomononucleotides. Exonuclease VII consists of one large subunit and four small subunits.
Probab=30.58  E-value=24  Score=30.22  Aligned_cols=26  Identities=19%  Similarity=0.285  Sum_probs=23.1

Q ss_pred             CCHHHHHHHHHHhHhhhhhHHHHHhh
Q 033754           45 GNLEQALSWMQRKMQSSGIERLIKRE   70 (112)
Q Consensus        45 g~IE~ALRrfKRk~~keGIl~eiK~R   70 (112)
                      |++..++..+|++|+++|++..=+++
T Consensus        98 G~l~~~~~~lk~~L~~eGlfd~~~k~  123 (432)
T TIGR00237        98 GLLQLAYEQLKEKLAAEGLFDQEYKK  123 (432)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCchhcC
Confidence            59999999999999999999876654


No 24 
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=29.98  E-value=10  Score=28.40  Aligned_cols=28  Identities=25%  Similarity=0.434  Sum_probs=23.5

Q ss_pred             ccccccccccccccccccceEEEecCCC
Q 033754           19 LNLFSRNQCQRHQVQQWRGIRVKVFNGN   46 (112)
Q Consensus        19 ~~~~~~~~~~~~~v~q~~gi~V~V~~g~   46 (112)
                      -.|||.+.|....|-+|||+||....|.
T Consensus        14 StLfN~Ltg~~~~v~n~pG~Tv~~~~g~   41 (156)
T PF02421_consen   14 STLFNALTGAKQKVGNWPGTTVEKKEGI   41 (156)
T ss_dssp             HHHHHHHHTTSEEEEESTTSSSEEEEEE
T ss_pred             HHHHHHHHCCCceecCCCCCCeeeeeEE
Confidence            4589999999999999999999866553


No 25 
>PF13041 PPR_2:  PPR repeat family 
Probab=29.76  E-value=52  Score=18.91  Aligned_cols=21  Identities=29%  Similarity=0.447  Sum_probs=15.9

Q ss_pred             ecCCCHHHHHHHHHHhHhhhhh
Q 033754           42 VFNGNLEQALSWMQRKMQSSGI   63 (112)
Q Consensus        42 V~~g~IE~ALRrfKRk~~keGI   63 (112)
                      .+.|++|+|++.|+... +.|+
T Consensus        14 ~~~~~~~~a~~l~~~M~-~~g~   34 (50)
T PF13041_consen   14 CKAGKFEEALKLFKEMK-KRGI   34 (50)
T ss_pred             HHCcCHHHHHHHHHHHH-HcCC
Confidence            35789999999998776 3343


No 26 
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein. The vertebrate Tap protein is a member of the NXF family of shuttling transport receptors for the nuclear export of mRNA. Its most C-terminal domain is important for binding to FG repeat-containing nuclear pore proteins (FG-nucleoporins) and is sufficient to mediate shuttling. This domain forms a compact four-helix fold related to that of a UBA domain.
Probab=28.32  E-value=45  Score=21.76  Aligned_cols=24  Identities=21%  Similarity=0.133  Sum_probs=17.8

Q ss_pred             cCC-CHHHHHHHHHHhHhhhhhHHH
Q 033754           43 FNG-NLEQALSWMQRKMQSSGIERL   66 (112)
Q Consensus        43 ~~g-~IE~ALRrfKRk~~keGIl~e   66 (112)
                      .+| |+|.|+..|...-....|-.|
T Consensus        36 ~~~Wd~~~Al~~F~~lk~~~~IP~e   60 (63)
T smart00804       36 DNNWDYERALKNFTELKSEGSIPPE   60 (63)
T ss_pred             HcCCCHHHHHHHHHHHHhcCCCChh
Confidence            456 999999999987665555443


No 27 
>cd04917 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in bacteria (Escherichia coli (EC) LysC). Aspartokinase is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The E. coli AKIII (LysC) binds two feedback allosteric inhibitor lysine molecules at the dimer interface located between the ACT1 domain of two subunits. The second ACT domain (ACT2), this CD, is not involved in the binding of heterotrophic effectors. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=28.25  E-value=51  Score=19.96  Aligned_cols=22  Identities=5%  Similarity=0.206  Sum_probs=17.9

Q ss_pred             ceEEEecCCCHHHHHHHHHHhH
Q 033754           37 GIRVKVFNGNLEQALSWMQRKM   58 (112)
Q Consensus        37 gi~V~V~~g~IE~ALRrfKRk~   58 (112)
                      .+.+.|.+.+.+.|++.+.+.+
T Consensus        41 ~is~~V~~~~~~~a~~~Lh~~f   62 (64)
T cd04917          41 NLCFLVKEEDKDEVVQRLHSRL   62 (64)
T ss_pred             EEEEEEeHHHHHHHHHHHHHHH
Confidence            5667888889999999988764


No 28 
>PF11393 IcmL:  Macrophage killing protein with similarity to conjugation protein;  InterPro: IPR021055 IcmL contains two amphipathic beta-sheet regions, required for the pore-forming ability which may be related to the transfer of this protein into a host cell membrane []. The icmL gene shows significant similarity to plasmid genes involved in conjugation however IcmL is thought to be required for macrophage killing. It is unknown whether conjugation plays a role in macrophage killing [].
Probab=28.10  E-value=64  Score=22.51  Aligned_cols=27  Identities=30%  Similarity=0.463  Sum_probs=22.3

Q ss_pred             HHHHHHHHHhHhhhhhHHHHHhhhcccC
Q 033754           48 EQALSWMQRKMQSSGIERLIKREQRHHI   75 (112)
Q Consensus        48 E~ALRrfKRk~~keGIl~eiK~R~~~Ye   75 (112)
                      +.+...|..-|+++|+|+.+|.+ +...
T Consensus        52 ~~g~~~f~~aL~~Sg~l~~ik~~-~l~~   78 (108)
T PF11393_consen   52 DEGWNSFQKALQKSGILDAIKDK-RLNL   78 (108)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHhc-ceEE
Confidence            45677899999999999999998 6543


No 29 
>cd04915 ACT_AK-Ectoine_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway. This CD includes the second of two ACT domains located C-terminal to the catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and various other halotolerant or halophilic bacteria. Bacteria exposed to hyperosmotic stress accumulate organic solutes called 'compatible solutes'  of which ectoine, a heterocyclic amino acid, is one. Apart from its osmotic function, ectoine also exhibits a protective effect on proteins, nucleic acids and membranes against a variety of stress factors. de novo synthesis of ectoine starts with the phosphorylation of L-aspartate and shares its first two enzymatic steps with the biosynthesis of amino acids of the aspartate family: aspartokinas
Probab=27.59  E-value=55  Score=20.47  Aligned_cols=22  Identities=9%  Similarity=0.237  Sum_probs=18.6

Q ss_pred             ceEEEecCCCHHHHHHHHHHhH
Q 033754           37 GIRVKVFNGNLEQALSWMQRKM   58 (112)
Q Consensus        37 gi~V~V~~g~IE~ALRrfKRk~   58 (112)
                      .|.+.|.+.+.++|++.+...+
T Consensus        43 ~is~~V~~~~~~~av~~Lh~~f   64 (66)
T cd04915          43 DVQFVVDRDDYDNAIKALHAAL   64 (66)
T ss_pred             EEEEEEEHHHHHHHHHHHHHHH
Confidence            5778888889999999988765


No 30 
>COG1433 Uncharacterized conserved protein [Function unknown]
Probab=27.53  E-value=54  Score=23.96  Aligned_cols=32  Identities=22%  Similarity=0.196  Sum_probs=24.6

Q ss_pred             ccccccccccccceEEEecCC-CHHHHHHHHHH
Q 033754           25 NQCQRHQVQQWRGIRVKVFNG-NLEQALSWMQR   56 (112)
Q Consensus        25 ~~~~~~~v~q~~gi~V~V~~g-~IE~ALRrfKR   56 (112)
                      .+-..-.+.+..||.|.+-++ ++|.|++.|..
T Consensus        74 iG~~a~~~l~~~GIkv~~~~~~~V~e~i~~~~~  106 (121)
T COG1433          74 IGPNAYNALKAAGIKVYVAPGGTVEEAIKAFLE  106 (121)
T ss_pred             cCHHHHHHHHHcCcEEEecCCCCHHHHHHHHhc
Confidence            333445567788999998887 99999998864


No 31 
>PF02579 Nitro_FeMo-Co:  Dinitrogenase iron-molybdenum cofactor;  InterPro: IPR003731 This entry represents several Nif (B, X and Y) proteins, which are involved in the biosynthesis of the iron-molybdenum cofactor (FeMo-co) found in the dinitrogenase enzyme of the nitrogenase complex in nitrogen-fixing bacteria. The nitrogenase complex catalyses the reduction of atmospheric dinitrogen to ammonia, and is composed of an iron metalloprotein (dinitrogenase reductase; homodimer of NifH; IPR000392 from INTERPRO) and a Fe-Mo metalloprotein (dinitrogenase; heterotetramer of NifD and NifK; IPR000318 from INTERPRO). The pathway for the synthesis of the Fe-Mo cofactor involves several proteins, including NifB, NifE, NifH, NifN, NifQ, NifV and NifX. NifB appears to be an iron-sulphur source for FeMo-co biosynthesis, while NifX may be associated with the mature FeMo-co, in particular with the addition of homocitrate during the last step of biosynthesis []. The NifX protein shows sequence similarity with the C terminus of NifB [], as well as to the conserved protein MTH1175 from the archaeon Methanobacterium thermoautotrophicum, which displays a ribonuclease H-like motif of three layers, alpha/beta/alpha, with a single mixed beta-sheet [].; PDB: 2QTD_A 2KLA_A 1EO1_A 1P90_A 1RDU_A 2YX6_D 1O13_A 1T3V_A 2RE2_B 2WFB_A.
Probab=27.24  E-value=77  Score=20.12  Aligned_cols=26  Identities=27%  Similarity=0.332  Sum_probs=19.6

Q ss_pred             cccccccceEEEe-cCCCHHHHHHHHH
Q 033754           30 HQVQQWRGIRVKV-FNGNLEQALSWMQ   55 (112)
Q Consensus        30 ~~v~q~~gi~V~V-~~g~IE~ALRrfK   55 (112)
                      -......||.|.. ..+++|.||..|.
T Consensus        67 ~~~L~~~gI~v~~~~~~~i~~~l~~~~   93 (94)
T PF02579_consen   67 FRALKEAGIKVYQGAGGDIEEALEAYL   93 (94)
T ss_dssp             HHHHHHTTSEEEESTSSBHHHHHHHHH
T ss_pred             HHHHHHCCCEEEEcCCCCHHHHHHHHh
Confidence            3445667899988 4569999999874


No 32 
>cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains. This CD includes the C-terminal of the two ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences. In B. subtilis strain 168, the regulation of the diaminopimelate (Dap)-lysine biosynthetic pathway involves dual control by Dap and lysine, effected through separate Dap- and lysine-sensitive AK isoenzymes. The B. subtilis strain 168 AKII is induced by methionine and repressed and inhibited by lysine. Although C. glutamicum is known to contain a single AK, both the succinylase and dehydrogenase variant pathways of DAP-lysine synthesis operate simultaneously in this organism. In corynebacteria and other various Gram-positive bacteria, the DAP-lysine pathway is feedback regu
Probab=26.14  E-value=59  Score=18.73  Aligned_cols=23  Identities=13%  Similarity=0.146  Sum_probs=19.7

Q ss_pred             cceEEEecCCCHHHHHHHHHHhH
Q 033754           36 RGIRVKVFNGNLEQALSWMQRKM   58 (112)
Q Consensus        36 ~gi~V~V~~g~IE~ALRrfKRk~   58 (112)
                      ..+.+.|.+.+++.|++.+.+.+
T Consensus        39 ~~is~~v~~~d~~~~~~~l~~~~   61 (63)
T cd04936          39 IKISCLIDEDDAEKAVRALHEAF   61 (63)
T ss_pred             ceEEEEEeHHHHHHHHHHHHHHh
Confidence            56888898889999999988765


No 33 
>PF12221 HflK_N:  Bacterial membrane protein N terminal;  InterPro: IPR020980  HflK is a bacterial membrane protein which is thought, together with the HflC protein, to form a membrane protease complex whose activity is modulated by the GTPase HflX []. This entry represents the N-terminal, membrane-spanning, region of of HflK responsible for anchoring the protein in the bacterial membrane. It is often found in association with PF01145 from PFAM.
Probab=25.90  E-value=64  Score=19.69  Aligned_cols=15  Identities=20%  Similarity=0.408  Sum_probs=13.6

Q ss_pred             CHHHHHHHHHHhHhh
Q 033754           46 NLEQALSWMQRKMQS   60 (112)
Q Consensus        46 ~IE~ALRrfKRk~~k   60 (112)
                      ++|++++.|.+++..
T Consensus        22 DLdel~r~l~~kl~~   36 (42)
T PF12221_consen   22 DLDELFRKLQDKLGG   36 (42)
T ss_pred             CHHHHHHHHHHHHhc
Confidence            999999999999864


No 34 
>PRK13780 phosphocarrier protein HPr; Provisional
Probab=25.40  E-value=1.1e+02  Score=20.59  Aligned_cols=32  Identities=19%  Similarity=0.309  Sum_probs=26.8

Q ss_pred             cccccceEEEecCCCHHHHHHHHHHhHhhhhh
Q 033754           32 VQQWRGIRVKVFNGNLEQALSWMQRKMQSSGI   63 (112)
Q Consensus        32 v~q~~gi~V~V~~g~IE~ALRrfKRk~~keGI   63 (112)
                      +.++-.|+|.+...|=|.|+..+..-++++|+
T Consensus        55 ~~~G~~v~i~a~G~De~~Al~~l~~~l~~~~l   86 (88)
T PRK13780         55 VGQGADITISAEGADAADAIAAIEETMKKEGL   86 (88)
T ss_pred             CCCCCEEEEEEeCcCHHHHHHHHHHHHHhccc
Confidence            67788888988555999999999999987764


No 35 
>PF13428 TPR_14:  Tetratricopeptide repeat
Probab=25.23  E-value=78  Score=17.88  Aligned_cols=20  Identities=15%  Similarity=0.167  Sum_probs=16.7

Q ss_pred             cCCCHHHHHHHHHHhHhhhh
Q 033754           43 FNGNLEQALSWMQRKMQSSG   62 (112)
Q Consensus        43 ~~g~IE~ALRrfKRk~~keG   62 (112)
                      ..|+.|+|.+.|.+-++.+.
T Consensus        13 ~~G~~~~A~~~~~~~l~~~P   32 (44)
T PF13428_consen   13 RLGQPDEAERLLRRALALDP   32 (44)
T ss_pred             HcCCHHHHHHHHHHHHHHCc
Confidence            45899999999999988654


No 36 
>TIGR03072 release_prfH putative peptide chain release factor H. Members of this protein family are bacterial proteins homologous to peptide chain release factors 1 (RF-1, product of the prfA gene), and 2 (RF-2, product of the prfB gene). The member from Escherichia coli K-12, designated prfH, appears to be a pseudogene. This class I release factor is always found as the downstream gene of a two-gene operon.
Probab=25.08  E-value=2e+02  Score=22.70  Aligned_cols=50  Identities=18%  Similarity=0.179  Sum_probs=31.4

Q ss_pred             ccCCCCcccccccccccccccccccceEEEecCC-----CHHHHHHHHHHhHhhh
Q 033754           12 LTQPSQGLNLFSRNQCQRHQVQQWRGIRVKVFNG-----NLEQALSWMQRKMQSS   61 (112)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~v~q~~gi~V~V~~g-----~IE~ALRrfKRk~~ke   61 (112)
                      +++.+.+-|-+|-..-.-....--.||+|.+.+.     |-+.|+.+|+-++..-
T Consensus       113 ~RssGpGGQ~vNkt~saVrl~h~ptgi~v~~~~~RSQ~~Nk~~A~~~L~~~l~~~  167 (200)
T TIGR03072       113 LRSSGPGGQHVNKTESAVRATHLASGISVKVQSERSQHANKRLATLLLAVRLADL  167 (200)
T ss_pred             EECCCCCcccccccceeEEEEECCCcEEEEECCccCHHHHHHHHHHHHHHHHHHH
Confidence            3344444455554432222223345899998874     8899999999988654


No 37 
>cd04920 ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC). This CD includes the second of two ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein. Aspartokinase (AK) is the first enzyme in the aspartate metabolic pathway and catalyzes the conversion of aspartate and ATP to aspartylphosphate and ADP. The lysA gene encodes the enzyme DAPDC, a pyridoxal-5'-phosphate (PLP)-dependent enzyme which catalyzes the final step in the lysine biosynthetic pathway converting meso-diaminopimelic acid (DAP) to l-lysine. Tandem ACT domains are positioned centrally with the AK catalytic domain N-terminal and the DAPDC domains C-terminal. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=23.43  E-value=71  Score=19.71  Aligned_cols=23  Identities=4%  Similarity=0.034  Sum_probs=18.4

Q ss_pred             cceEEEecCCCHHHHHHHHHHhH
Q 033754           36 RGIRVKVFNGNLEQALSWMQRKM   58 (112)
Q Consensus        36 ~gi~V~V~~g~IE~ALRrfKRk~   58 (112)
                      ..|++.|++.+.++|++.+-..+
T Consensus        39 ~~is~vv~~~d~~~av~~LH~~f   61 (63)
T cd04920          39 LNLTFVVDEDQADGLCARLHFQL   61 (63)
T ss_pred             CeEEEEEeHHHHHHHHHHHHHHH
Confidence            35777888889999999987654


No 38 
>PF13181 TPR_8:  Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A ....
Probab=23.06  E-value=1e+02  Score=15.77  Aligned_cols=17  Identities=24%  Similarity=0.585  Sum_probs=14.0

Q ss_pred             CCCHHHHHHHHHHhHhh
Q 033754           44 NGNLEQALSWMQRKMQS   60 (112)
Q Consensus        44 ~g~IE~ALRrfKRk~~k   60 (112)
                      -|++|.|+.-|++-++-
T Consensus        14 ~~~~~~A~~~~~~a~~~   30 (34)
T PF13181_consen   14 LGDYEEALEYFEKALEL   30 (34)
T ss_dssp             TTSHHHHHHHHHHHHHH
T ss_pred             cCCHHHHHHHHHHHHhh
Confidence            47999999999987653


No 39 
>PF02996 Prefoldin:  Prefoldin subunit;  InterPro: IPR004127 This entry comprises of several prefoldin subunits. Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea. Eukaryotic PFD is a multi-subunit complex containing six polypeptides in the molecular mass range of 14-23 kDa. In archaea, on the other hand, PFD is composed of two types of subunits, two alpha and four beta. The six subunits associate to form two back-to-back up-and-down eight-stranded barrels, from which hang six coiled coils. Each subunit contributes one (beta subunits) or two (alpha subunits) beta hairpin turns to the barrels. The coiled coils are formed by the N and C termini of an individual subunit. Overall, this unique arrangement resembles a jellyfish. The eukaryotic PFD hexamer is composed of six different subunits; however, these can be grouped into two alpha-like (PFD3 and -5) and four beta-like (PFD1, -2, -4, and -6) subunits based on amino acid sequence similarity with their archaeal counterparts. Eukaryotic PFD has a six-legged structure similar to that seen in the archaeal homologue [, ]. This family contains the archaeal alpha subunit, eukaryotic prefoldin subunits 3 and 5 and the UXT (ubiquitously expressed transcript) family.   Eukaryotic PFD has been shown to bind both actin and tubulin co-translationally. The chaperone then delivers the target protein to CCT, interacting with the chaperonin through the tips of the coiled coils. No authentic target proteins of any archaeal PFD have been identified, to date.; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0016272 prefoldin complex; PDB: 1FXK_C 2ZDI_C.
Probab=22.37  E-value=1.2e+02  Score=20.47  Aligned_cols=31  Identities=16%  Similarity=0.425  Sum_probs=24.7

Q ss_pred             cccccccceEEEecCC-----CHHHHHHHHHHhHhh
Q 033754           30 HQVQQWRGIRVKVFNG-----NLEQALSWMQRKMQS   60 (112)
Q Consensus        30 ~~v~q~~gi~V~V~~g-----~IE~ALRrfKRk~~k   60 (112)
                      +.|-.+..|.|.+..|     ++|.|...+++++..
T Consensus        53 g~i~~~~~vlV~lG~~~~vE~s~~eA~~~l~~r~~~   88 (120)
T PF02996_consen   53 GKIPDTDKVLVSLGAGYYVEMSLEEAIEFLKKRIKE   88 (120)
T ss_dssp             EE-SSTTEEEEEEETTEEEEEEHHHHHHHHHHHHHH
T ss_pred             EEeCCCCEEEEEeeCCeEEEecHHHHHHHHHHHHHH
Confidence            3466677788888887     999999999998765


No 40 
>PF04108 APG17:  Autophagy protein Apg17 ;  InterPro: IPR007240 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. No molecule involved in autophagy has yet been identified in higher eukaryotes []. The pre-autophagosomal structure contains at least five Apg proteins: Apg1p, Apg2p, Apg5p, Aut7p/Apg8p and Apg16p. It is found in the vacuole []. The C-terminal glycine of Apg12p is conjugated to a lysine residue of Apg5p via an isopeptide bond. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. Auotphagy protein 16 (Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate []. Autophagy protein 5 (Apg5) is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway []. Autophagy protein 17 (Apg17) is required for activating Apg1 protein kinases. This entry also contains Autophagy protein 11 which is involved in cytoplasm to vacuole transport (Cvt) and pexophagy. ; GO: 0006914 autophagy
Probab=22.34  E-value=1.5e+02  Score=25.31  Aligned_cols=44  Identities=14%  Similarity=0.142  Sum_probs=35.5

Q ss_pred             hhhHHHHHhhhcccCCchHHHHHHHHHHHHHHHhHHHHHHHHHHH
Q 033754           61 SGIERLIKREQRHHIKNSEKRVLARKNLERKIRSQDLARKLKAIL  105 (112)
Q Consensus        61 eGIl~eiK~R~~~YeKPSekRrrk~~ea~rR~rkqe~~rKi~~Im  105 (112)
                      .++|.|+-+| ++|.+--..--+...+.-.+++.+|..++-.|+-
T Consensus       349 ~~LL~Ev~RR-r~~~~k~~~i~~~~~eeL~~l~eeE~~~Re~F~~  392 (412)
T PF04108_consen  349 DSLLLEVERR-RAVRDKMKKIIREANEELDKLREEEQRRREAFLK  392 (412)
T ss_pred             HHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3488999999 8887777777777788888888888888888863


No 41 
>TIGR02663 nifX nitrogen fixation protein NifX. Members of this family are NifX proteins encoded within operons for nitrogen fixation in a number of bacteria. NifX, NafY, and the C-terminal region of NifB all belong to the Pfam family pfam02579 and are involved in MoFe cofactor biosynthesis. NifX is a nitrogenase accessory protein with a role in expression of the MoFe cofactor.
Probab=22.24  E-value=80  Score=21.95  Aligned_cols=33  Identities=9%  Similarity=0.023  Sum_probs=24.3

Q ss_pred             cccccccceEEEe-cCC-CHHHHHHHHHHhHhhhh
Q 033754           30 HQVQQWRGIRVKV-FNG-NLEQALSWMQRKMQSSG   62 (112)
Q Consensus        30 ~~v~q~~gi~V~V-~~g-~IE~ALRrfKRk~~keG   62 (112)
                      -...+..||.+.. ..+ +||.||..|.+.|..+.
T Consensus        77 ~~~L~~~gI~~~~~~~~~~v~eal~~l~~~~~~~~  111 (119)
T TIGR02663        77 AAKVVAAKIHPIKVNEPESISELLERLQKMLKGNP  111 (119)
T ss_pred             HHHHHHcCCeeEecCCCccHHHHHHHHHHHHcCCC
Confidence            4456667888874 333 89999999998886543


No 42 
>cd04918 ACT_AK1-AT_2 ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1). This CD includes the second of two ACT domains located C-terminal to the catalytic domain of a monofunctional, lysine-sensitive, plant aspartate kinase 1 (AK1), which can be synergistically inhibited by S-adenosylmethionine (SAM). This isoenzyme is found in higher plants, Arabidopsis thaliana (AT) and Zea mays, and also in Chlorophyta. In its inactive state, Arabidopsis AK1 binds the effectors lysine and SAM (two molecules each) at the interface of two ACT1 domain subunits. The second ACT domain (ACT2), this CD, does not interact with an effector. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=21.80  E-value=78  Score=19.48  Aligned_cols=22  Identities=14%  Similarity=0.250  Sum_probs=18.3

Q ss_pred             ceEEEecCCCHHHHHHHHHHhH
Q 033754           37 GIRVKVFNGNLEQALSWMQRKM   58 (112)
Q Consensus        37 gi~V~V~~g~IE~ALRrfKRk~   58 (112)
                      .|.+.|++.+.+.|++.+.+.+
T Consensus        42 sis~~v~~~~~~~av~~Lh~~f   63 (65)
T cd04918          42 NISLIVNDSEAEGCVQALHKSF   63 (65)
T ss_pred             eEEEEEeHHHHHHHHHHHHHHH
Confidence            5777888889999999988765


No 43 
>PF00486 Trans_reg_C:  Transcriptional regulatory protein, C terminal;  InterPro: IPR001867 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents a domain that is almost always found associated with the response regulator receiver domain (see IPR001789 from INTERPRO). It may play a role in DNA binding [].; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0000160 two-component signal transduction system (phosphorelay), 0006355 regulation of transcription, DNA-dependent; PDB: 2K4J_A 2JPB_A 1ODD_A 1OPC_A 1KGS_A 2PMU_E 2JZY_A 1GXP_B 1QQI_A 2Z33_A ....
Probab=21.57  E-value=46  Score=20.41  Aligned_cols=22  Identities=23%  Similarity=0.536  Sum_probs=18.6

Q ss_pred             EecCCCHHHHHHHHHHhHhhhh
Q 033754           41 KVFNGNLEQALSWMQRKMQSSG   62 (112)
Q Consensus        41 ~V~~g~IE~ALRrfKRk~~keG   62 (112)
                      .+.+++++..+.++++++...|
T Consensus        40 ~~~~~~l~~~I~rLR~kL~~~~   61 (77)
T PF00486_consen   40 DVSDNSLDVHISRLRKKLEDAG   61 (77)
T ss_dssp             TTCTHHHHHHHHHHHHHHHSST
T ss_pred             ccchhhHHHHHHHHHHHHhhcC
Confidence            4456699999999999999865


No 44 
>cd08003 WGR_PARP2_like WGR domain of poly(ADP-ribose) polymerases. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs). It has been called WGR after the most conserved central motif of the domain. The domain typically occurs together with a catalytic PARP domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain. PARPs catalyze the NAD(+)-dependent synthesis of ADP-ribose polymers and their addition to various nuclear proteins. Higher eukaryotes contain several PARPs and and there may be up to 17 human PARP-like proteins, with three of them (PARP-1, PARP-2, and PARP-3) containing a WGR domain. The synthesis of poly-ADP-ribose requires multiple enzymatic activities for initiation, trans-ADP-ribosylation, elongation, branching, and release of the polymer from the enzyme. This subfamily is composed of human PARP-2 and similar proteins. Similar to PARP-1, PARP-2 is ubiquitously expressed and it
Probab=21.22  E-value=90  Score=21.94  Aligned_cols=29  Identities=24%  Similarity=0.258  Sum_probs=23.3

Q ss_pred             CHHHHHHHHHHhH-hhhhhHHHHHhhhcccCCc
Q 033754           46 NLEQALSWMQRKM-QSSGIERLIKREQRHHIKN   77 (112)
Q Consensus        46 ~IE~ALRrfKRk~-~keGIl~eiK~R~~~YeKP   77 (112)
                      ++|.|++.|++++ +++|  .++..| .-|+|+
T Consensus        63 ~l~~A~~~F~k~F~~KTg--n~W~~R-~~f~k~   92 (103)
T cd08003          63 DLEQAKSLFEKKFLDKTK--NEWEDR-ANFEKV   92 (103)
T ss_pred             CHHHHHHHHHHHHHHHhC--Cchhhc-cCCCCC
Confidence            5999999999996 5688  467778 667764


No 45 
>TIGR00019 prfA peptide chain release factor 1. This model describes peptide chain release factor 1 (PrfA, RF-1), and excludes the related peptide chain release factor 2 (PrfB, RF-2). RF-1 helps recognize and terminate translation at UAA and UAG stop codons. The mitochondrial release factors are prfA-like, although not included above the trusted cutoff for this model. RF-1 does not have a translational frameshift.
Probab=21.05  E-value=2.5e+02  Score=24.19  Aligned_cols=51  Identities=12%  Similarity=0.168  Sum_probs=32.7

Q ss_pred             ccCCCCcccccccccccccccccccceEEEecCC-----CHHHHHHHHHHhHhhhh
Q 033754           12 LTQPSQGLNLFSRNQCQRHQVQQWRGIRVKVFNG-----NLEQALSWMQRKMQSSG   62 (112)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~v~q~~gi~V~V~~g-----~IE~ALRrfKRk~~keG   62 (112)
                      ++++|.|-|-+|...-.-...---.||+|.+.+.     |-+.|+++|+.+|...-
T Consensus       228 ~RssG~GGQ~VNkt~SaVrl~h~ptgi~V~~~~eRSQ~~Nk~~A~~~L~~~L~~~~  283 (360)
T TIGR00019       228 FRSSGAGGQHVNTTDSAVRITHLPTGIVVECQDERSQHKNKDKAMKVLRARLYEAE  283 (360)
T ss_pred             EECCCCCCCCcCceeeeEEEEECCCcEEEEECCccCHHHHHHHHHHHHHHHHHHHH
Confidence            4455555555554433222223345899999875     78999999999887654


No 46 
>TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5. This model finds a set of small proteins from the Archaea and from Aquifex aeolicus that may represent two orthologous groups. The proteins are predicted to be mostly coiled coil, and may hit large numbers of proteins that contain coiled coil regions.
Probab=21.04  E-value=1.6e+02  Score=20.37  Aligned_cols=31  Identities=16%  Similarity=0.440  Sum_probs=23.4

Q ss_pred             cccccccceEEEecCC-----CHHHHHHHHHHhHhh
Q 033754           30 HQVQQWRGIRVKVFNG-----NLEQALSWMQRKMQS   60 (112)
Q Consensus        30 ~~v~q~~gi~V~V~~g-----~IE~ALRrfKRk~~k   60 (112)
                      +.|.....|.|.+..|     ++|.|...|++++..
T Consensus        62 ~~v~~~~~v~v~iG~g~~vE~~~~eA~~~l~~~~~~   97 (126)
T TIGR00293        62 AKVKDTDKVLVSIGSGYYVEKDAEEAIEFLKKRIEE   97 (126)
T ss_pred             EEeCCCCEEEEEcCCCEEEEecHHHHHHHHHHHHHH
Confidence            3455556677777665     999999999998876


No 47 
>PF00625 Guanylate_kin:  Guanylate kinase;  InterPro: IPR008144 Guanylate kinase (2.7.4.8 from EC) (GK) [] catalyzes the ATP-dependent phosphorylation of GMP into GDP. It is essential for recycling GMP and indirectly, cGMP. In prokaryotes (such as Escherichia coli), lower eukaryotes (such as yeast) and in vertebrates, GK is a highly conserved monomeric protein of about 200 amino acids. GK has been shown [, , ] to be structurally similar to protein A57R (or SalG2R) from various strains of Vaccinia virus. Proteins containing one or more copies of the DHR domain, an SH3 domain as well as a C-terminal GK-like domain, are collectively termed MAGUKs (membrane-associated guanylate kinase homologs) [], and include Drosophila lethal(1)discs large-1 tumor suppressor protein (gene dlg1); mammalian tight junction protein Zo-1; a family of mammalian synaptic proteins that seem to interact with the cytoplasmic tail of NMDA receptor subunits (SAP90/PSD-95, CHAPSYN-110/PSD-93, SAP97/DLG1 and SAP102); vertebrate 55kDa erythrocyte membrane protein (p55); Caenorhabditis elegans protein lin-2; rat protein CASK; and human proteins DLG2 and DLG3. There is an ATP-binding site (P-loop) in the N-terminal section of GK, which is not conserved in the GK-like domain of the above proteins. However these proteins retain the residues known, in GK, to be involved in the binding of GMP.; GO: 0005515 protein binding; PDB: 3UAT_A 3KFV_A 2ANC_F 2F3T_E 2ANB_A 2AN9_A 1S96_A 2F3R_B 3TR0_A 1LVG_A ....
Probab=20.85  E-value=1.3e+02  Score=21.76  Aligned_cols=24  Identities=17%  Similarity=0.331  Sum_probs=19.1

Q ss_pred             eEEEecCCCHHHHHHHHHHhHhhh
Q 033754           38 IRVKVFNGNLEQALSWMQRKMQSS   61 (112)
Q Consensus        38 i~V~V~~g~IE~ALRrfKRk~~ke   61 (112)
                      ....+.|+++|.|+..++..++++
T Consensus       160 fd~vi~n~~le~~~~~l~~ii~~~  183 (183)
T PF00625_consen  160 FDYVIVNDDLEEAVKELKEIIEQE  183 (183)
T ss_dssp             SSEEEECSSHHHHHHHHHHHHHHH
T ss_pred             CCEEEECcCHHHHHHHHHHHHHhC
Confidence            445555779999999999988764


No 48 
>cd00584 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly.  The complex contains two alpha and four beta subunits, the two subunits being evolutionarily related. In archaea, there is usually only one gene for each subunit while in eukaryotes there two or more paralogous genes encoding each subunit adding heterogeneity to the structure of the hexamer. The structure of the complex consists of a double beta barrel assembly with six protruding coiled-coils.
Probab=20.66  E-value=1.5e+02  Score=20.53  Aligned_cols=31  Identities=23%  Similarity=0.481  Sum_probs=24.5

Q ss_pred             cccccccceEEEecCC-----CHHHHHHHHHHhHhh
Q 033754           30 HQVQQWRGIRVKVFNG-----NLEQALSWMQRKMQS   60 (112)
Q Consensus        30 ~~v~q~~gi~V~V~~g-----~IE~ALRrfKRk~~k   60 (112)
                      +.|.-+..|.|.+..|     +++.|...|+++++.
T Consensus        63 ~~i~~~~~v~v~iG~g~~vE~~~~eA~~~l~~r~~~   98 (129)
T cd00584          63 AKVKDTDKVLVDLGTGYYVEKDLEEAIEFLDKKIEE   98 (129)
T ss_pred             EEeCCCCEEEEEcCCCEEEEecHHHHHHHHHHHHHH
Confidence            4566667788888776     899999999998764


No 49 
>smart00862 Trans_reg_C Transcriptional regulatory protein, C terminal. This domain is almost always found associated with the response regulator receiver domain. It may play a role in DNA binding.
Probab=20.32  E-value=35  Score=20.83  Aligned_cols=20  Identities=20%  Similarity=0.479  Sum_probs=17.0

Q ss_pred             cCCCHHHHHHHHHHhHhhhh
Q 033754           43 FNGNLEQALSWMQRKMQSSG   62 (112)
Q Consensus        43 ~~g~IE~ALRrfKRk~~keG   62 (112)
                      .+++++.++.++++++...|
T Consensus        43 ~~~~l~~~i~~LR~~l~~~~   62 (78)
T smart00862       43 DDNTLDVHISRLRKKLEDDG   62 (78)
T ss_pred             ccchHHHHHHHHHHHHhcCC
Confidence            45689999999999998755


No 50 
>PF11172 DUF2959:  Protein of unknown function (DUF2959);  InterPro: IPR021342  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=20.27  E-value=4.6e+02  Score=21.07  Aligned_cols=52  Identities=17%  Similarity=0.164  Sum_probs=38.4

Q ss_pred             EecCCCHHHHHHHHHHhHhh-------------------hhhHHHHHhhhcccCCchHHHHHHHHHHHHHH
Q 033754           41 KVFNGNLEQALSWMQRKMQS-------------------SGIERLIKREQRHHIKNSEKRVLARKNLERKI   92 (112)
Q Consensus        41 ~V~~g~IE~ALRrfKRk~~k-------------------eGIl~eiK~R~~~YeKPSekRrrk~~ea~rR~   92 (112)
                      .+.+|++|..+..|+..++.                   +-+|.||..--.-|..||-++.-..+-+.-+.
T Consensus        56 ~~~ggdLe~~Y~~ln~~ye~s~~~A~~V~~RI~~vE~Va~ALF~EWe~EL~~Y~~~sLR~~S~~kL~~tr~  126 (201)
T PF11172_consen   56 NFDGGDLEDKYNALNDEYESSEDAAEEVSDRIDAVEDVADALFDEWEQELDQYSNASLRRASEQKLAETRR  126 (201)
T ss_pred             CCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHH
Confidence            34567999999999998875                   35688888877899999988855444444333


No 51 
>PRK05783 hypothetical protein; Provisional
Probab=20.10  E-value=1.7e+02  Score=20.12  Aligned_cols=35  Identities=11%  Similarity=0.018  Sum_probs=29.3

Q ss_pred             cccccccccccceEEEecCCCHHHHHHHHHHhHhh
Q 033754           26 QCQRHQVQQWRGIRVKVFNGNLEQALSWMQRKMQS   60 (112)
Q Consensus        26 ~~~~~~v~q~~gi~V~V~~g~IE~ALRrfKRk~~k   60 (112)
                      ++.-..|.++.-+.+.+.++|-|.|.......|++
T Consensus        32 ~~~V~~VRvGK~iel~l~~~~~e~a~~~v~~mc~~   66 (84)
T PRK05783         32 TGNIIEVRAGKYLVFKIEANSPEEAKELALKIARE   66 (84)
T ss_pred             CCCcceEEeeEEEEEEEcCCCHHHHHHHHHHHHHh
Confidence            55567789999999999878999999888888765


Done!