Query         033761
Match_columns 112
No_of_seqs    116 out of 1077
Neff          9.1 
Searched_HMMs 46136
Date          Fri Mar 29 06:00:41 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033761.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033761hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00405 cytochrome c; Provisi 100.0 2.4E-31 5.2E-36  163.4  10.2  108    5-112     7-114 (114)
  2 COG3474 Cytochrome c2 [Energy  100.0 4.4E-29 9.5E-34  153.7   8.9  102    9-111    28-131 (135)
  3 PTZ00048 cytochrome c; Provisi 100.0 2.7E-28 5.8E-33  150.3  10.5  105    7-112    10-114 (115)
  4 KOG3453 Cytochrome c [Energy p  99.7 1.7E-18 3.7E-23  103.7   4.7  104    7-110     4-107 (110)
  5 TIGR03872 cytochrome_MoxG cyto  99.7   5E-17 1.1E-21  102.4   7.9   82    9-112    41-123 (133)
  6 TIGR02603 CxxCH_TIGR02603 puta  99.7 2.8E-16   6E-21   99.2   6.8   35   10-45      1-35  (133)
  7 PRK13617 psbV cytochrome c-550  99.7 2.8E-16   6E-21  101.6   6.6   88    9-112    56-157 (170)
  8 PF00034 Cytochrom_C:  Cytochro  99.6   4E-18 8.8E-23   99.5  -3.4   80   12-111     1-91  (91)
  9 CHL00183 petJ cytochrome c553;  99.6 8.3E-16 1.8E-20   93.8   6.5   84    7-111    21-104 (108)
 10 PF13442 Cytochrome_CBB3:  Cyto  99.6 3.8E-16 8.2E-21   87.6   4.1   67   10-107     1-67  (67)
 11 CHL00133 psbV photosystem II c  99.6 1.9E-15 4.2E-20   97.5   7.0   88    8-111    48-149 (163)
 12 TIGR03045 PS_II_C550 cytochrom  99.6 2.5E-15 5.4E-20   96.8   7.1   89    8-112    47-149 (159)
 13 PRK13618 psbV cytochrome c-550  99.6 5.3E-15 1.2E-19   95.5   7.7   90    8-112    48-150 (163)
 14 TIGR03046 PS_II_psbV2 photosys  99.6 1.4E-15 2.9E-20   97.3   4.9   88    9-111    52-144 (155)
 15 PRK13621 psbV cytochrome c-550  99.6   2E-15 4.3E-20   97.4   5.2   89    8-111    62-155 (170)
 16 PRK13620 psbV cytochrome c-550  99.6 1.7E-14 3.6E-19   95.4   7.6   88    8-112   100-202 (215)
 17 PRK13697 cytochrome c6; Provis  99.6 1.4E-14 2.9E-19   88.7   6.7   82    9-111    25-106 (111)
 18 TIGR00782 ccoP cytochrome c ox  99.6 2.1E-14 4.6E-19  100.8   8.5   83    9-112   200-283 (285)
 19 PRK14487 cbb3-type cytochrome   99.6 1.2E-14 2.6E-19   97.0   6.5   83    9-111    48-159 (217)
 20 COG2863 Cytochrome c553 [Energ  99.6 4.6E-15   1E-19   91.2   4.1   80    8-111    20-101 (121)
 21 TIGR03874 4cys_cytochr c-type   99.6 1.9E-14 4.2E-19   91.1   7.0   79   11-110    32-115 (143)
 22 PRK13619 psbV cytochrome c-550  99.5 6.2E-14 1.4E-18   89.2   5.8   89    8-111    47-148 (160)
 23 TIGR00782 ccoP cytochrome c ox  99.5 2.3E-13   5E-18   95.6   8.0   81   12-111   107-193 (285)
 24 PRK14486 putative bifunctional  99.5 3.9E-13 8.4E-18   94.6   8.3   80    9-111   212-291 (294)
 25 PRK13622 psbV cytochrome c-550  99.4 3.5E-12 7.6E-17   83.4   7.2   91    6-111    56-159 (180)
 26 COG3258 Cytochrome c [Energy p  99.4 3.4E-12 7.3E-17   87.2   7.1   84    7-112   157-253 (293)
 27 TIGR00781 ccoO cytochrome c ox  99.3 8.8E-12 1.9E-16   83.9   6.3   82    9-110    47-157 (232)
 28 COG2010 CccA Cytochrome c, mon  99.3 3.8E-12 8.3E-17   81.2   4.4   21   10-30     49-69  (150)
 29 PRK14486 putative bifunctional  99.3   1E-11 2.2E-16   87.5   6.6  102    9-111    48-187 (294)
 30 PF14495 Cytochrom_C550:  Cytoc  99.3 3.8E-12 8.2E-17   78.7   2.7   87    9-110    22-121 (135)
 31 COG4654 Cytochrome c551/c552 [  99.0 6.3E-10 1.4E-14   65.9   4.2   83    9-109    20-104 (110)
 32 TIGR03791 TTQ_mauG tryptophan   98.9 7.9E-09 1.7E-13   72.9   8.2  105    7-111   154-279 (291)
 33 PF02433 FixO:  Cytochrome C ox  98.8 1.6E-08 3.4E-13   68.3   5.1  102    9-110    47-157 (226)
 34 PRK14485 putative bifunctional  98.5 6.2E-07 1.3E-11   69.8   7.3  102    9-110   534-647 (712)
 35 COG2857 CYT1 Cytochrome c1 [En  98.3 2.6E-06 5.6E-11   59.1   5.8   42   70-111   172-213 (250)
 36 PF09098 Dehyd-heme_bind:  Quin  98.1 1.5E-06 3.3E-11   56.0   2.0   20   13-32      1-20  (167)
 37 COG3245 CycB Cytochrome c5 [En  97.9 2.8E-05 6.2E-10   47.5   4.5   75   14-111    49-125 (126)
 38 COG2993 CcoO Cbb3-type cytochr  97.8 6.6E-06 1.4E-10   54.6   1.1  100   10-110    50-159 (227)
 39 PF06537 DUF1111:  Protein of u  97.8   2E-05 4.4E-10   59.1   2.9   22    9-30    360-382 (499)
 40 PF09086 DUF1924:  Domain of un  97.8 2.2E-05 4.8E-10   46.4   2.5   27    5-31      4-39  (98)
 41 PF02167 Cytochrom_C1:  Cytochr  97.7 1.5E-05 3.2E-10   54.2   1.3   25    6-30      9-33  (219)
 42 TIGR03806 chp_HNE_0200 conserv  97.3 0.00082 1.8E-08   48.2   6.0   21   12-32    213-233 (317)
 43 COG3748 Predicted membrane pro  97.2  0.0015 3.3E-08   46.8   6.2   24   87-110   378-403 (407)
 44 PF14376 Haem_bd:  Haem-binding  97.1  0.0024 5.3E-08   40.5   6.3   97    9-110    30-136 (137)
 45 PF10643 Cytochrome-c551:  Phot  97.1 0.00047   1E-08   46.2   2.5   22    9-30    166-187 (233)
 46 COG1858 MauG Cytochrome c pero  96.9  0.0043 9.3E-08   45.2   6.8   26    5-30    213-240 (364)
 47 KOG3052 Cytochrome c1 [Energy   96.7 0.00037   8E-09   48.2   0.0   25    6-30     89-113 (311)
 48 TIGR02162 torC trimethylamine-  96.7  0.0024 5.2E-08   47.0   4.1   17   13-29    322-338 (386)
 49 COG3258 Cytochrome c [Energy p  96.6  0.0071 1.5E-07   42.1   5.3   16   96-111   121-136 (293)
 50 PRK15032 trimethylamine N-oxid  96.3  0.0063 1.4E-07   44.9   3.9   17   13-29    319-335 (390)
 51 PF09626 DHC:  Dihaem cytochrom  95.6    0.02 4.4E-07   35.5   3.4   11   19-29      1-11  (120)
 52 COG3488 Predicted thiol oxidor  94.6   0.022 4.8E-07   41.2   1.8   22    9-30    348-370 (481)
 53 PF03150 CCP_MauG:  Di-haem cyt  94.0    0.01 2.2E-07   38.6  -0.8   21   10-30      3-32  (159)
 54 TIGR03791 TTQ_mauG tryptophan   91.6   0.081 1.8E-06   37.7   0.9   22   10-31      4-34  (291)
 55 COG2857 CYT1 Cytochrome c1 [En  90.5   0.047   1E-06   38.0  -1.0   24    8-31     39-62  (250)
 56 PF07635 PSCyt1:  Planctomycete  90.3    0.17 3.7E-06   27.2   1.3    9   23-31      1-9   (59)
 57 COG1858 MauG Cytochrome c pero  83.3    0.59 1.3E-05   34.3   1.1   22   10-31     60-90  (364)
 58 PF06537 DUF1111:  Protein of u  82.0     0.8 1.7E-05   35.1   1.4   18   18-35     66-84  (499)
 59 PF09832 DUF2059:  Uncharacteri  79.6     1.8 3.8E-05   23.4   1.9   16   94-109    16-31  (64)
 60 PF08090 Enterotoxin_HS1:  Heat  78.9     1.3 2.8E-05   20.8   1.1   10   21-30     20-29  (36)
 61 TIGR03806 chp_HNE_0200 conserv  76.9     3.1 6.7E-05   30.1   3.0   23   22-45    145-167 (317)
 62 COG3043 NapB Nitrate reductase  75.5     1.8   4E-05   27.8   1.4   10   23-32    129-138 (155)
 63 PF07583 PSCyt2:  Protein of un  74.6     1.4 3.1E-05   29.9   0.8   14   15-28    166-182 (208)
 64 PRK11586 napB nitrate reductas  73.6     2.4 5.3E-05   27.2   1.6   11   22-32    122-132 (149)
 65 TIGR03153 cytochr_NrfH cytochr  73.2     1.2 2.7E-05   28.0   0.2   16   14-29     96-111 (135)
 66 TIGR01905 paired_CXXCH_1 doubl  69.7     1.9 4.1E-05   21.5   0.4   11   21-31      7-17  (41)
 67 PF03892 NapB:  Nitrate reducta  68.6     2.3 4.9E-05   26.9   0.7   11   22-32    111-121 (133)
 68 COG3488 Predicted thiol oxidor  67.6     2.4 5.1E-05   31.1   0.7   28    8-35     82-111 (481)
 69 PF07627 PSCyt3:  Protein of un  64.4     1.3 2.8E-05   26.7  -1.0    7   22-28     71-77  (101)
 70 PF11845 DUF3365:  Protein of u  64.3     1.9   4E-05   28.3  -0.4    8   21-28    147-154 (188)
 71 PF09722 DUF2384:  Protein of u  61.0     8.1 0.00017   20.0   1.8   42   69-111    10-51  (54)
 72 PF09699 Paired_CXXCH_1:  Doubl  60.1     2.7 5.8E-05   20.6  -0.1   10   22-31      8-17  (41)
 73 PF06943 zf-LSD1:  LSD1 zinc fi  59.6     4.6  0.0001   17.9   0.6    8   22-29     18-25  (25)
 74 TIGR01904 GSu_C4xC__C2xCH Geob  58.4     4.3 9.2E-05   20.4   0.4    6   22-27     37-42  (42)
 75 PF13822 ACC_epsilon:  Acyl-CoA  55.2      18  0.0004   19.5   2.7   18   94-111    10-27  (62)
 76 PHA02119 hypothetical protein   55.2     8.8 0.00019   21.5   1.4   10  101-110    57-66  (87)
 77 PF12162 STAT1_TAZ2bind:  STAT1  54.9      18 0.00038   15.7   2.0   18   86-107     5-22  (23)
 78 PF13986 DUF4224:  Domain of un  53.3     8.6 0.00019   19.7   1.1   14   94-107     2-15  (47)
 79 COG3005 TorC Nitrate/TMAO redu  50.3     6.2 0.00014   26.4   0.3   16   16-31    130-145 (190)
 80 TIGR01053 LSD1 zinc finger dom  50.1     6.6 0.00014   18.3   0.3    9   22-30     21-29  (31)
 81 PF11256 DUF3055:  Protein of u  47.5      22 0.00047   20.6   2.2   16   95-110    66-81  (81)
 82 CHL00037 petA cytochrome f      45.3     7.1 0.00015   28.1   0.0    7   22-28     55-61  (320)
 83 PHA02902 putative IMV membrane  44.4      27 0.00058   19.3   2.2   20   90-109    49-68  (70)
 84 cd07321 Extradiol_Dioxygenase_  44.3      12 0.00025   21.3   0.8   31   69-105    15-45  (77)
 85 PRK02693 apocytochrome f; Revi  44.2     7.6 0.00016   27.7   0.0    7   22-28     48-54  (312)
 86 COG3303 NrfA Formate-dependent  43.9     6.8 0.00015   29.3  -0.2   17   14-30    324-340 (501)
 87 PF13435 Cytochrome_C554:  Cyto  42.7      12 0.00026   22.1   0.7   10   21-30     49-58  (130)
 88 TIGR02826 RNR_activ_nrdG3 anae  41.7      65  0.0014   20.5   4.0    9   22-30     28-36  (147)
 89 PF14522 Cytochrome_C7:  Cytoch  41.7      11 0.00023   20.0   0.3    8   22-29     14-21  (65)
 90 PF07128 DUF1380:  Protein of u  40.4      56  0.0012   20.9   3.5   36   64-110    23-58  (139)
 91 COG5204 SPT4 Transcription elo  39.9      47   0.001   19.9   2.9   35   69-104    62-97  (112)
 92 cd07922 CarBa CarBa is the A s  39.6      16 0.00035   21.1   0.9   30   69-104    16-45  (81)
 93 PF06883 RNA_pol_Rpa2_4:  RNA p  38.7      34 0.00075   18.3   2.1   18   94-111     3-20  (58)
 94 PF10058 DUF2296:  Predicted in  37.9      13 0.00029   19.6   0.4   11   22-32     24-34  (54)
 95 PF11829 DUF3349:  Protein of u  37.8      45 0.00097   19.9   2.6   17   92-108    33-49  (96)
 96 PF13453 zf-TFIIB:  Transcripti  36.7      14  0.0003   18.0   0.3    8   22-29     21-28  (41)
 97 PHA02681 ORF089 virion membran  36.5      37 0.00079   19.7   2.0   19   91-109    48-66  (92)
 98 PF15161 Neuropep_like:  Neurop  35.8      11 0.00024   20.2  -0.2    8   22-29     15-22  (65)
 99 PF10955 DUF2757:  Protein of u  35.8      10 0.00022   21.6  -0.3   13   94-106    31-43  (76)
100 PF02304 Phage_B:  Scaffold pro  35.3      24 0.00053   21.4   1.2   19   10-28     62-82  (117)
101 COG0099 RpsM Ribosomal protein  34.8      47   0.001   20.7   2.4   16   93-108    46-61  (121)
102 TIGR02251 HIF-SF_euk Dullard-l  34.8      52  0.0011   21.1   2.8   23   90-112   137-159 (162)
103 PHA00003 B internal scaffoldin  34.4      30 0.00066   21.1   1.5   19   10-28     65-85  (120)
104 cd06395 PB1_Map2k5 PB1 domain   34.2      43 0.00092   19.4   2.0   14   96-109    58-71  (91)
105 PF14537 Cytochrom_c3_2:  Cytoc  34.2      15 0.00032   20.1   0.2    8   22-29      8-15  (80)
106 cd07921 PCA_45_Doxase_A_like S  33.9      24 0.00052   21.5   1.0   31   69-105    25-55  (106)
107 PF04320 DUF469:  Protein with   33.2      60  0.0013   19.6   2.7   19   93-111    68-86  (101)
108 PF07295 DUF1451:  Protein of u  32.1      47   0.001   21.3   2.2   17   93-109    31-47  (146)
109 cd04860 AE_Prim_S AE_Prim_S: p  31.9      46   0.001   23.0   2.3   17   94-110   150-166 (232)
110 PF13821 DUF4187:  Domain of un  31.6      43 0.00093   17.7   1.7   14   96-109    12-25  (55)
111 PF06677 Auto_anti-p27:  Sjogre  31.6      41 0.00088   16.7   1.5   17   12-28      9-25  (41)
112 PRK11659 cytochrome c nitrite   31.5      14 0.00031   24.5  -0.2   10   22-31    134-143 (183)
113 PF04674 Phi_1:  Phosphate-indu  31.3      45 0.00097   23.8   2.2   21   91-111    19-39  (273)
114 PF14769 CLAMP:  Flagellar C1a   30.6      63  0.0014   19.0   2.5   17   93-109    62-78  (101)
115 KOG1605 TFIIF-interacting CTD   30.4      94   0.002   22.0   3.7   22   90-111   226-247 (262)
116 TIGR03152 cyto_c552_HCOOH form  30.1      25 0.00054   26.8   0.8   10   22-31    122-131 (439)
117 PF10281 Ish1:  Putative stress  30.0      72  0.0016   15.1   3.8   13   67-79      3-15  (38)
118 TIGR03146 cyt_nit_nrfB cytochr  29.3      18 0.00039   22.9  -0.0   10   22-31    111-120 (145)
119 PF07095 IgaA:  Intracellular g  29.2      95  0.0021   25.2   3.8   22   90-111    41-62  (705)
120 CHL00137 rps13 ribosomal prote  29.1      64  0.0014   20.0   2.4   15   94-108    47-61  (122)
121 CHL00136 rpl31 ribosomal prote  29.1      24 0.00053   19.6   0.5    9   21-29     36-44  (68)
122 PF08263 LRRNT_2:  Leucine rich  29.1      58  0.0013   15.7   1.9   15   97-111     2-16  (43)
123 TIGR03631 bact_S13 30S ribosom  28.9      63  0.0014   19.7   2.4   16   93-108    44-59  (113)
124 TIGR02161 napC_nirT periplasmi  28.3      28  0.0006   23.2   0.8    9   22-30     77-85  (185)
125 PF12123 Amidase02_C:  N-acetyl  28.1      74  0.0016   16.2   2.1   17   93-109    22-38  (45)
126 PRK11032 hypothetical protein;  28.0      62  0.0013   21.2   2.3   17   93-109    41-57  (160)
127 PF07102 DUF1364:  Protein of u  28.0      11 0.00023   22.5  -1.1    9   22-30     53-61  (94)
128 PRK00019 rpmE 50S ribosomal pr  27.8      26 0.00057   19.7   0.5    9   21-29     36-44  (72)
129 PRK11125 nrfA cytochrome c nit  27.6      29 0.00063   26.8   0.8   10   22-31    160-169 (480)
130 PF03264 Cytochrom_NNT:  NapC/N  27.6      15 0.00033   23.8  -0.6   18   13-30    113-134 (173)
131 PF02335 Cytochrom_C552:  Cytoc  27.2      32  0.0007   26.2   1.0    9   20-28    272-280 (434)
132 PRK10617 cytochrome c-type pro  27.2      30 0.00064   23.5   0.7   10   22-31     86-95  (200)
133 cd03271 ABC_UvrA_II The excisi  27.1      28 0.00061   24.4   0.6   16   95-110   203-218 (261)
134 KOG0262 RNA polymerase I, larg  26.8 1.5E+02  0.0032   26.3   4.6   52   58-109   477-536 (1640)
135 PF13099 DUF3944:  Domain of un  26.8      30 0.00064   16.7   0.5   15   94-108    12-26  (35)
136 PRK05179 rpsM 30S ribosomal pr  26.6      71  0.0015   19.8   2.3   16   94-109    47-62  (122)
137 TIGR03629 arch_S13P archaeal r  26.1      76  0.0016   20.3   2.4   16   94-109    51-66  (144)
138 TIGR02245 HAD_IIID1 HAD-superf  25.5 1.4E+02  0.0031   20.0   3.8   18   94-111   162-179 (195)
139 PF09630 DUF2024:  Domain of un  25.5     9.4  0.0002   22.0  -1.6   13   17-29     49-61  (81)
140 PF05927 Penaeidin:  Penaeidin;  25.2      36 0.00078   19.0   0.7   10   21-30     44-53  (73)
141 PF12408 DUF3666:  Ribose-5-pho  25.1      49  0.0011   17.1   1.2   12   99-110    37-48  (48)
142 PRK01397 50S ribosomal protein  25.0      32 0.00069   19.7   0.5    9   21-29     35-43  (78)
143 PF14053 DUF4248:  Domain of un  24.9 1.3E+02  0.0029   16.6   3.2   39   70-108    25-67  (69)
144 PLN03217 transcription factor   24.3      90  0.0019   18.3   2.2   17   94-110    16-32  (93)
145 PTZ00134 40S ribosomal protein  24.0      79  0.0017   20.5   2.2   17   93-109    59-75  (154)
146 PRK11702 hypothetical protein;  24.0   1E+02  0.0023   18.8   2.6   17   93-109    75-91  (108)
147 PF04270 Strep_his_triad:  Stre  23.8      94   0.002   16.4   2.1   17   93-109    36-52  (53)
148 COG3086 RseC Positive regulato  23.8      30 0.00064   22.3   0.2   22   12-33     11-36  (150)
149 PF00432 Prenyltrans:  Prenyltr  23.8      86  0.0019   15.2   1.9   13   99-111     2-14  (44)
150 PF02085 Cytochrom_CIII:  Class  23.7      43 0.00092   19.6   0.9    9   22-30     49-57  (102)
151 TIGR03823 FliZ flagellar regul  23.4      25 0.00055   22.9  -0.1   10   21-30     23-32  (168)
152 PF11310 DUF3113:  Protein of u  23.3      71  0.0015   17.0   1.6   12   97-108    28-39  (60)
153 PF01197 Ribosomal_L31:  Riboso  23.3      38 0.00083   18.7   0.6    9   21-29     37-45  (69)
154 TIGR00105 L31 ribosomal protei  23.2      36 0.00078   18.8   0.5    9   21-29     36-44  (68)
155 cd08168 Cytochrom_C3 Heme-bind  23.2      34 0.00074   19.3   0.4    9   22-30     35-43  (85)
156 COG0633 Fdx Ferredoxin [Energy  23.1      31 0.00068   20.5   0.3    8   22-29     44-51  (102)
157 PF13447 Multi-haem_cyto:  Seve  23.1      36 0.00078   24.1   0.6   13   17-29    210-222 (267)
158 PF06648 DUF1160:  Protein of u  23.1      63  0.0014   20.2   1.6   15   94-108    98-112 (122)
159 PRK00528 rpmE 50S ribosomal pr  22.9      37  0.0008   19.0   0.5    9   21-29     38-46  (71)
160 PF12797 Fer4_2:  4Fe-4S bindin  22.8      34 0.00074   14.6   0.3    8   21-28      8-15  (22)
161 PF14566 PTPlike_phytase:  Inos  22.8      81  0.0018   20.0   2.1   18   95-112   106-123 (149)
162 PF10180 DUF2373:  Uncharacteri  22.7 1.2E+02  0.0026   16.6   2.5   17   95-111    34-50  (65)
163 COG3184 Uncharacterized protei  22.3      67  0.0015   21.5   1.7   17   93-109   106-122 (183)
164 COG1579 Zn-ribbon protein, pos  22.3      34 0.00073   23.9   0.3    8   22-29    199-206 (239)
165 PF10820 DUF2543:  Protein of u  22.2      77  0.0017   17.8   1.7   16   95-110    24-39  (81)
166 PRK04053 rps13p 30S ribosomal   22.1   1E+02  0.0022   19.9   2.4   16   93-108    54-69  (149)
167 PRK11582 flagella biosynthesis  22.0      29 0.00063   22.7  -0.1   10   21-30     23-32  (169)
168 PRK01678 rpmE2 50S ribosomal p  21.8      39 0.00086   19.7   0.5    9   21-29     49-57  (87)
169 PF07637 PSD5:  Protein of unkn  21.7 1.4E+02   0.003   16.0   2.6   19   91-109    15-33  (64)
170 PF09601 DUF2459:  Protein of u  21.7      93   0.002   20.5   2.3   15   95-109    98-112 (173)
171 PF13709 DUF4159:  Domain of un  21.4      88  0.0019   21.1   2.2   16   94-109    66-81  (207)
172 PF04369 Lactococcin:  Lactococ  21.4      53  0.0011   17.8   0.9   12   93-104     8-19  (60)
173 cd07347 harmonin_N_like N-term  21.4   1E+02  0.0022   17.6   2.1   17   94-110    15-31  (78)
174 COG3183 Predicted restriction   21.2      30 0.00066   24.5  -0.1    8   22-29    243-250 (272)
175 PF15332 LIME1:  Lck-interactin  21.1      38 0.00083   23.0   0.4    8   23-30      2-9   (228)
176 PF09256 BaffR-Tall_bind:  BAFF  21.1      23 0.00049   16.5  -0.5    9   21-29     15-23  (31)
177 PF02831 gpW:  gpW;  InterPro:   21.0      46 0.00099   18.5   0.6   16   96-111    36-51  (68)
178 PF06207 DUF1002:  Protein of u  21.0      95  0.0021   21.5   2.3   17   95-111   192-208 (225)
179 PF11116 DUF2624:  Protein of u  20.9      99  0.0021   18.0   2.0   16   95-110    31-46  (85)
180 TIGR03507 decahem_SO1788 decah  20.7      39 0.00085   27.1   0.4   10   21-30    294-303 (664)
181 COG4840 Uncharacterized protei  20.5 1.4E+02  0.0031   16.6   2.4   19   94-112    53-71  (71)

No 1  
>PTZ00405 cytochrome c; Provisional
Probab=99.97  E-value=2.4e-31  Score=163.42  Aligned_cols=108  Identities=53%  Similarity=0.929  Sum_probs=99.4

Q ss_pred             CCCCCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCC
Q 033761            5 DEAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYI   84 (112)
Q Consensus         5 ~a~~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~   84 (112)
                      .+...+++++|++||+.+|++||+++..+...+||+|.++.+|..+..++|.|+..+++.+++|+.++|..||.+|....
T Consensus         7 ~~~~~gd~~~G~~lF~~~C~aCH~~~~~~~~~vGP~L~gv~gR~~g~~~~~~YS~al~~~g~~wd~~~L~~~l~~P~~~~   86 (114)
T PTZ00405          7 APLPPGDAERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRKSGTVEGFAYSKANADSGVIWTPEVLDVYLENPKKFM   86 (114)
T ss_pred             ccCCccCHHHHHHHHHhhhHhhCCCCCCCCCCcCCCccccccCccccccCccccHHHHhccCcCCHHHHHHHHHCHHhhC
Confidence            45667899999999998899999987555568999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhccC
Q 033761           85 PGTKMVFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        85 ~~~~m~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                      |+++|+|.++.+++|+++|++||++|+.
T Consensus        87 pgt~M~f~gl~~~~dr~~liaYL~sl~~  114 (114)
T PTZ00405         87 PGTKMSFAGIKKPQERADVIAYLETLKD  114 (114)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHhcC
Confidence            9999999999899999999999999874


No 2  
>COG3474 Cytochrome c2 [Energy production and conversion]
Probab=99.96  E-value=4.4e-29  Score=153.70  Aligned_cols=102  Identities=57%  Similarity=1.012  Sum_probs=97.5

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcc--cccccHHHHHHHHhCCCCCCCC
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNM--AVNWEEKTLYDYLLNPKKYIPG   86 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~l~~~l~~~~~~~~~   86 (112)
                      .+++..|+.+|++ |.+||+++..|.+.+||.|.++.+|..++.++|.|+.+++..  +++|+.+.|..||.+|..+.||
T Consensus        28 ~~da~~G~~vFkk-C~~CH~i~~~g~nkvGP~L~gVvGR~ags~egf~YS~Amk~~~~g~vWd~~~L~~fL~~Pkk~vpG  106 (135)
T COG3474          28 LGDAAAGEKVFKK-CQACHSIEKGGPNKVGPHLWGVVGRPAGSVEGFSYSAAMKKAGGGIVWDEDNLDEFLTAPKKYVPG  106 (135)
T ss_pred             cccHHHhHHHHHH-HHHhhccccCCCCCCCCccccccCccccccCCcccCHHHHhccCCcccCHHHHHHHHhChhhhCCC
Confidence            4799999999986 999999998888999999999999999999999999999998  8999999999999999999999


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           87 TKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        87 ~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      +.|.|.++..++||.+|++||++++
T Consensus       107 TkM~faGlkk~~dradlIAYLk~~~  131 (135)
T COG3474         107 TKMAFAGLKKDQDRADLIAYLKSLP  131 (135)
T ss_pred             cceeecCCCCHHHHHHHHHHHHhcc
Confidence            9999999999999999999999876


No 3  
>PTZ00048 cytochrome c; Provisional
Probab=99.96  E-value=2.7e-28  Score=150.34  Aligned_cols=105  Identities=60%  Similarity=1.137  Sum_probs=95.1

Q ss_pred             CCCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCC
Q 033761            7 APPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPG   86 (112)
Q Consensus         7 ~~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~   86 (112)
                      .+.+++++|+++|+++|+.||++++.+...+||+|.++.++..+. ++|.|+..+...++.|+.++|..||.+|....|+
T Consensus        10 ~~~~~~~~G~~~f~~~C~~CH~~~~~g~~~~GP~L~Gi~gR~~g~-~~~~ys~~~~~~g~~wt~~~L~~~l~~P~~~~pg   88 (115)
T PTZ00048         10 VPEGDAKKGAKLFKAKCAQCHTINKGGAVKQGPNLHGFYGRKSGS-ADFPYSDANKNSGIVWSDKHLFEYLVNPKLYIPG   88 (115)
T ss_pred             CCcccHHHHHHHHHhhhhhcCCCcCCCCCCcCCcccccccccccC-CCCccchhhhhcccccCHHHHHHHHhCcCccCCC
Confidence            446788999999998999999998767678899999999998887 7888888888888999999999999999999999


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhccC
Q 033761           87 TKMVFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        87 ~~m~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                      +.|+|.++.+++|+++|++||++|+.
T Consensus        89 t~M~~~gl~~~~~~~~liaYL~s~~~  114 (115)
T PTZ00048         89 TKMVFAGIKKEKERADLIAYLKEASS  114 (115)
T ss_pred             CccCcCCCCCHHHHHHHHHHHHHhcc
Confidence            99999888889999999999999863


No 4  
>KOG3453 consensus Cytochrome c [Energy production and conversion]
Probab=99.75  E-value=1.7e-18  Score=103.67  Aligned_cols=104  Identities=64%  Similarity=1.124  Sum_probs=96.1

Q ss_pred             CCCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCC
Q 033761            7 APPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPG   86 (112)
Q Consensus         7 ~~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~   86 (112)
                      ..+.+.+.|..+|.+.|..||.++..+...++|+|.++.++..++...+.+..+...-++.|..+.|..+|.+|..++|+
T Consensus         4 ~~~~d~~~g~~~f~~rc~qch~~~~~~~~k~~p~l~gl~g~~~g~~~~~sy~~a~KnKgV~wgE~tl~eyLenpkkyipG   83 (110)
T KOG3453|consen    4 VPAGDVEKGKKIFPQRCAQCHTVEKGGFHKTGPNLHGLFGRQLGQAAGLSYTDANKNKGVTWGEDTLMEYLENPKKYIPG   83 (110)
T ss_pred             ccccccccccccceeeccccccccCCcccccCCcchhhHHHhhccccCcceeecccCCceEEcchhHHHHHhCCCccccc
Confidence            44678899999999999999999887778899999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhc
Q 033761           87 TKMVFPGLKKPQDRADLIAYLKQS  110 (112)
Q Consensus        87 ~~m~~~~~ls~~e~~~l~ayl~~l  110 (112)
                      +.|-|.++-...|+.|+++||..-
T Consensus        84 tKmifaGikk~~eraDlIayl~ka  107 (110)
T KOG3453|consen   84 TKMIFAGIKKKAERADLIAYLKKA  107 (110)
T ss_pred             cceeecccCchHHHHHHHHHHHHh
Confidence            999998887779999999999753


No 5  
>TIGR03872 cytochrome_MoxG cytochrome c(L), periplasmic. This model describes a periplasmic c-type cytochrome that serves as the primary electron acceptor for the quinoprotein methanol dehydrogenase, a PQQ enzyme. The member from Paracoccus denitrificans is also characterized as an electron acceptor for methylamine dehydrogenase, a tryptophan tryptophylquinone enzyme. This protein is called cytochrome c(L) in methylotrophic bacteria such Methylobacterium extorquens, but c551i in Paracoccus denitrificans.
Probab=99.71  E-value=5e-17  Score=102.36  Aligned_cols=82  Identities=22%  Similarity=0.360  Sum_probs=58.7

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCCCC
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTK   88 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~   88 (112)
                      ...+++|++||..+|++||+.++.|.  .||+|.+.......                ....+.|.+.+..+.    ..+
T Consensus        41 ~~~~a~G~~ly~~~CAaCHG~~g~G~--~gP~L~~~~~~~~~----------------~~~~~~l~~~i~~G~----~g~   98 (133)
T TIGR03872        41 AEALKKGESLFATACSGCHGHLAEGK--LGPGLNDDYWTYPK----------------NTTDKGLFETIFGGA----NGM   98 (133)
T ss_pred             HHHHHHHHHHHHHhhHHhCCCCCCCC--CCCCCcCcccccCC----------------cccHHHHHHHHHcCC----CCC
Confidence            45678999999999999999987653  47988764321100                002445667776653    346


Q ss_pred             C-CCCCCCCHHHHHHHHHHHHhccC
Q 033761           89 M-VFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        89 m-~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                      | +|...|+++||++|++||+++.+
T Consensus        99 Mp~~~~~LsdeeI~aLaaYI~sl~~  123 (133)
T TIGR03872        99 MGPQYGNLTLDEMLQIMAWIRHLYT  123 (133)
T ss_pred             CcccccCCCHHHHHHHHHHHHHhCC
Confidence            7 57778999999999999999864


No 6  
>TIGR02603 CxxCH_TIGR02603 putative heme-binding domain, Pirellula/Verrucomicrobium type. This model represents a domain limited to very few species but expanded into large paralogous families in some species that conain it. We find it in over 20 copies each in Pirellula sp. strain 1 (phylum Planctomycetes) and Verrucomicrobium spinosum DSM 4136 (phylum Verrucomicrobia), and no matches above trusted cutoff an any other species so far. This domain, about 140 amino acids long, contains an absolutely conserved motif CxxCH, the cytochrome c family heme-binding site signature (PS00190).
Probab=99.66  E-value=2.8e-16  Score=99.19  Aligned_cols=35  Identities=29%  Similarity=0.721  Sum_probs=29.7

Q ss_pred             ccHHHHHHHHHhcCCccccCcCCCCCCCCCCccccc
Q 033761           10 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLF   45 (112)
Q Consensus        10 ~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~   45 (112)
                      +++++|+.+|.+.|++||++++.|. ..||+|.++.
T Consensus         1 gd~~~G~~~f~~~C~~CH~~~g~g~-~~gP~L~~~~   35 (133)
T TIGR02603         1 GDAEKGKAVYAQRCYVCHRIGGEGV-DVGPDLTGVG   35 (133)
T ss_pred             CCHHHHHHHHHhHHHHhCCCCCCCC-ccCCCccccc
Confidence            4788999999988999999987664 6789999864


No 7  
>PRK13617 psbV cytochrome c-550; Provisional
Probab=99.66  E-value=2.8e-16  Score=101.56  Aligned_cols=88  Identities=24%  Similarity=0.342  Sum_probs=64.4

Q ss_pred             CccHHHHHHHHHhcCCccccCcCC-CCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCC---
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKG-AGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYI---   84 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~-g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~---   84 (112)
                      ++++.+|+++|+.+|++||...+- ..+.+||+|..+....    +            ...+.+.|.+||++|..++   
T Consensus        56 ~~~~~~G~~~F~~~C~~CH~~g~T~~n~~vg~dL~~L~aa~----p------------~r~nv~aLv~yikdP~sydg~~  119 (170)
T PRK13617         56 ESEIKAGRKVFNTSCGTCHAGGITKTNQNVGLDPETLALAT----P------------ARDNVDALVDYLKDPTSYDGEY  119 (170)
T ss_pred             HHHHHHHHHHHHcchhhhccCCCcCCCCCcCCCHHHHhccC----C------------CCCCHHHHHHHHhChHhhcchh
Confidence            346789999999899999975432 2346788886553211    0            0126889999999997766   


Q ss_pred             ------CCC----CCCCCCCCCHHHHHHHHHHHHhccC
Q 033761           85 ------PGT----KMVFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        85 ------~~~----~m~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                            |+.    .||-...|||+|+.+|++||..++|
T Consensus       120 s~~e~~P~~~~~~imP~~~~LsdeeL~alAayLl~~~k  157 (170)
T PRK13617        120 SIADLHPSMRSADLYPAMRDLNDEDLRLMAGYILVAPK  157 (170)
T ss_pred             hccccCccccccccCcccCCCCHHHHHHHHHHHHhccc
Confidence                  543    5664456899999999999998854


No 8  
>PF00034 Cytochrom_C:  Cytochrome c;  InterPro: IPR003088 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes. Ambler [] recognised four classes of cytC. Class I includes the low-spin soluble cytC of mitochondria and bacteria, with the haem-attachment site towards the N terminus, and the sixth ligand provided by a methionine residue about 40 residues further on towards the C terminus. On the basis of sequence similarity, class I cytC were further subdivided into five classes, IA to IE. Class IB includes the eukaryotic mitochondrial cytC and prokaryotic 'short' cyt c2 exemplified by Rhodopila globiformis cyt c2; class IA includes 'long' cyt c2, such as Rhodospirillum rubrum cyt c2 and Aquaspirillum itersonii cyt c-550, which have several extra loops by comparison with class IB cytC.; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1YNR_B 2AI5_A 1AYG_A 3O5C_C 1YEA_A 3CXH_W 1YTC_A 1YEB_A 2YBB_Y 2B4Z_A ....
Probab=99.64  E-value=4e-18  Score=99.46  Aligned_cols=80  Identities=30%  Similarity=0.507  Sum_probs=49.5

Q ss_pred             HHHHHHHHHhcCCccccCcCCCCCCC-CCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCC----------
Q 033761           12 AKAGEKIFKTKCAQCHTVEKGAGHKQ-GPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNP----------   80 (112)
Q Consensus        12 ~~~G~~lf~~~C~~CH~~~~~g~~~~-gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~----------   80 (112)
                      +++|++||..+|++||+.++.+.... +|+|.++..+..                    .+++..++.++          
T Consensus         1 a~~G~~l~~~~C~~CH~~~~~~~~~~~~p~l~~~~~~~~--------------------~~~~~~~~~~~~~~~~~~~~~   60 (91)
T PF00034_consen    1 AARGKELFQANCAACHGADGNGDGGGPGPDLTGIGKRYS--------------------YDWIGRYITNPEAISPPAHMP   60 (91)
T ss_dssp             HHHHHHHHHHHTTTTHBTSTTSSSSSTSHBHTTHTHHBT--------------------THHTHHHHHHHHHHHHHHHHH
T ss_pred             ChhHHHHHhCcChhcCCCCCcCCccccCccccCccccch--------------------HHHHHHHHHHHhhhccccchh
Confidence            57999999778999999987665444 588887654321                    11111111111          


Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           81 KKYIPGTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        81 ~~~~~~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      ........|+....||++|+++|++||++|+
T Consensus        61 ~~~~~~~~~~~~~~ls~~e~~~l~ayl~slk   91 (91)
T PF00034_consen   61 DAMPMFPMMPMPKILSDEEIADLAAYLRSLK   91 (91)
T ss_dssp             HHHHHHHHHHHHHTSSHHHHHHHHHHHHHTS
T ss_pred             hccCcccCCcccCCCCHHHHHHHHHHHHHhC
Confidence            0000112233222689999999999999986


No 9  
>CHL00183 petJ cytochrome c553; Provisional
Probab=99.63  E-value=8.3e-16  Score=93.79  Aligned_cols=84  Identities=21%  Similarity=0.249  Sum_probs=57.7

Q ss_pred             CCCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCC
Q 033761            7 APPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPG   86 (112)
Q Consensus         7 ~~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~   86 (112)
                      ...++++.|+.||..+|++||+.   |.+..+|.+....             ..+.... ..+.+.+..+++++.    +
T Consensus        21 ~~~a~~~~G~~ly~~~Ca~CHg~---g~~~~~P~~~~~~-------------~~l~~~~-~~~~~~i~~~i~~G~----~   79 (108)
T CHL00183         21 AFAADLDNGEQIFSANCAACHAG---GNNVIMPEKTLKK-------------DALEANS-MNSIEAITYQVTNGK----N   79 (108)
T ss_pred             cccccHHHHHHHHHHHHHHHCCC---CCCCCCCCcccCH-------------HHHhhCc-CCCHHHHHHHHHcCc----c
Confidence            34567899999999999999984   2234567654211             0111111 125678888998865    2


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           87 TKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        87 ~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      .|++|...||++|+++|++||.++.
T Consensus        80 ~MP~f~~~Ls~~ei~~i~aYi~~~~  104 (108)
T CHL00183         80 AMPAFGGRLSDEDIEDVANYVLSQA  104 (108)
T ss_pred             ccccccCCCCHHHHHHHHHHHHHhh
Confidence            3445877899999999999999875


No 10 
>PF13442 Cytochrome_CBB3:  Cytochrome C oxidase, cbb3-type, subunit III ; PDB: 1KB0_A 2DGE_D 2CE1_A 2CE0_A 2V07_A 1W2L_A 2ZOO_A 2ZBO_G 1DVV_A 2EXV_A ....
Probab=99.63  E-value=3.8e-16  Score=87.57  Aligned_cols=67  Identities=30%  Similarity=0.662  Sum_probs=51.6

Q ss_pred             ccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCCCCC
Q 033761           10 GNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKM   89 (112)
Q Consensus        10 ~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~m   89 (112)
                      +++..|+.||.++|++||+.+     ..||+|.+.                      .|+.+.|..++.++.    +.|+
T Consensus         1 a~~~~G~~ly~~~C~~CH~~~-----~~gp~l~~~----------------------~~~~~~l~~~i~~g~----~~Mp   49 (67)
T PF13442_consen    1 ADAAKGKALYEQNCASCHGPG-----GAGPSLAGK----------------------DWSPEELYNIIRNGR----GGMP   49 (67)
T ss_dssp             -HHHHHHHHHHHHTHHHHGTG-----SSSSTSTHH----------------------HHHHHHHHHHHHHTB----TTBS
T ss_pred             CcHHHHHHHHHhHhHHhcCCC-----ccCccchhh----------------------hhhHHHHHHHHHhCc----CCCC
Confidence            467899999999999999943     235777643                      245678888888776    3455


Q ss_pred             CCCCCCCHHHHHHHHHHH
Q 033761           90 VFPGLKKPQDRADLIAYL  107 (112)
Q Consensus        90 ~~~~~ls~~e~~~l~ayl  107 (112)
                      +|...||++|+++|++||
T Consensus        50 ~~~~~ls~~e~~~l~~yi   67 (67)
T PF13442_consen   50 PFGGQLSDEEIEALAAYI   67 (67)
T ss_dssp             CTTTTSTHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHC
Confidence            677789999999999997


No 11 
>CHL00133 psbV photosystem II cytochrome c550; Validated
Probab=99.61  E-value=1.9e-15  Score=97.46  Aligned_cols=88  Identities=20%  Similarity=0.306  Sum_probs=58.3

Q ss_pred             CCccHHHHHHHHHhcCCccccCcCC-CCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCC---
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEKG-AGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKY---   83 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~~-g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~---   83 (112)
                      .++++++|++||..+|+.||..... ..+.+++++..+.+.    .+            ...+.++|.+||++|..+   
T Consensus        48 t~~~~~~Gk~lF~~~CaaCH~~G~~~~~p~vgl~l~~L~~A----~~------------~r~~~~~Lv~~iknP~~ydg~  111 (163)
T CHL00133         48 TPEQVKRGKRLFNASCGACHVGGITKTNPNVGLDPEALSLA----TP------------PRDNIEALVDYMKNPTTYDGL  111 (163)
T ss_pred             CHHHHHHHHHHHHhhHHHhCCCCCCCCCCCCCCCHHHHhhc----CC------------CcccHHHHHHHHhCcccccch
Confidence            3457899999999999999962100 112334444433220    00            012688999999999873   


Q ss_pred             ----------CCCCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           84 ----------IPGTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        84 ----------~~~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                                .++..||-...||++|+.+|++||....
T Consensus       112 ~~i~~~~~~~K~~~~MPa~~~LsdeEL~aVAaYIl~q~  149 (163)
T CHL00133        112 ESIAEIHPSIKSADIFPKMRSLTDEDLYAIAGHILLQP  149 (163)
T ss_pred             HHHHHhhcccCccccCCCCCCCCHHHHHHHHHHHHhcc
Confidence                      2345576446789999999999997643


No 12 
>TIGR03045 PS_II_C550 cytochrome c-550. Members of this protein family are cytochrome c-550, the PsbV extrinsic protein of photosystem II, from both Cyanobacteria and chloroplasts. A paralog to this protein, PsbV2, is found in some species in addition to PsbV itself.
Probab=99.61  E-value=2.5e-15  Score=96.82  Aligned_cols=89  Identities=19%  Similarity=0.260  Sum_probs=60.1

Q ss_pred             CCccHHHHHHHHHhcCCccccCcCC-CCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCC---
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEKG-AGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKY---   83 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~~-g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~---   83 (112)
                      .++++++|++||+.+|++||..... ..+.+++++..+....    +            ...+.++|..||++|..+   
T Consensus        47 ~~~~~~~Gk~lF~~~Ca~CH~~G~~~~~p~vgl~l~~L~~A~----~------------~r~~v~~Lv~~iknP~~~dg~  110 (159)
T TIGR03045        47 TEEQVKRGKRLFNTACGTCHVGGITKTNPNVGLDPEALALAT----P------------PRDNVEALVDYMKNPTSYDGE  110 (159)
T ss_pred             ChHhHHHHHHHHHHHHHHhCCCCCCCCCCCCCCChhhHHhcC----C------------CccCHHHHHHHHhCccccccc
Confidence            3568899999999999999952211 1134444544433210    0            012688999999999755   


Q ss_pred             ----------CCCCCCCCCCCCCHHHHHHHHHHHHhccC
Q 033761           84 ----------IPGTKMVFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        84 ----------~~~~~m~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                                .+...||....||++|+.+|++||....+
T Consensus       111 ~~~~~~hp~~k~~~~mP~~~~LsdeEL~avAaYIl~q~~  149 (159)
T TIGR03045       111 ESIAELHPSIRSADIFPKMRNLTDEDLRLIAGHILVQPK  149 (159)
T ss_pred             chhhhcccccCcccccCCcCCCCHHHHHHHHHHHHHhcc
Confidence                      23456765566899999999999987653


No 13 
>PRK13618 psbV cytochrome c-550; Provisional
Probab=99.60  E-value=5.3e-15  Score=95.51  Aligned_cols=90  Identities=21%  Similarity=0.271  Sum_probs=62.0

Q ss_pred             CCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCC----
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKY----   83 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~----   83 (112)
                      ..+++++|+++|+.+|++||. .  |....+|++..-.....+..+.            +.+.+.|..||++|..+    
T Consensus        48 s~~~~~~G~~lF~~~Ca~CH~-~--G~~~~~p~~~l~~~~La~a~p~------------rd~v~~l~~yik~P~~~Dg~~  112 (163)
T PRK13618         48 SLKQVKEGKRLFNYACAQCHA-G--GVTKTNQNVGLEPEALALATPN------------RDNIEGLVDYMKNPTTYDGEE  112 (163)
T ss_pred             ChhhHHHHHHHHHHHHHHhcC-C--CCCCCCCCcCCChhhhccCCCC------------ccCHHHHHHHHhCchhccccc
Confidence            456889999999999999994 2  3355567665321111111110            12678999999999886    


Q ss_pred             ---------CCCCCCCCCCCCCHHHHHHHHHHHHhccC
Q 033761           84 ---------IPGTKMVFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        84 ---------~~~~~m~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                               .+...||-...|||+|+.+|++||..+.|
T Consensus       113 ~~~~~h~~ik~~~~mP~~~~Lsd~eL~ava~yll~~~~  150 (163)
T PRK13618        113 EISEIHPSIKSADIFTAMRNLTDKDLEAIAGHILVQPK  150 (163)
T ss_pred             hhcccccccCccccCCCCCCCCHHHHHHHHHHHHhccC
Confidence                     34456775556899999999999976543


No 14 
>TIGR03046 PS_II_psbV2 photosystem II cytochrome PsbV2. Members of this protein family are PsbV2, a protein closely related cytochrome c-550 (PsbV), a protein important to the water-splitting and oxygen-evolving activity of photosystem II. Mutant studies in Thermosynechococcus elongatus showed PsbV2 can partially replace PsbV, from which it appears to have arisen first by duplication, then by intergenic recombination with a different gene.
Probab=99.60  E-value=1.4e-15  Score=97.31  Aligned_cols=88  Identities=22%  Similarity=0.417  Sum_probs=58.4

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCC---
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIP---   85 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~---   85 (112)
                      ++++.+|+++|..+|++||.-   |.+.+.|+..-......+..+.            +-+.++|.+|+++|..+.+   
T Consensus        52 ~~d~~~G~~lF~~~Ca~CH~g---G~n~~~p~~~L~~~~L~~atp~------------Rd~I~~Lv~~iknP~s~kG~~~  116 (155)
T TIGR03046        52 PEQLTDGKNLFESNCLNCHVG---GATLPNPNVSLSLKDLKGATPP------------RDTIQSLVAYQRDPMSYDGSEE  116 (155)
T ss_pred             HHHHHhHHHHHHHHHHHhccC---CCCCcCCCCCCCHHHHhcCCCc------------hHHHHHHHHHhhCCcccCcccc
Confidence            458899999999999999963   3334444322111111111110            0135789999999998766   


Q ss_pred             --CCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           86 --GTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        86 --~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                        +..||....|||+|+++|++||....
T Consensus       117 ~~~~~mp~~~~LsdeEL~aIAaYLl~qa  144 (155)
T TIGR03046       117 SYGCRPVPEDWMDDEEVENLAAFILRAA  144 (155)
T ss_pred             cccccCCcccCCCHHHHHHHHHHHHHhh
Confidence              44566666789999999999998653


No 15 
>PRK13621 psbV cytochrome c-550; Provisional
Probab=99.59  E-value=2e-15  Score=97.42  Aligned_cols=89  Identities=22%  Similarity=0.445  Sum_probs=60.4

Q ss_pred             CCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCC--
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIP--   85 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~--   85 (112)
                      .++++..|+++|..+|++||.   .|...+.|+..-......+..+.            .-+.++|.+|+++|..+.+  
T Consensus        62 s~~d~~~G~~lF~~~Ca~CH~---gG~n~v~p~ktL~~~~L~~a~p~------------rd~I~~LV~~iknPms~kg~~  126 (170)
T PRK13621         62 SPEQLTDGKQLFDSNCLNCHV---GGATLPNPNVSLSLKDLRGATPP------------RDNIAALVAYQRDPMSYDGSE  126 (170)
T ss_pred             CHHHHHhHHHHHHHHHHHhcc---CCCCCcCCCCCCCHHHHhcCCCc------------hHHHHHHHHHhhCCCCCCccc
Confidence            456889999999999999995   33455566433211111111111            1145799999999998865  


Q ss_pred             ---CCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           86 ---GTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        86 ---~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                         +..|+....||++|+++|++||....
T Consensus       127 ~~~~~~mps~~~LSdeEL~aIAaYLL~qA  155 (170)
T PRK13621        127 ESYGCRQVPEDWMTDEELQNLAAFILRAA  155 (170)
T ss_pred             ccccccCCccCCCCHHHHHHHHHHHHhhh
Confidence               45565556789999999999997653


No 16 
>PRK13620 psbV cytochrome c-550; Provisional
Probab=99.56  E-value=1.7e-14  Score=95.39  Aligned_cols=88  Identities=20%  Similarity=0.249  Sum_probs=65.0

Q ss_pred             CCccHHHHHHHHHhcCCccccCcCC--CCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCC
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEKG--AGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIP   85 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~~--g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~   85 (112)
                      ..+++++|++||++.|++|| +.|.  ..+.++|+++.+....   .+             .++.+.|..||++|..+++
T Consensus       100 S~eq~~~GkqLF~~~Ca~CH-VgG~Tktnp~vgpdLt~LaaAt---pp-------------Rdn~e~Lv~wLkdP~sydg  162 (215)
T PRK13620        100 SLKQVAEGKQLFAYACGQCH-VGGITKTDPNVGLDPEALALAT---PP-------------RDSVESLVDYLHNPTTYDG  162 (215)
T ss_pred             CHHHHHHHHHHHHhhhhhcc-CCCCCCCCCCCCCCHHHHhccC---CC-------------CCCHHHHHHHHhCccccCC
Confidence            35688999999998999999 4431  1235677777442211   11             1378899999999999887


Q ss_pred             -------------CCCCCCCCCCCHHHHHHHHHHHHhccC
Q 033761           86 -------------GTKMVFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        86 -------------~~~m~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                                   +..||-...|||+|+.+|++|+.-..|
T Consensus       163 ~~siae~HPs~~s~d~mP~~r~LtdedL~aIa~~IL~qpk  202 (215)
T PRK13620        163 EREISELHPSTKSTDIFPKMRNLTEDDLVAISGHILLQPK  202 (215)
T ss_pred             cchhhhcCccccccccccccCCCCHHHHHHHHHHHhcccc
Confidence                         678886666899999999999975543


No 17 
>PRK13697 cytochrome c6; Provisional
Probab=99.56  E-value=1.4e-14  Score=88.66  Aligned_cols=82  Identities=21%  Similarity=0.325  Sum_probs=55.0

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCCCC
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTK   88 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~   88 (112)
                      .++...|+.+|..+|++||+.. .+....+|.+....               +... ..++.+.+...+.++.    ..|
T Consensus        25 a~~~~~G~~ly~~~C~~CHg~g-~~~~~~~p~l~~~~---------------~~~~-~~~~~~~l~~~i~~g~----~~M   83 (111)
T PRK13697         25 AADAANGEQVFSANCASCHAGG-KNLVNAGKTLKKAD---------------LEKY-GMYSLEAITAQVTNGK----NAM   83 (111)
T ss_pred             ccCHHHHHHHHHHHHHHhCCCC-CCCCCCCCCCCHHH---------------HHhc-CCCCHHHHHHHHHcCC----CCC
Confidence            4677899999998999999952 21122245444211               0111 1245678888888864    234


Q ss_pred             CCCCCCCCHHHHHHHHHHHHhcc
Q 033761           89 MVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        89 m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      ++|...+|++|+++|++||.++.
T Consensus        84 p~~~~~ls~~di~~l~~Yi~~~~  106 (111)
T PRK13697         84 PAFKDRLSPDQIEDVAAYVLEQA  106 (111)
T ss_pred             CCCcCCCCHHHHHHHHHHHHHHH
Confidence            46777899999999999999864


No 18 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=99.56  E-value=2.1e-14  Score=100.79  Aligned_cols=83  Identities=19%  Similarity=0.254  Sum_probs=59.4

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCC-CCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCCC
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQ-GPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGT   87 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~-gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~   87 (112)
                      +..+.+|+.||.++|++||+.++.|.... .|+|++.....         .         -+...+.+.++++..   +.
T Consensus       200 ~~~~~~G~~lf~~~Ca~CHG~~G~G~~~~gaP~L~~~~~~y---------~---------~~~~~i~~~i~~G~~---g~  258 (285)
T TIGR00782       200 EALAAKGQELFADNCTTCHGEDGKGLQELGAPNLTDDVWLY---------G---------GDLKTITTTITNGRG---GV  258 (285)
T ss_pred             hhHHHHHHHHHhccchhhCCCCCCCCCCCCCCCCCcchhhc---------C---------CCHHHHHHHHHhCCC---CC
Confidence            34568999999989999999988765443 48888642211         0         034566677776542   33


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHhccC
Q 033761           88 KMVFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        88 ~m~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                      |++|...||++||++|++||++|..
T Consensus       259 Mp~~~~~Ls~~ei~~La~Yv~sL~~  283 (285)
T TIGR00782       259 MPAWGPRLSEAQIKALAAYVHSLGG  283 (285)
T ss_pred             CCCccccCCHHHHHHHHHHHHHhcC
Confidence            3458788999999999999999863


No 19 
>PRK14487 cbb3-type cytochrome c oxidase subunit II; Provisional
Probab=99.55  E-value=1.2e-14  Score=96.96  Aligned_cols=83  Identities=19%  Similarity=0.359  Sum_probs=62.9

Q ss_pred             CccHHHHHHHHHh-cCCcccc--CcCC-------C-----------------CCCCCCCcccccCCccccCCCCCCchhh
Q 033761            9 PGNAKAGEKIFKT-KCAQCHT--VEKG-------A-----------------GHKQGPNLNGLFGRQSGTTPGYSYSAAN   61 (112)
Q Consensus         9 ~~~~~~G~~lf~~-~C~~CH~--~~~~-------g-----------------~~~~gP~l~~~~~~~~~~~~~~~~~~~~   61 (112)
                      ++.+.+|+.+|.+ .|..||+  +++-       |                 ....||+|+.+                 
T Consensus        48 t~lel~Gr~iyi~eGC~~CHsQ~VR~~~~e~~r~G~~S~a~e~~yd~P~lwGs~RtGPDLt~v-----------------  110 (217)
T PRK14487         48 TALELAGRDIYIREGCYNCHSQMIRPFRAETERYGHYSLAGESVYDHPFLWGSKRTGPDLARV-----------------  110 (217)
T ss_pred             CHHHHHHHHHHHhcChhhccCccccCCchhhhhcCcccccchhhcccccccCCCCCCcchhhh-----------------
Confidence            4566799999975 5999998  4431       1                 12344555544                 


Q ss_pred             hcccccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHH--HHHHHHHhcc
Q 033761           62 KNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRA--DLIAYLKQST  111 (112)
Q Consensus        62 ~~~~~~~~~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~--~l~ayl~~l~  111 (112)
                         |.+.+.+|+..||.+|+...|++.||-+..|++++++  +|++||++|.
T Consensus       111 ---G~R~s~~w~~~hl~nP~~v~PgS~MPay~~L~~~~ld~~~~~~~l~~l~  159 (217)
T PRK14487        111 ---GGRYSDEWHRNHLINPRSVVPESNMPAYPWLAENDLDGTDTAEKMTALR  159 (217)
T ss_pred             ---hccCCHHHHHHHHhCcccCCCCCCCCCCcccccccCCHHHHHHHHHHhh
Confidence               4444789999999999999999999866677788877  9999999885


No 20 
>COG2863 Cytochrome c553 [Energy production and conversion]
Probab=99.55  E-value=4.6e-15  Score=91.18  Aligned_cols=80  Identities=28%  Similarity=0.373  Sum_probs=62.7

Q ss_pred             CCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCC-CCCC
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKK-YIPG   86 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~-~~~~   86 (112)
                      ...+++.|+.+|.+.|++||+.++.+.....|+|.++                        +.++|...|++-+. ..++
T Consensus        20 a~~~a~~G~~~~~~~Ca~CHG~~g~~~~~~~P~Lagq------------------------~~~yl~~~L~a~k~g~r~~   75 (121)
T COG2863          20 AAADAALGKALAAQSCAACHGADGNSPAPGYPKLAGQ------------------------SEAYLEKQLKAYKDGKRPG   75 (121)
T ss_pred             hhhhHHHHHHhhcchhhhccCCCCCCccCCCCCcCCC------------------------CHHHHHHHHHHHHcCCCCc
Confidence            6788999999998889999999987755566777765                        57788888865332 2334


Q ss_pred             CCC-CCCCCCCHHHHHHHHHHHHhcc
Q 033761           87 TKM-VFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        87 ~~m-~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      ..| .....|||+||.+|.+|+.+++
T Consensus        76 ~vM~~~a~~LsD~Di~~lAa~~a~~~  101 (121)
T COG2863          76 PVMNAIASGLSDEDIADLAAYYAAQK  101 (121)
T ss_pred             chHHHHHHhCCHHHHHHHHHHHHhCC
Confidence            466 5667799999999999999876


No 21 
>TIGR03874 4cys_cytochr c-type cytochrome, methanol metabolism-related. This family represents a c-type cytochrome related to (but excluding) cytochrome c-555 of Methylococcus capsulatus. Members contain four invariant Cys residues, including two from a heme-binding motif shared with c-555, and two others.
Probab=99.55  E-value=1.9e-14  Score=91.13  Aligned_cols=79  Identities=18%  Similarity=0.297  Sum_probs=58.4

Q ss_pred             cHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCC---CC
Q 033761           11 NAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIP---GT   87 (112)
Q Consensus        11 ~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~---~~   87 (112)
                      ..-.|++||..+|++||+.++.|.. ..|+|.+....                    .+..+|.+.|.++.....   ..
T Consensus        32 ~~~~G~~lY~~~CAaCHG~dG~G~~-~~P~Lans~v~--------------------~s~~nli~vIl~G~~~~~~~~~~   90 (143)
T TIGR03874        32 FTYSGYRRYHSECHVCHGPDGMGST-YAPALKDSVKR--------------------MSYGDFLGVVANGRQNVSAAQNN   90 (143)
T ss_pred             ccccHHHHHHHHHHHhCCCCCCCCC-CCCCCCCcccc--------------------CCHHHHHHHHHhCCCCCCCCCCC
Confidence            3457999999999999999987743 57888632111                    157788899988764322   23


Q ss_pred             CC-CCCCCCCHH-HHHHHHHHHHhc
Q 033761           88 KM-VFPGLKKPQ-DRADLIAYLKQS  110 (112)
Q Consensus        88 ~m-~~~~~ls~~-e~~~l~ayl~~l  110 (112)
                      .| +|...|+++ ||.+|+.||+.-
T Consensus        91 ~MPaF~~~LsD~~eIa~L~~YLR~~  115 (143)
T TIGR03874        91 VMPAFGDNPNVMCYLDDLYVYLRAR  115 (143)
T ss_pred             CCCCccccCCcHHHHHHHHHHHHhc
Confidence            46 588889886 999999999864


No 22 
>PRK13619 psbV cytochrome c-550; Provisional
Probab=99.49  E-value=6.2e-14  Score=89.25  Aligned_cols=89  Identities=21%  Similarity=0.297  Sum_probs=62.0

Q ss_pred             CCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCC--
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIP--   85 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~--   85 (112)
                      .++++.+|++||+.+|+.||..   |...++|++.--........|.-            -+.+.|..|+++|..++.  
T Consensus        47 s~~d~~~GkklF~~~Ca~CH~g---G~nk~~Pnl~L~~~~L~~atP~R------------dnV~aLVdymk~PtsyDG~~  111 (160)
T PRK13619         47 TSKQITNGQRLFVQECTQCHLQ---GKTKTNNNVSLGLEDLAGAEPPR------------DNVLALVDYLKHPTSYDGED  111 (160)
T ss_pred             CHHHHHHHHHHHHHHHHHcccC---CCCCcCCCCCcCHHHHHhcCCCc------------ccHHHHHHHHhCCcccccch
Confidence            3568899999999999999985   55677887763222222222221            267899999999987731  


Q ss_pred             -----------CCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           86 -----------GTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        86 -----------~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                                 ...||-...|||+|+.+|++|+....
T Consensus       112 ~~a~~hpsi~~~di~P~mr~LtdedL~~iAg~IL~~p  148 (160)
T PRK13619        112 DYSELHPNVSRPDIFPELRNFTEDDLYDVAGYMLVAP  148 (160)
T ss_pred             hhhhhcccccccccccccCCCCHHHHHHHHHHHHhcc
Confidence                       12344334589999999999997544


No 23 
>TIGR00782 ccoP cytochrome c oxidase, cbb3-type, subunit III. This model describes a di-heme subunit of approximately 26 kDa of the cbb3 type copper and heme-containing cytochrome oxidase.
Probab=99.47  E-value=2.3e-13  Score=95.57  Aligned_cols=81  Identities=25%  Similarity=0.256  Sum_probs=56.8

Q ss_pred             HHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCC------C
Q 033761           12 AKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYI------P   85 (112)
Q Consensus        12 ~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~------~   85 (112)
                      ...|+.||..+|+.||+.++.|.. ..|+|++.....                  ..+.+.+...|+++....      .
T Consensus       107 ~~~G~~lf~~~Ca~CHG~~g~G~~-g~P~L~~~~~~~------------------g~~~~~i~~~i~~G~~~~~~~~~~~  167 (285)
T TIGR00782       107 RNAGAAIFRTWCAQCHGSGAGGAK-GFPNLLDNDWLW------------------GGTLEGIHTTIKHGIRDPDDGDTYV  167 (285)
T ss_pred             HHHHHHHHHHHhHHhCCCCCCCCC-CCCCCCCCcccc------------------CCCHHHHHHHHHhCccCcccCCcCC
Confidence            478999999999999999876532 247777432110                  014667778777665311      1


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           86 GTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        86 ~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      +.|++|...||++||++|++||+++.
T Consensus       168 ~~Mp~~~~~LsdeeI~aVaaYv~sl~  193 (285)
T TIGR00782       168 GEMPAFGPLLEEADIKDVASYVMSLS  193 (285)
T ss_pred             CCCCccccccChHHHHHHHHHHHHhc
Confidence            33446877899999999999999885


No 24 
>PRK14486 putative bifunctional cbb3-type cytochrome c oxidase subunit II/cytochrome c; Provisional
Probab=99.46  E-value=3.9e-13  Score=94.64  Aligned_cols=80  Identities=18%  Similarity=0.324  Sum_probs=54.5

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCCCC
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTK   88 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~   88 (112)
                      .++..+|+.+|..+|++||+.++.|.  .+|.+.......                   ...+.+.+.|.++...  ..|
T Consensus       212 ~~~~~~G~~ly~~~Ca~CHg~~g~G~--~gp~p~~~~~~~-------------------~~~~~~~~~I~~G~~~--~~M  268 (294)
T PRK14486        212 VAAIAKGKALYDANCAACHGDEAQGQ--EGVALNDIDDGD-------------------LPDAAYFGMIKGGSDA--KGM  268 (294)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCCCCC--CCCCccccccCC-------------------CcHHHHHHHHHcCCCc--CCC
Confidence            34578999999999999999887653  345444321100                   0234556667765532  133


Q ss_pred             CCCCCCCCHHHHHHHHHHHHhcc
Q 033761           89 MVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        89 m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      ++|...||++|+++|++||++++
T Consensus       269 P~f~~~Lsdeei~~LaaYV~sl~  291 (294)
T PRK14486        269 PGFGGDLSDDDIWAIVAYIRSQK  291 (294)
T ss_pred             CcccccCCHHHHHHHHHHHHhcc
Confidence            45777799999999999999986


No 25 
>PRK13622 psbV cytochrome c-550; Provisional
Probab=99.36  E-value=3.5e-12  Score=83.37  Aligned_cols=91  Identities=21%  Similarity=0.313  Sum_probs=55.5

Q ss_pred             CCCCccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCC
Q 033761            6 EAPPGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIP   85 (112)
Q Consensus         6 a~~~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~   85 (112)
                      ....++..+|+++|..+|++||+. |  .+...|...-......+..++            .-+.+.|..++++|..+..
T Consensus        56 ~~s~~~~~~G~~lF~~~Ca~CH~~-G--~ni~~P~~tLk~~aL~~a~p~------------rdnv~AIv~yLk~p~tYdg  120 (180)
T PRK13622         56 TFTEAQLAKGKKLFNRACAQCHVG-G--QTYPNPDVSLKLSDLEGATPP------------RDNVLAIVDYIKNPVTYDG  120 (180)
T ss_pred             cCCHHHHHHHHHHHHhhhHHhccC-C--CCCcCCCcccCHHHHcCCCCC------------cccHHHHHHHHhcccccCC
Confidence            344567789999999899999964 2  233344333211111111111            0156788889988886541


Q ss_pred             ---------C----CCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           86 ---------G----TKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        86 ---------~----~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                               +    ..||-...|||+|+++|++||....
T Consensus       121 ~~~~~e~~p~~~~~~~~p~~~~LsdeEI~~VA~yIl~qa  159 (180)
T PRK13622        121 VESLLEYHPNTQLLSEYPRLRNLTDEDLKLIAGYILVQA  159 (180)
T ss_pred             ccchhhccccchhccccccccCCCHHHHHHHHHHHHhCc
Confidence                     1    1133234689999999999998654


No 26 
>COG3258 Cytochrome c [Energy production and conversion]
Probab=99.35  E-value=3.4e-12  Score=87.17  Aligned_cols=84  Identities=24%  Similarity=0.369  Sum_probs=55.7

Q ss_pred             CCCccHHHHHHHHHhcCCccccCcCCCCCC--------CCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHh
Q 033761            7 APPGNAKAGEKIFKTKCAQCHTVEKGAGHK--------QGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLL   78 (112)
Q Consensus         7 ~~~~~~~~G~~lf~~~C~~CH~~~~~g~~~--------~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~   78 (112)
                      .-.++..+|++||.++|+.||+.+|+|...        ..|.|.+.        ++|+.      .+...-...+.+||.
T Consensus       157 ~~aadp~rG~kly~eqCa~CHg~~G~G~k~~~~~~~~y~fPpLwG~--------dSfn~------GagMari~t~A~Fi~  222 (293)
T COG3258         157 LKAADPVRGKKLYAEQCAACHGADGQGLKNDDEQGAGYLFPPLWGP--------DSFND------GAGMARINTLARFIK  222 (293)
T ss_pred             ccCCCchhHHHHHHHHHHHhcCCCCCccccCcCCCcceecCcccCC--------cccCC------ccchhhHHHHHHHHH
Confidence            346799999999999999999998876432        23444432        12211      111122357778887


Q ss_pred             CCCCCCCCCCCC--CCC---CCCHHHHHHHHHHHHhccC
Q 033761           79 NPKKYIPGTKMV--FPG---LKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        79 ~~~~~~~~~~m~--~~~---~ls~~e~~~l~ayl~~l~~  112 (112)
                      .        -||  +..   +|||+|.+||++|+.++++
T Consensus       223 ~--------nMP~g~~~~~P~Lsd~dA~DiAay~~~~pR  253 (293)
T COG3258         223 A--------NMPYGFSGTNPILSDQDAWDIAAYVNSQPR  253 (293)
T ss_pred             h--------cCCCCcCccCCccChHHHHHHHHHHcCCCC
Confidence            5        244  323   4899999999999988653


No 27 
>TIGR00781 ccoO cytochrome c oxidase, cbb3-type, subunit II. This model describes the monoheme subunit of the cbb3-type cytochrome oxidase, found in a subset of Proteobacterial species. Species having this protein also have CcoN (subunit I, containing copper and two heme groups), CcoP (subunit III, containing two hemes), and CcoQ (essential for incorporation of the prosthetic groups).
Probab=99.29  E-value=8.8e-12  Score=83.91  Aligned_cols=82  Identities=18%  Similarity=0.291  Sum_probs=55.3

Q ss_pred             CccHHHHHHHHHh-cCCcccc--CcCC------------------------CCCCCCCCcccccCCccccCCCCCCchhh
Q 033761            9 PGNAKAGEKIFKT-KCAQCHT--VEKG------------------------AGHKQGPNLNGLFGRQSGTTPGYSYSAAN   61 (112)
Q Consensus         9 ~~~~~~G~~lf~~-~C~~CH~--~~~~------------------------g~~~~gP~l~~~~~~~~~~~~~~~~~~~~   61 (112)
                      ++.+.+|+.+|.+ .|..||+  +++.                        |....||+|+.++                
T Consensus        47 t~lel~Gr~iyi~eGC~~CHsQ~VR~~~~e~~ryG~~S~a~e~~yd~p~lwGs~RtGPDLt~vG----------------  110 (232)
T TIGR00781        47 TPLELAGRDIYIREGCYHCHSQMIRPFRAEVERYGHYSLAGESMYDHPFQWGSKRTGPDLARVG----------------  110 (232)
T ss_pred             CHHHHHHHHHHHhcChhhcccccccCcchhhhhcCcccccchhhcccccccCCCCcCcCccccc----------------
Confidence            4566799999965 5999998  4431                        1123455555444                


Q ss_pred             hcccccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHH--HHHHHHHhc
Q 033761           62 KNMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRA--DLIAYLKQS  110 (112)
Q Consensus        62 ~~~~~~~~~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~--~l~ayl~~l  110 (112)
                          .+++.+|+..+|.+|+...|++.||-+..|++++++  ++.+.++++
T Consensus       111 ----~R~s~~wh~~hl~nPr~v~PgSiMP~y~~L~~~~ld~~~~~~~~~~~  157 (232)
T TIGR00781       111 ----GRYSDEWHVKHLFDPRSVVPESIMPAYKHLATKKVDVDTAYAEAKTQ  157 (232)
T ss_pred             ----ccCCHHHHHHHHhCccccCCCCCCCCCcccccccCCHHHHHHHHHHH
Confidence                444788999999999999999999755445444333  555555554


No 28 
>COG2010 CccA Cytochrome c, mono- and diheme variants [Energy production and conversion]
Probab=99.29  E-value=3.8e-12  Score=81.20  Aligned_cols=21  Identities=33%  Similarity=0.650  Sum_probs=19.0

Q ss_pred             ccHHHHHHHHHhcCCccccCc
Q 033761           10 GNAKAGEKIFKTKCAQCHTVE   30 (112)
Q Consensus        10 ~~~~~G~~lf~~~C~~CH~~~   30 (112)
                      .....|+++|..+|+.||+++
T Consensus        49 ~~~~~G~~~f~~~C~~CHg~~   69 (150)
T COG2010          49 AARGAGLALFLGNCAACHGPN   69 (150)
T ss_pred             HHHHHHHHHhcccchhccCCC
Confidence            467899999999999999987


No 29 
>PRK14486 putative bifunctional cbb3-type cytochrome c oxidase subunit II/cytochrome c; Provisional
Probab=99.28  E-value=1e-11  Score=87.50  Aligned_cols=102  Identities=14%  Similarity=0.257  Sum_probs=60.2

Q ss_pred             CccHHHHHHHHHh-cCCccccCc--CCCC--CCCC-CCccc--ccCCccccCCCCCCchhhhcccccccHHHHHHHHhCC
Q 033761            9 PGNAKAGEKIFKT-KCAQCHTVE--KGAG--HKQG-PNLNG--LFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNP   80 (112)
Q Consensus         9 ~~~~~~G~~lf~~-~C~~CH~~~--~~g~--~~~g-P~l~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~   80 (112)
                      ++.+.+|+.||.+ .|..||+..  ....  ..-| ++..+  +..++ .....-...++|...|.+++.+|+..+|.+|
T Consensus        48 ~~~~~~G~~~y~~~gC~~CH~q~vr~~~~~~~~~g~~s~~~~~~~~~p-~~~g~~r~GPDL~~vG~r~~~~w~~~~l~~P  126 (294)
T PRK14486         48 TPLELAGRDVYQREGCVNCHTQTVRPLKSEVVRYGQYSKAGEFAYDHP-FLWGSKRTGPDLARIGGKYPDAWHYAHFEDP  126 (294)
T ss_pred             CHHHHHHHHHHHHcCchhhcCccccCCcccccccCCCCcchhhhcccc-ccccCCCCCCchhhhcccCCHHHHHHHHhCc
Confidence            4567899999987 599999942  1100  0000 11110  00000 0001112234555556666899999999999


Q ss_pred             CCCCCCCCCC-CC----CCC----------------CH---------HHHHHHHHHHHhcc
Q 033761           81 KKYIPGTKMV-FP----GLK----------------KP---------QDRADLIAYLKQST  111 (112)
Q Consensus        81 ~~~~~~~~m~-~~----~~l----------------s~---------~e~~~l~ayl~~l~  111 (112)
                      +...|+..|| |.    ..+                ++         .|+++|++||.+|.
T Consensus       127 ~~~~p~s~MP~~~~l~~~~~~~~~~~~~~~~~~~py~~~~~~~~~~~~e~~AlvAYl~~L~  187 (294)
T PRK14486        127 QAVVPRSNMPAYAFLKGKPLDAALTQRKMRALGFPYTDADLAALAGKTEMDAMVAYMQSLG  187 (294)
T ss_pred             ccCCCCCCCCCCHHHhhccCcHHHHHHhhhhcCCCCCHHHHHHhcccHHHHHHHHHHHHhc
Confidence            9999998886 22    111                12         36789999999885


No 30 
>PF14495 Cytochrom_C550:  Cytochrome c-550 domain; PDB: 3ARC_V 1IZL 3A0H_V 3A0B_v 1E29_A 1F1C_B 1S5L_V 4FBY_i 3PRR_V 3PRQ_V ....
Probab=99.25  E-value=3.8e-12  Score=78.72  Aligned_cols=87  Identities=28%  Similarity=0.444  Sum_probs=51.8

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCCC-
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGT-   87 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~-   87 (112)
                      ..++.+|++||...|+.||.   +|.....|+..--.....+..|.-            -|.+.|..|+++|..++.-. 
T Consensus        22 ~~q~~~GkrLF~~~C~~CH~---GG~TktNpnV~L~le~L~~AtPpR------------DNi~~LVdYmk~PtsYDG~~~   86 (135)
T PF14495_consen   22 PEQLKRGKRLFNASCAQCHV---GGITKTNPNVSLSLEDLAGATPPR------------DNIEALVDYMKNPTSYDGEES   86 (135)
T ss_dssp             HHHHHHHHHHHHHHTHHHHG---GGCBTTSTTSBSSHHHHHTSSS--------------SSHHHHHHHHHS-B-TTSSSB
T ss_pred             HHHHHHHHHHHHHHHHhhcc---CCcccCCCCCCcCHHHHccCCCCc------------ccHHHHHHHhhCCCCcCCchh
Confidence            45789999999999999996   222333454432111122222221            27889999999998776321 


Q ss_pred             -------C-----CCCCCCCCHHHHHHHHHHHHhc
Q 033761           88 -------K-----MVFPGLKKPQDRADLIAYLKQS  110 (112)
Q Consensus        88 -------~-----m~~~~~ls~~e~~~l~ayl~~l  110 (112)
                             +     .|-..-|+++|+.+|++||...
T Consensus        87 i~e~hp~~~s~di~p~mr~ltdddL~~iAg~IL~~  121 (135)
T PF14495_consen   87 ISELHPSIKSADIFPKMRNLTDDDLYAIAGYILRQ  121 (135)
T ss_dssp             GTTTS-STTCTTTSGGGTS--HHHHHHHHHHHHHH
T ss_pred             HHHhCcCcccchhhHhhcCCCHHHHHHHHHHHHhc
Confidence                   1     1111237999999999999643


No 31 
>COG4654 Cytochrome c551/c552 [Energy production and conversion]
Probab=99.00  E-value=6.3e-10  Score=65.92  Aligned_cols=83  Identities=19%  Similarity=0.297  Sum_probs=55.6

Q ss_pred             CccHHHHHHHHHhc-CCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCC-
Q 033761            9 PGNAKAGEKIFKTK-CAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPG-   86 (112)
Q Consensus         9 ~~~~~~G~~lf~~~-C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~-   86 (112)
                      .+++++|+.||.++ |.+||.++-   ..+||++..+..++.+..+               ....|...++.+.....+ 
T Consensus        20 a~~a~~~~aif~qkgC~~CHq~~v---ktVGPS~kdIAakYag~~~---------------~~~kl~q~i~~g~~g~wg~   81 (110)
T COG4654          20 AADAEDGKAIFSQKGCVACHQPDV---KTVGPSYKDIAAKYAGKAG---------------ALAKLAQGIKPGGVGVWGP   81 (110)
T ss_pred             ccchhhhHHHHHhccchhhccccc---cccCccHHHHHHHHccchh---------------HHHHHHHhccccCcCcccc
Confidence            47889999999986 999999864   5789999988776654322               234555555544332222 


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHh
Q 033761           87 TKMVFPGLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        87 ~~m~~~~~ls~~e~~~l~ayl~~  109 (112)
                      ..||-...+|+.+...++.||..
T Consensus        82 ipMppqp~~sd~~a~~~~kwvl~  104 (110)
T COG4654          82 IPMPPQPAISDADAKTLAKWVLA  104 (110)
T ss_pred             CCCCCcccccchHHHHHHHHHHh
Confidence            35654444578888888877764


No 32 
>TIGR03791 TTQ_mauG tryptophan tryptophylquinone biosynthesis enzyme MauG. Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Probab=98.92  E-value=7.9e-09  Score=72.90  Aligned_cols=105  Identities=22%  Similarity=0.264  Sum_probs=51.3

Q ss_pred             CCCccHHHHHHHHH--hcCCccccCcCCC---CCCCC-CC-cc-cccCCc--cccCCCCCC-chhhhcc---------cc
Q 033761            7 APPGNAKAGEKIFK--TKCAQCHTVEKGA---GHKQG-PN-LN-GLFGRQ--SGTTPGYSY-SAANKNM---------AV   66 (112)
Q Consensus         7 ~~~~~~~~G~~lf~--~~C~~CH~~~~~g---~~~~g-P~-l~-~~~~~~--~~~~~~~~~-~~~~~~~---------~~   66 (112)
                      ..++++.+|..||.  .+|+.||...--+   ....| |. +. +.....  ....+.+.+ .+.|++.         |.
T Consensus       154 als~~e~~G~~LF~~k~~C~~CH~g~~ftd~~f~~iG~~~~~d~G~~~~~~~~~~~~~~~FrtPsLRnV~~taPY~HdG~  233 (291)
T TIGR03791       154 AIGADAKRGFALFKGKAGCAACHSSWRFTDDSFHDIGLKAGLDLGRGAFAPPQVTAMQHAFKTPSLRDLPMEGPFMHDGQ  233 (291)
T ss_pred             cCCHHHHHHHHHhcCCCCCCCCCCCCCcCCchHHhcCCCCccCCCcccccccccccccCcccCccccccccCCCCCCCCC
Confidence            44678899999997  3699999722110   01111 11 00 000000  000011112 3334332         23


Q ss_pred             cccHHHHHHHHhCCCCCCCCCCCCC-CCCCCHHHHHHHHHHHHhcc
Q 033761           67 NWEEKTLYDYLLNPKKYIPGTKMVF-PGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        67 ~~~~~~l~~~l~~~~~~~~~~~m~~-~~~ls~~e~~~l~ayl~~l~  111 (112)
                      ..+.+.+..+...+....++.-... .-.||++|+++||+||++|+
T Consensus       234 ~~tL~evv~~y~~~g~~~~~~~~~~~~~~Lt~~E~~dLvaFL~tLt  279 (291)
T TIGR03791       234 LGSLDAVIDHYEKGGEKRPSISAEMKPFELSEREREDLIAFIETLD  279 (291)
T ss_pred             cCCHHHHHHHHHccCccccccccccccCCCCHHHHHHHHHHHHhcC
Confidence            3456666666544332222111001 11489999999999999997


No 33 
>PF02433 FixO:  Cytochrome C oxidase, mono-heme subunit/FixO;  InterPro: IPR003468 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO) []. Cytochrome cbb3 oxidases are required both to support symbiotic nitrogen fixation, whilst ensuring that the oxygen-labile nitrogenase is not compromised. Cytochrome cbb3 oxidases consist of four subunits: FixN (or CcoN), FixO (or CcoO), FixP (or CcoP) and FixQ (or CcoQ). The catalytic core is comprised of subunits FixN, FixO and FixP, where FixN acts as the catalytic subunit, and Fix O and FixP are membrane-bound mono- and di-haem cytochromes c, respectively. The FixQ subunit protects the core complex in the presence of oxygen from proteolytic degradation []. This entry represents the mono-haem FixO subunit.
Probab=98.76  E-value=1.6e-08  Score=68.27  Aligned_cols=102  Identities=18%  Similarity=0.200  Sum_probs=58.3

Q ss_pred             CccHHHHHHHHHhc-CCccccCcCCC--C--CCCC-CCccccc-CCccccCCCCCCchhhhcccccccHHHHHHHHhCCC
Q 033761            9 PGNAKAGEKIFKTK-CAQCHTVEKGA--G--HKQG-PNLNGLF-GRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPK   81 (112)
Q Consensus         9 ~~~~~~G~~lf~~~-C~~CH~~~~~g--~--~~~g-P~l~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~   81 (112)
                      ++.+.+|+.+|.++ |..||+..-.-  .  ..-| +++.+-. ......-.+-...++|...|.+.+.+|-...+.+|+
T Consensus        47 t~lel~GR~iYi~eGC~~CHSQ~VRp~~~e~~RyG~yS~a~e~~yd~P~lwGSkRtGPDLarvG~r~s~~Wh~~Hl~~Pr  126 (226)
T PF02433_consen   47 TPLELAGRDIYIREGCYYCHSQMVRPFRAEVERYGRYSVAGEYVYDHPFLWGSKRTGPDLARVGGRYSDDWHLAHLYNPR  126 (226)
T ss_pred             cHHHHhHHHHHHHcCchhcccccCCCchhhhhhcCCCCchhhhhccCccccCCCCcCccHHHHhccCChHHHHHHhhChH
Confidence            45678999999864 99999843110  0  0001 1221100 000011112223455666666678899999999999


Q ss_pred             CCCCCCCCCCCCCCCH--HHHHHHHHHHHhc
Q 033761           82 KYIPGTKMVFPGLKKP--QDRADLIAYLKQS  110 (112)
Q Consensus        82 ~~~~~~~m~~~~~ls~--~e~~~l~ayl~~l  110 (112)
                      ...|+..||-+..|-+  .+...+.+.++.|
T Consensus       127 ~v~p~SiMP~Y~~L~~~~~d~~~~~~~~~~l  157 (226)
T PF02433_consen  127 SVVPGSIMPSYPWLFENKLDGEDIQAKMKAL  157 (226)
T ss_pred             hhCCCCCCCCChhHhhccCcHHHHHHHHHHH
Confidence            9999999974444422  2444566655544


No 34 
>PRK14485 putative bifunctional cbb3-type cytochrome c oxidase subunit I/II; Provisional
Probab=98.47  E-value=6.2e-07  Score=69.83  Aligned_cols=102  Identities=14%  Similarity=0.175  Sum_probs=58.5

Q ss_pred             CccHHHHHHHHHhc-CCccccCcCC--CC--CCCC-CCccccc-CCccccCCCCCCchhhhcccccccHHHHHHHHhCCC
Q 033761            9 PGNAKAGEKIFKTK-CAQCHTVEKG--AG--HKQG-PNLNGLF-GRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPK   81 (112)
Q Consensus         9 ~~~~~~G~~lf~~~-C~~CH~~~~~--g~--~~~g-P~l~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~   81 (112)
                      ++.+.+|+.+|.++ |..||+..-.  ..  ..-| +++.+-. ....-.-.+-+..|++.+.|.+.++++-...+.||+
T Consensus       534 t~~~~~Gr~iyi~egC~~CHsq~vr~~~~e~~r~G~~s~~~e~~~d~p~~~Gs~rtgpdl~~~g~~~~~~wh~~hl~~p~  613 (712)
T PRK14485        534 TPLELEGRDLYIREGCYNCHSQMIRPFRSEVERYGEYSKAGEFVYDHPFLWGSKRTGPDLAREGGKYPDSWHYNHMEDPQ  613 (712)
T ss_pred             ChHHHhhHHHHHHcCccccccccCCCCchhHHhcCCCCchhhhhccCCcccCCCCcCcchhhhcCCCChHHHHHHhcCch
Confidence            45678999999865 9999984311  00  0001 1111100 000001111223455656666667889999999999


Q ss_pred             CCCCCCCCC-----CCCCCCHHHHHHHHHHHHhc
Q 033761           82 KYIPGTKMV-----FPGLKKPQDRADLIAYLKQS  110 (112)
Q Consensus        82 ~~~~~~~m~-----~~~~ls~~e~~~l~ayl~~l  110 (112)
                      ...|++.||     +...++.+++.+-...++.+
T Consensus       614 ~~~p~s~mp~y~~l~~~~~~~~~~~~~~~~~~~~  647 (712)
T PRK14485        614 STSPGSIMPAYPWLLENELDISDTPAKIKAMQTL  647 (712)
T ss_pred             hcCCCCCCCCChhhhhCCCChHHHHHHHHHHHhc
Confidence            999999887     23445555666555555543


No 35 
>COG2857 CYT1 Cytochrome c1 [Energy production and conversion]
Probab=98.26  E-value=2.6e-06  Score=59.07  Aligned_cols=42  Identities=36%  Similarity=0.382  Sum_probs=34.9

Q ss_pred             HHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           70 EKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        70 ~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      ...+..||.+|....+++.|+-...++|++.++|++||..+.
T Consensus       172 ~~~~~~~i~~p~~~k~~~~m~~~~~~tdq~~~dlvaYL~~~~  213 (250)
T COG2857         172 EGELGIFIADPLKDKPGTYMPGNPALTDQEVKDLVAYLKWAA  213 (250)
T ss_pred             hhhHhhhccCccccCCcCCCCCChhhHHHHHHHHHHHHHHcc
Confidence            334889999999999888786455678999999999998864


No 36 
>PF09098 Dehyd-heme_bind:  Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding;  InterPro: IPR015182 Quinohemoprotein amine dehydrogenases (QHNDH) 1.4.99 from EC) are enzymes produced in the periplasmic space of certain Gram-negative bacteria, such as Paracoccus denitrificans and Pseudomonas putida, in response to primary amines, including n-butylamine and benzylamine. QHNDH catalyses the oxidative deamination of a wide range of aliphatic and aromatic amines through formation of a Schiff-base intermediate involving one of the quinone O atoms []. Catalysis requires the presence of a novel redox cofactor, cysteine tryptophylquinone (CTQ). CTQ is derived from the post-translational modification of specific residues, which involves the oxidation of the indole ring of a tryptophan residue to form tryptophylquinone, followed by covalent cross-linking with a cysteine residue []. There is one CTQ per subunit in QHNDH. In addition to CTQ, two haem c cofactors are present in QHNDH that mediate the transfer of the substrate-derived electrons from CTQ to an external electron acceptor, cytochrome c-550 [, ]. QHNDH is a heterotrimer of alpha, beta and gamma subunits. The alpha and beta subunits contain signal peptides necessary for the translocation of QHNDH to the periplasm. The alpha subunit is composed of four domains - domain 1 forming a dihaem cytochrome, and domains 2-4 forming antiparallel beta-barrel structures; the beta subunit is a 7-bladed beta-propeller that provides part of the active site; and the small, catalytic gamma subunit contains the novel cross-linked CTQ cofactor, in addition to additional thioester cross-links between Cys and Asp/Glu residues that encage CTQ. The gamma subunit assumes a globular secondary structure with two short alpha-helices having many turns and bends [].  This entry represents the dihaem cytochrome c domain of the QHNDH alpha subunit. The domain contain two cysteine residues that are involved in thioether linkages to haem []. ; PDB: 1PBY_A 1JJU_A 1JMZ_A 1JMX_A.
Probab=98.11  E-value=1.5e-06  Score=56.01  Aligned_cols=20  Identities=35%  Similarity=0.885  Sum_probs=15.0

Q ss_pred             HHHHHHHHhcCCccccCcCC
Q 033761           13 KAGEKIFKTKCAQCHTVEKG   32 (112)
Q Consensus        13 ~~G~~lf~~~C~~CH~~~~~   32 (112)
                      +.|+.|.+++|+.||+.+..
T Consensus         1 q~G~~Lv~~kC~~CHs~~~~   20 (167)
T PF09098_consen    1 QDGEQLVQEKCAGCHSADYD   20 (167)
T ss_dssp             --HHHHHHHCHCCTC-EECT
T ss_pred             CcHHHHHHHHHHHhcCcccc
Confidence            36999999999999997653


No 37 
>COG3245 CycB Cytochrome c5 [Energy production and conversion]
Probab=97.89  E-value=2.8e-05  Score=47.52  Aligned_cols=75  Identities=15%  Similarity=0.256  Sum_probs=40.6

Q ss_pred             HHHHHHHhcCCccccCcCCCCCCCCCCcccccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCCCCCCCCCCCCC-
Q 033761           14 AGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPKKYIPGTKMVFP-   92 (112)
Q Consensus        14 ~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~m~~~-   92 (112)
                      +|+.+|...|..||+..--|    .|...+-.        .|.-       .+.-..+.|...-.++-    |.|+|-. 
T Consensus        49 ~Gk~vy~~tC~~CHa~~~~G----APk~GdkA--------aW~P-------RiaqG~dtL~~hai~Gf----nAMPpkG~  105 (126)
T COG3245          49 EGKKVYGATCQACHAAGLPG----APKTGDKA--------AWAP-------RIAQGKDTLLDHAINGF----NAMPPKGG  105 (126)
T ss_pred             ccchhHhhhhhHhccCCCCC----CCCCCchh--------hhhh-------HHHhchHHHHHHHhccc----cCCCCCCC
Confidence            39999999999999843211    23222110        0000       00002445555444433    2233322 


Q ss_pred             -CCCCHHHHHHHHHHHHhcc
Q 033761           93 -GLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        93 -~~ls~~e~~~l~ayl~~l~  111 (112)
                       ...||+|+.+.|.|+...+
T Consensus       106 ca~cSdDe~kAaId~M~~~~  125 (126)
T COG3245         106 CADCSDDEVKAAIDFMAAAS  125 (126)
T ss_pred             cCCCCHHHHHHHHHHHHhcc
Confidence             2369999999999997654


No 38 
>COG2993 CcoO Cbb3-type cytochrome oxidase, cytochrome c subunit [Energy production and conversion]
Probab=97.83  E-value=6.6e-06  Score=54.56  Aligned_cols=100  Identities=18%  Similarity=0.190  Sum_probs=53.3

Q ss_pred             ccHHHHHHHHHh-cCCccccCcCCCC----CCCC-CCccc--ccCCccccCCCCCCchhhhcccccccHHHHHHHHhCCC
Q 033761           10 GNAKAGEKIFKT-KCAQCHTVEKGAG----HKQG-PNLNG--LFGRQSGTTPGYSYSAANKNMAVNWEEKTLYDYLLNPK   81 (112)
Q Consensus        10 ~~~~~G~~lf~~-~C~~CH~~~~~g~----~~~g-P~l~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~   81 (112)
                      +-...|+.+|-+ .|..||+.--.-.    ..-| -++++  .+..++ .-.+-...+++...|...+.+|=...|.+|+
T Consensus        50 ~LeLaGR~IYIreGCy~CHSQmiRpfr~E~eRYGhySvA~Es~yDhPf-lWGSKRTGPDLaRVG~ryS~dWH~~Hl~~PR  128 (227)
T COG2993          50 PLELAGRDIYIREGCYVCHSQMIRPFRAEVERYGHYSVAGESVYDHPF-LWGSKRTGPDLARVGGRYSDDWHRAHLLDPR  128 (227)
T ss_pred             HHHhccceeEeecccchhhhhccccchHHHHhhccceechhhhccCch-hhcCCccCcchhhhccccccHHHHHHccCch
Confidence            445689999976 5999998321100    0000 01110  000000 0001112334444455558889999999999


Q ss_pred             CCCCCCCCCCCCCC--CHHHHHHHHHHHHhc
Q 033761           82 KYIPGTKMVFPGLK--KPQDRADLIAYLKQS  110 (112)
Q Consensus        82 ~~~~~~~m~~~~~l--s~~e~~~l~ayl~~l  110 (112)
                      .+.|...||.+..|  ++-|++++.+=+.++
T Consensus       129 ~vVPeSiMPsY~~L~~~~ld~~d~~~~~~~~  159 (227)
T COG2993         129 SVVPESIMPSYPWLFDNKLDVDDIGAELKAL  159 (227)
T ss_pred             hcCccccCcccHHHhcCCCchHHHHHHHHhh
Confidence            99998888733332  233566666555544


No 39 
>PF06537 DUF1111:  Protein of unknown function (DUF1111);  InterPro: IPR010538 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=97.76  E-value=2e-05  Score=59.08  Aligned_cols=22  Identities=32%  Similarity=0.670  Sum_probs=18.7

Q ss_pred             CccHHHHHHHHHh-cCCccccCc
Q 033761            9 PGNAKAGEKIFKT-KCAQCHTVE   30 (112)
Q Consensus         9 ~~~~~~G~~lf~~-~C~~CH~~~   30 (112)
                      ..++.+|++||.+ .|++||.+.
T Consensus       360 ~~~v~~G~~lF~~~GCa~CH~p~  382 (499)
T PF06537_consen  360 DPQVLRGKQLFYQIGCASCHTPS  382 (499)
T ss_pred             cHHHHHHHHHHHhcCCcccCCCc
Confidence            4678899999987 599999865


No 40 
>PF09086 DUF1924:  Domain of unknown function (DUF1924);  InterPro: IPR015170 This entry is found in a set of bacterial proteins, including Cytochrome c-type protein. It is functionally uncharacterised. ; PDB: 1DW2_C 1DW1_A 1DW3_C 1DW0_A 1OAE_A 1GU2_B 1E8E_A.
Probab=97.76  E-value=2.2e-05  Score=46.44  Aligned_cols=27  Identities=33%  Similarity=0.600  Sum_probs=18.5

Q ss_pred             CCCCCccHHHHHHHHHh---------cCCccccCcC
Q 033761            5 DEAPPGNAKAGEKIFKT---------KCAQCHTVEK   31 (112)
Q Consensus         5 ~a~~~~~~~~G~~lf~~---------~C~~CH~~~~   31 (112)
                      ++....++++|+++|.+         .|++||+.+.
T Consensus         4 ~~~~~~sa~rG~~~f~~~~~~~g~~~sCasCH~~~p   39 (98)
T PF09086_consen    4 PAFAGFSAARGEAFFTSKHTGNGKEWSCASCHTADP   39 (98)
T ss_dssp             CCTSS--HHHHHHHHH--ECCTTCECSCHHHH-SST
T ss_pred             cccCCCCHHHHHHHHHccCCCCCCCCCcccccCCCc
Confidence            45667889999999963         2999999764


No 41 
>PF02167 Cytochrom_C1:  Cytochrome C1 family;  InterPro: IPR002326 Cytochrome bc1 complex (ubiquinol:ferricytochrome c oxidoreductase) is found in mitochondria, photosynthetic bacteria and other prokaryotes. It is minimally composed of three subunits: cytochrome b, carrying a low- and a high-potential haem group; cytochrome c1 (cyt c1); and a high-potential Rieske iron-sulphur protein. The general function of the complex is electron transfer between two mobile redox carriers, ubiquinol and cytochrome c; the electron transfer is coupled with proton translocation across the membrane, thus generating proton-motive force in the form of an electrochemical potential that can drive ATP synthesis. In its structure and functions, the cytochrome bc1 complex bears extensive analogy to the cytochrome b6f complex of chloroplasts and cyanobacteria; cyt c1 plays an analogous role to cytochrome f, in spite of their different structures [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0020037 heme binding; PDB: 1P84_D 2IBZ_D 1EZV_D 3CX5_O 3CXH_O 1KB9_D 1KYO_D 1ZRT_Q 2CA4_B 2C9X_B ....
Probab=97.70  E-value=1.5e-05  Score=54.19  Aligned_cols=25  Identities=20%  Similarity=0.626  Sum_probs=20.1

Q ss_pred             CCCCccHHHHHHHHHhcCCccccCc
Q 033761            6 EAPPGNAKAGEKIFKTKCAQCHTVE   30 (112)
Q Consensus         6 a~~~~~~~~G~~lf~~~C~~CH~~~   30 (112)
                      ....++++||.++|.+.|++||+..
T Consensus         9 ~~D~aslqRG~qvy~~~C~~CHsl~   33 (219)
T PF02167_consen    9 SFDKASLQRGAQVYMEVCASCHSLK   33 (219)
T ss_dssp             ---HHHHHHHHHHHHHTGGGTSBCT
T ss_pred             cccHHHHHHHHHHHHHHHhhccccc
Confidence            4456788999999999999999965


No 42 
>TIGR03806 chp_HNE_0200 conserved hypothetical protein, HNE_0200 family. The model TIGR03805 describes an uncharacterized protein family that contains repeats associated with the formation of a right-handed helical stack of parallel beta strands, homologous to those found in a number of carbohydrate-binding proteins and sugar hydrolases. This model describes another uncharacterized protein family, found in the same species as TIGR03805 member proteins, usually as the adjacent gene or in a fusion protein. An example is HNE_0200 from Hyphomonas neptunium ATCC 15444. Sometimes two members of this family are with a single member of TIGR03805. The function is unknown.
Probab=97.31  E-value=0.00082  Score=48.22  Aligned_cols=21  Identities=24%  Similarity=0.499  Sum_probs=17.4

Q ss_pred             HHHHHHHHHhcCCccccCcCC
Q 033761           12 AKAGEKIFKTKCAQCHTVEKG   32 (112)
Q Consensus        12 ~~~G~~lf~~~C~~CH~~~~~   32 (112)
                      ..+-+.++..+|+.||+.++.
T Consensus       213 e~rarpyL~~NC~~CH~p~g~  233 (317)
T TIGR03806       213 AQRARAYLDVNCAHCHNPGGL  233 (317)
T ss_pred             HHHHHHHHHhHHHhcCCCCcC
Confidence            467888999999999997643


No 43 
>COG3748 Predicted membrane protein [Function unknown]
Probab=97.20  E-value=0.0015  Score=46.77  Aligned_cols=24  Identities=21%  Similarity=0.199  Sum_probs=17.7

Q ss_pred             CCCCCCC--CCCHHHHHHHHHHHHhc
Q 033761           87 TKMVFPG--LKKPQDRADLIAYLKQS  110 (112)
Q Consensus        87 ~~m~~~~--~ls~~e~~~l~ayl~~l  110 (112)
                      ..||..+  .+||||+..|.+|+.+-
T Consensus       378 ~~MP~gNvt~mT~eER~ll~aW~e~~  403 (407)
T COG3748         378 HAMPPGNVTQMTDEERALLAAWFESG  403 (407)
T ss_pred             ccCCCcccccCCHHHHHHHHHHHHhc
Confidence            3565433  46999999999999763


No 44 
>PF14376 Haem_bd:  Haem-binding domain
Probab=97.14  E-value=0.0024  Score=40.47  Aligned_cols=97  Identities=11%  Similarity=0.189  Sum_probs=46.3

Q ss_pred             CccHHHHHHHHHhcCCccccCcCCCCCCCCCCcccccCCc-------cccCCCCCCchhhh--cccccccHHHHHHHHhC
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVEKGAGHKQGPNLNGLFGRQ-------SGTTPGYSYSAANK--NMAVNWEEKTLYDYLLN   79 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~~~g~~~~gP~l~~~~~~~-------~~~~~~~~~~~~~~--~~~~~~~~~~l~~~l~~   79 (112)
                      ....+.-+.+++..|-.||+.+-     .-|=.+.+....       ......++++.-..  ...-....+.+...|.+
T Consensus        30 ~~~p~~v~~il~~~CydCHSn~T-----~~PwYa~i~p~s~l~~~dI~~Gr~~lNfs~~~~~~~~~~~~~l~~i~~~I~~  104 (137)
T PF14376_consen   30 IKAPEEVKIILKNSCYDCHSNNT-----RYPWYANIAPASWLMEKDIKEGRRHLNFSEWGSYSKRKQEAKLAKIEEVIED  104 (137)
T ss_pred             ccchHHHHHHHHccccccCCCCC-----CCccceecCchHHHHHHHHHHHHHHhCcchhhhcCcccCHHHHHHHHHHHHc
Confidence            34556778899889999999542     234333221100       00000111111000  00001133455555665


Q ss_pred             CCCCCCC-CCCCCCCCCCHHHHHHHHHHHHhc
Q 033761           80 PKKYIPG-TKMVFPGLKKPQDRADLIAYLKQS  110 (112)
Q Consensus        80 ~~~~~~~-~~m~~~~~ls~~e~~~l~ayl~~l  110 (112)
                      +..-.+. .+|-....||++|+..|++|++..
T Consensus       105 g~MP~~~Y~~~H~~a~Ls~~ek~~Ll~Wi~~~  136 (137)
T PF14376_consen  105 GEMPPPSYTLLHWEAKLSEEEKQALLNWIKEQ  136 (137)
T ss_pred             CCCChHHHhhhCCCCCCCHHHHHHHHHHHHHc
Confidence            2211110 111234568999999999999763


No 45 
>PF10643 Cytochrome-c551:  Photosystem P840 reaction-centre cytochrome c-551;  InterPro: IPR019604  A photosynthetic reaction-centre complex is found in certain green sulphur bacteria such as Chlorobium vibrioforme, which are anaerobic photo-auto-trophic organisms. The primary electron donor is P840, a probable B-Chl a dimer, and the primary electron acceptor is a B-Chl monomer. Also on the donor side c-type cytochromes are known to function as electron donors to photo-oxidised P840. This family is thus the secondary endogenous donor of the photosynthetic reaction-centre complex and is a membrane-bound cytochrome containing a single haem group. ; PDB: 3A9F_A.
Probab=97.06  E-value=0.00047  Score=46.25  Aligned_cols=22  Identities=32%  Similarity=0.688  Sum_probs=16.0

Q ss_pred             CccHHHHHHHHHhcCCccccCc
Q 033761            9 PGNAKAGEKIFKTKCAQCHTVE   30 (112)
Q Consensus         9 ~~~~~~G~~lf~~~C~~CH~~~   30 (112)
                      ..+...-+.+|+.+|..||+.+
T Consensus       166 gfdf~AAk~L~~~KCNkCHTl~  187 (233)
T PF10643_consen  166 GFDFAAAKALFDRKCNKCHTLK  187 (233)
T ss_dssp             T--HHHHHHHHHHHTTSSS-SH
T ss_pred             hhhHHHHHHHHHhhccccccHH
Confidence            3456678899999999999964


No 46 
>COG1858 MauG Cytochrome c peroxidase [Inorganic ion transport and metabolism]
Probab=96.95  E-value=0.0043  Score=45.22  Aligned_cols=26  Identities=38%  Similarity=0.646  Sum_probs=20.3

Q ss_pred             CCCCCccHHHHHHHHH-h-cCCccccCc
Q 033761            5 DEAPPGNAKAGEKIFK-T-KCAQCHTVE   30 (112)
Q Consensus         5 ~a~~~~~~~~G~~lf~-~-~C~~CH~~~   30 (112)
                      .+..+.+..+|.+||. . +|++||.-.
T Consensus       213 ~~aLT~~e~rGl~LF~~k~~C~aCH~g~  240 (364)
T COG1858         213 DAALTEQEKRGLALFKGKANCAACHNGI  240 (364)
T ss_pred             hhhcCHHHHHHHHHHccCCCchhhccCc
Confidence            3455678899999998 4 599999743


No 47 
>KOG3052 consensus Cytochrome c1 [Energy production and conversion]
Probab=96.74  E-value=0.00037  Score=48.16  Aligned_cols=25  Identities=24%  Similarity=0.679  Sum_probs=20.8

Q ss_pred             CCCCccHHHHHHHHHhcCCccccCc
Q 033761            6 EAPPGNAKAGEKIFKTKCAQCHTVE   30 (112)
Q Consensus         6 a~~~~~~~~G~~lf~~~C~~CH~~~   30 (112)
                      +.+-+.+.+|.++|++.|++||+.+
T Consensus        89 s~DhaSiRRGyqVYkqVCaaCHSm~  113 (311)
T KOG3052|consen   89 SFDHASIRRGYQVYKQVCAACHSMD  113 (311)
T ss_pred             cccHHHHhhhHHHHHHHHHHhhhhH
Confidence            4445678999999999999999944


No 48 
>TIGR02162 torC trimethylamine-N-oxide reductase c-type cytochrome TorC. This family includes consists of TorC, a pentahemic c-type cytochrome subunit of periplasmic reductases for trimethylamine-N-oxide (TMAO). The N-terminal half is closely related to tetrahemic NapC (or NirT) subunits of periplasmic nitrate (or nitrite) reductases; some species have both TMAO and nitrate reductase complexes.
Probab=96.72  E-value=0.0024  Score=47.00  Aligned_cols=17  Identities=18%  Similarity=0.661  Sum_probs=15.3

Q ss_pred             HHHHHHHHhcCCccccC
Q 033761           13 KAGEKIFKTKCAQCHTV   29 (112)
Q Consensus        13 ~~G~~lf~~~C~~CH~~   29 (112)
                      ..|+.+|..+|+.||+.
T Consensus       322 ~~a~~ly~~~Cs~CH~~  338 (386)
T TIGR02162       322 AYAKSMYNGACSMCHVQ  338 (386)
T ss_pred             HHHHHHHhcchhhhcCC
Confidence            56999999999999985


No 49 
>COG3258 Cytochrome c [Energy production and conversion]
Probab=96.56  E-value=0.0071  Score=42.14  Aligned_cols=16  Identities=19%  Similarity=0.378  Sum_probs=13.7

Q ss_pred             CHHHHHHHHHHHHhcc
Q 033761           96 KPQDRADLIAYLKQST  111 (112)
Q Consensus        96 s~~e~~~l~ayl~~l~  111 (112)
                      +..|+.+|++|+.-|+
T Consensus       121 DspEmkAmlaY~kWL~  136 (293)
T COG3258         121 DSPEMKAMLAYMKWLK  136 (293)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            5689999999998775


No 50 
>PRK15032 trimethylamine N-oxide reductase cytochrome c-type subunit; Provisional
Probab=96.25  E-value=0.0063  Score=44.87  Aligned_cols=17  Identities=24%  Similarity=0.761  Sum_probs=15.1

Q ss_pred             HHHHHHHHhcCCccccC
Q 033761           13 KAGEKIFKTKCAQCHTV   29 (112)
Q Consensus        13 ~~G~~lf~~~C~~CH~~   29 (112)
                      ..|+.+|+.+|+.||+.
T Consensus       319 ~ya~~ly~~~Cs~CHa~  335 (390)
T PRK15032        319 AYADSLYNGTCNQCHGA  335 (390)
T ss_pred             HHHHHHHhccchhhcCC
Confidence            46999999999999985


No 51 
>PF09626 DHC:  Dihaem cytochrome c;  InterPro: IPR018588  Dihaem cytochrome c (DHC) is a soluble c-type cytochrome that folds into two distinct domains, each binding a single haem group and connected by a small linker region. Despite little sequence similarity, the N-terminal domain (residues 12-75) is a class I type cytochrome c, that binds one of the haems, but the domain surrounding the other haem is structurally unique. DHC binds electrostatically to an oxygen-binding protein, sphaeroides haem protein (SHP), as a component of a conserved electron transfer pathway. DHC acts as the physiological electron donor for SHP during phototrophic growth []. In certain species DHC is found upstream of IPR011577 from INTERPRO. ; PDB: 2FWT_A 2FW5_A.
Probab=95.55  E-value=0.02  Score=35.51  Aligned_cols=11  Identities=36%  Similarity=1.168  Sum_probs=7.2

Q ss_pred             HHhcCCccccC
Q 033761           19 FKTKCAQCHTV   29 (112)
Q Consensus        19 f~~~C~~CH~~   29 (112)
                      |.+.|++||-.
T Consensus         1 Y~~eCgsCH~a   11 (120)
T PF09626_consen    1 YKEECGSCHMA   11 (120)
T ss_dssp             -HHHTTSSS--
T ss_pred             CccchhhccCc
Confidence            56789999974


No 52 
>COG3488 Predicted thiol oxidoreductase [Energy production and conversion]
Probab=94.57  E-value=0.022  Score=41.22  Aligned_cols=22  Identities=36%  Similarity=0.741  Sum_probs=18.2

Q ss_pred             CccHHHHHHHHHh-cCCccccCc
Q 033761            9 PGNAKAGEKIFKT-KCAQCHTVE   30 (112)
Q Consensus         9 ~~~~~~G~~lf~~-~C~~CH~~~   30 (112)
                      ..++..|++||.+ .|++||.+.
T Consensus       348 dp~vl~GkkLF~~agC~aCH~pk  370 (481)
T COG3488         348 DPQVLAGKKLFAQAGCVACHTPK  370 (481)
T ss_pred             ChhhhhhhHHHHhcCchhccCCc
Confidence            4577899999986 699999854


No 53 
>PF03150 CCP_MauG:  Di-haem cytochrome c peroxidase;  InterPro: IPR004852 This is a group of distinct cytochrome c peroxidases (CCPs) that contain two haem groups. Similar to other cytochrome c peroxidases, they reduce hydrogen peroxide to water using c-type haem as an oxidizable substrate. However, since they possess two, instead of one, haem prosthetic groups, bacterial CCPs reduce hydrogen peroxide without the need to generate semi-stable free radicals. The two haem groups have significantly different redox potentials. The high potential (+320 mV) haem feeds electrons from electron shuttle proteins to the low potential (-330 mV) haem, where peroxide is reduced (indeed, the low potential site is known as the peroxidatic site) []. The CCP protein itself is structured into two domains, each containing one c-type haem group, with a calcium-binding site at the domain interface. This family also includes MauG proteins, whose similarity to di-haem CCP was previously recognised [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1IQC_A 2VHD_B 1EB7_A 3RN0_A 3SVW_B 3RMZ_A 3SJL_B 3PXW_A 3SLE_B 3PXS_A ....
Probab=93.98  E-value=0.01  Score=38.57  Aligned_cols=21  Identities=43%  Similarity=0.842  Sum_probs=14.8

Q ss_pred             ccHHHHHHHHHh---------cCCccccCc
Q 033761           10 GNAKAGEKIFKT---------KCAQCHTVE   30 (112)
Q Consensus        10 ~~~~~G~~lf~~---------~C~~CH~~~   30 (112)
                      +.++-|+.||..         .|++||.++
T Consensus         3 ~~~~LGk~LF~D~~LS~~~~~SCasCH~~~   32 (159)
T PF03150_consen    3 AKAALGKKLFFDPRLSGDGTVSCASCHDPE   32 (159)
T ss_dssp             HHHHHHHHHHT-GGGSTTSS--HHHHS-TT
T ss_pred             HHHHHHHHHhCCCccCCCcCcCchhhCCCc
Confidence            346789999943         499999876


No 54 
>TIGR03791 TTQ_mauG tryptophan tryptophylquinone biosynthesis enzyme MauG. Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Probab=91.57  E-value=0.081  Score=37.67  Aligned_cols=22  Identities=32%  Similarity=0.637  Sum_probs=16.7

Q ss_pred             ccHHHHHHHHHh---------cCCccccCcC
Q 033761           10 GNAKAGEKIFKT---------KCAQCHTVEK   31 (112)
Q Consensus        10 ~~~~~G~~lf~~---------~C~~CH~~~~   31 (112)
                      +.++-|+.||..         .|++||.++.
T Consensus         4 ~k~~LGk~LFfD~~LS~~~~~SCasCH~p~~   34 (291)
T TIGR03791         4 EKAALGKALFFDPRLSRDGSMSCATCHNPGL   34 (291)
T ss_pred             HHHHHHHHHhcCcccCCCCCcCchhcCCccc
Confidence            456789999931         4999998764


No 55 
>COG2857 CYT1 Cytochrome c1 [Energy production and conversion]
Probab=90.54  E-value=0.047  Score=38.01  Aligned_cols=24  Identities=25%  Similarity=0.767  Sum_probs=20.0

Q ss_pred             CCccHHHHHHHHHhcCCccccCcC
Q 033761            8 PPGNAKAGEKIFKTKCAQCHTVEK   31 (112)
Q Consensus         8 ~~~~~~~G~~lf~~~C~~CH~~~~   31 (112)
                      ..++..+|..+|...|..||+...
T Consensus        39 d~~~lq~g~~~~~~~c~~chs~~~   62 (250)
T COG2857          39 DKGSLQRGAQLYKEYCSACHSLKL   62 (250)
T ss_pred             hhHHhhhceeeeecCChhhccccc
Confidence            346778999999999999999654


No 56 
>PF07635 PSCyt1:  Planctomycete cytochrome C;  InterPro: IPR011429 These proteins share a region of homology at their N terminus that contains the C-{CPWHF}-{CPWR}-C-H-{CFYW} motif typical of cytochrome c.
Probab=90.33  E-value=0.17  Score=27.24  Aligned_cols=9  Identities=44%  Similarity=1.106  Sum_probs=7.6

Q ss_pred             CCccccCcC
Q 033761           23 CAQCHTVEK   31 (112)
Q Consensus        23 C~~CH~~~~   31 (112)
                      |..||+.+.
T Consensus         1 C~~CHg~~~    9 (59)
T PF07635_consen    1 CFSCHGPDK    9 (59)
T ss_pred             CcCCCCCCC
Confidence            999999764


No 57 
>COG1858 MauG Cytochrome c peroxidase [Inorganic ion transport and metabolism]
Probab=83.33  E-value=0.59  Score=34.35  Aligned_cols=22  Identities=36%  Similarity=0.850  Sum_probs=17.2

Q ss_pred             ccHHHHHHHHHh---------cCCccccCcC
Q 033761           10 GNAKAGEKIFKT---------KCAQCHTVEK   31 (112)
Q Consensus        10 ~~~~~G~~lf~~---------~C~~CH~~~~   31 (112)
                      +.++-|+.||-.         .|++||.+..
T Consensus        60 ~~~aLGk~LffDprLS~sg~~SC~sCH~~~~   90 (364)
T COG1858          60 AKAALGKKLFFDPRLSASGTISCATCHNLAR   90 (364)
T ss_pred             HHHHHHHHhhcCcccCCCCCcCchhhcCccc
Confidence            557889999932         4999998764


No 58 
>PF06537 DUF1111:  Protein of unknown function (DUF1111);  InterPro: IPR010538 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=82.03  E-value=0.8  Score=35.05  Aligned_cols=18  Identities=22%  Similarity=0.726  Sum_probs=14.0

Q ss_pred             HHHhc-CCccccCcCCCCC
Q 033761           18 IFKTK-CAQCHTVEKGAGH   35 (112)
Q Consensus        18 lf~~~-C~~CH~~~~~g~~   35 (112)
                      ||... |.+||--+|.|..
T Consensus        66 LfN~~SC~sCH~~dGRG~p   84 (499)
T PF06537_consen   66 LFNARSCQSCHIKDGRGHP   84 (499)
T ss_pred             hhhhhhHhhcccCCCCCCC
Confidence            77754 9999998877653


No 59 
>PF09832 DUF2059:  Uncharacterized protein conserved in bacteria (DUF2059);  InterPro: IPR018637  This entry contains proteins that have no known function. ; PDB: 2X3O_B 3OAO_A.
Probab=79.59  E-value=1.8  Score=23.38  Aligned_cols=16  Identities=6%  Similarity=0.220  Sum_probs=13.3

Q ss_pred             CCCHHHHHHHHHHHHh
Q 033761           94 LKKPQDRADLIAYLKQ  109 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~  109 (112)
                      .+|++|+.+|++|..|
T Consensus        16 ~ft~~El~~i~~FY~S   31 (64)
T PF09832_consen   16 HFTEEELDAILAFYES   31 (64)
T ss_dssp             HS-HHHHHHHHHHHHS
T ss_pred             HCCHHHHHHHHHHHCC
Confidence            4689999999999976


No 60 
>PF08090 Enterotoxin_HS1:  Heat stable E.coli enterotoxin 1;  InterPro: IPR012557 Heat-stable toxin 1 of entero-aggregative Escherichia coli (EAST1) is a small toxin. It is not, however, solely associated with entero-aggregative E. coli but also with many other diarrhoeic E. coli families. Some studies have established the role of EAST1 in some human outbreaks of diarrhoea. Isolates from farm animals have been shown to carry the astA gene coding for EAST1. However, the relation between the presence of EAST1 and disease is not conclusive [].
Probab=78.86  E-value=1.3  Score=20.80  Aligned_cols=10  Identities=40%  Similarity=0.953  Sum_probs=7.6

Q ss_pred             hcCCccccCc
Q 033761           21 TKCAQCHTVE   30 (112)
Q Consensus        21 ~~C~~CH~~~   30 (112)
                      ..|++||+..
T Consensus        20 tac~s~~grt   29 (36)
T PF08090_consen   20 TACGSCHGRT   29 (36)
T ss_pred             hhhccCCCCc
Confidence            4699999843


No 61 
>TIGR03806 chp_HNE_0200 conserved hypothetical protein, HNE_0200 family. The model TIGR03805 describes an uncharacterized protein family that contains repeats associated with the formation of a right-handed helical stack of parallel beta strands, homologous to those found in a number of carbohydrate-binding proteins and sugar hydrolases. This model describes another uncharacterized protein family, found in the same species as TIGR03805 member proteins, usually as the adjacent gene or in a fusion protein. An example is HNE_0200 from Hyphomonas neptunium ATCC 15444. Sometimes two members of this family are with a single member of TIGR03805. The function is unknown.
Probab=76.92  E-value=3.1  Score=30.14  Aligned_cols=23  Identities=30%  Similarity=0.574  Sum_probs=14.3

Q ss_pred             cCCccccCcCCCCCCCCCCccccc
Q 033761           22 KCAQCHTVEKGAGHKQGPNLNGLF   45 (112)
Q Consensus        22 ~C~~CH~~~~~g~~~~gP~l~~~~   45 (112)
                      .|..||...+. ....||....+.
T Consensus       145 ~C~~CH~~~~~-~~piG~k~r~LN  167 (317)
T TIGR03806       145 QCKQCHQLAAD-IVPLGPKARQLN  167 (317)
T ss_pred             HhHHhcCCCCC-ccccCcCHHHcC
Confidence            49999986432 234677655543


No 62 
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=75.50  E-value=1.8  Score=27.76  Aligned_cols=10  Identities=40%  Similarity=1.002  Sum_probs=5.6

Q ss_pred             CCccccCcCC
Q 033761           23 CAQCHTVEKG   32 (112)
Q Consensus        23 C~~CH~~~~~   32 (112)
                      |.+||.++.+
T Consensus       129 ClQCHVPQaD  138 (155)
T COG3043         129 CLQCHVPQAD  138 (155)
T ss_pred             eeeccccccc
Confidence            6666655443


No 63 
>PF07583 PSCyt2:  Protein of unknown function (DUF1549);  InterPro: IPR011444 The function is not known. It is found associated with IPR022655 from INTERPRO. It is also found associated with the Planctomycete cytochrome C domain IPR011429 from INTERPRO.
Probab=74.60  E-value=1.4  Score=29.93  Aligned_cols=14  Identities=43%  Similarity=1.001  Sum_probs=9.6

Q ss_pred             HHHHHHh---cCCcccc
Q 033761           15 GEKIFKT---KCAQCHT   28 (112)
Q Consensus        15 G~~lf~~---~C~~CH~   28 (112)
                      =.++|-+   .|+.||-
T Consensus       166 ~~~~FLG~~l~CAqCHd  182 (208)
T PF07583_consen  166 VSRVFLGVRLQCAQCHD  182 (208)
T ss_pred             HHHHHHhcccchhhccC
Confidence            3455654   5999996


No 64 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=73.56  E-value=2.4  Score=27.16  Aligned_cols=11  Identities=36%  Similarity=0.812  Sum_probs=7.5

Q ss_pred             cCCccccCcCC
Q 033761           22 KCAQCHTVEKG   32 (112)
Q Consensus        22 ~C~~CH~~~~~   32 (112)
                      .|..||.++.+
T Consensus       122 fCtQCHVPQad  132 (149)
T PRK11586        122 FCLQCHVPQAD  132 (149)
T ss_pred             eeccccCcccc
Confidence            38888876543


No 65 
>TIGR03153 cytochr_NrfH cytochrome c nitrate reductase, small subunit. Members of this protein family are NrfH, a tetraheme cytochrome c. NrfH is the cytochrome c nitrate reductase small subunit, and forms a heterodimer with NrfA, the catalytic subunit. While NrfA can act as a monomer, NrfH can bind to and anchor NrfA in the membrane and enables electron transfer to NrfA from quinones.
Probab=73.16  E-value=1.2  Score=27.98  Aligned_cols=16  Identities=25%  Similarity=0.760  Sum_probs=12.7

Q ss_pred             HHHHHHHhcCCccccC
Q 033761           14 AGEKIFKTKCAQCHTV   29 (112)
Q Consensus        14 ~G~~lf~~~C~~CH~~   29 (112)
                      +.+++.+.+|.+||+.
T Consensus        96 ~~~~~~~~nC~~CH~~  111 (135)
T TIGR03153        96 HSRKVVQENCVRCHAG  111 (135)
T ss_pred             HHhHhhhcchHHHHhH
Confidence            4567778899999974


No 66 
>TIGR01905 paired_CXXCH_1 doubled CXXCH domain. This model represents a domain of about 41 amino acids that contains, among other motifs, two copies of the motif CXXCH associated with heme binding. Almost every member of this family has at least three copies of this domain (at least six copies of CXXCH) is predicted to be a high molecular weight c-type cytochrome. Members are found mostly in species of Shewanella, Geobacter, and Vibrio.
Probab=69.72  E-value=1.9  Score=21.50  Aligned_cols=11  Identities=27%  Similarity=0.809  Sum_probs=8.5

Q ss_pred             hcCCccccCcC
Q 033761           21 TKCAQCHTVEK   31 (112)
Q Consensus        21 ~~C~~CH~~~~   31 (112)
                      ..|.+||.+.+
T Consensus         7 g~C~~CH~pH~   17 (41)
T TIGR01905         7 GDCTSCHDPHG   17 (41)
T ss_pred             CCccccccccc
Confidence            35999998754


No 67 
>PF03892 NapB:  Nitrate reductase cytochrome c-type subunit (NapB);  InterPro: IPR005591 The napB gene encodes a dihaem cytochrome c, the small subunit of a heterodimeric periplasmic nitrate reductase [].; PDB: 3O5A_B 3ML1_B 1OGY_L 1JNI_A.
Probab=68.58  E-value=2.3  Score=26.93  Aligned_cols=11  Identities=36%  Similarity=0.866  Sum_probs=5.4

Q ss_pred             cCCccccCcCC
Q 033761           22 KCAQCHTVEKG   32 (112)
Q Consensus        22 ~C~~CH~~~~~   32 (112)
                      .|..||.++.+
T Consensus       111 fC~qCHvpQ~d  121 (133)
T PF03892_consen  111 FCTQCHVPQAD  121 (133)
T ss_dssp             SGGGT--B-BS
T ss_pred             eeccccCcccc
Confidence            38888876543


No 68 
>COG3488 Predicted thiol oxidoreductase [Energy production and conversion]
Probab=67.60  E-value=2.4  Score=31.14  Aligned_cols=28  Identities=25%  Similarity=0.577  Sum_probs=18.6

Q ss_pred             CCccHHHHH-HHHHhc-CCccccCcCCCCC
Q 033761            8 PPGNAKAGE-KIFKTK-CAQCHTVEKGAGH   35 (112)
Q Consensus         8 ~~~~~~~G~-~lf~~~-C~~CH~~~~~g~~   35 (112)
                      ++.++..|- -||+.+ |-.||--+|.|..
T Consensus        82 sSTqAsDGLGPlfN~raCqnCHvkDGRGrP  111 (481)
T COG3488          82 SSTQASDGLGPLFNTRACQNCHVKDGRGRP  111 (481)
T ss_pred             cccccccccccccccccccccccccCCCCC
Confidence            344455554 466654 9999998887753


No 69 
>PF07627 PSCyt3:  Protein of unknown function (DUF1588);  InterPro: IPR013039  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013042 from INTERPRO and IPR013043 from INTERPRO.
Probab=64.44  E-value=1.3  Score=26.67  Aligned_cols=7  Identities=57%  Similarity=1.474  Sum_probs=6.2

Q ss_pred             cCCcccc
Q 033761           22 KCAQCHT   28 (112)
Q Consensus        22 ~C~~CH~   28 (112)
                      .|++||.
T Consensus        71 ~Ca~CH~   77 (101)
T PF07627_consen   71 ACASCHR   77 (101)
T ss_pred             cHHHHhh
Confidence            4999997


No 70 
>PF11845 DUF3365:  Protein of unknown function (DUF3365);  InterPro: IPR021796  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 198 to 657 amino acids in length. 
Probab=64.35  E-value=1.9  Score=28.27  Aligned_cols=8  Identities=38%  Similarity=1.120  Sum_probs=6.9

Q ss_pred             hcCCcccc
Q 033761           21 TKCAQCHT   28 (112)
Q Consensus        21 ~~C~~CH~   28 (112)
                      ..|..||+
T Consensus       147 ~~CL~CHg  154 (188)
T PF11845_consen  147 ESCLSCHG  154 (188)
T ss_pred             hHHHHccC
Confidence            35999998


No 71 
>PF09722 DUF2384:  Protein of unknown function (DUF2384);  InterPro: IPR024467 This domain is found predominantly in proteobacterial proteins. Its function in unknown.
Probab=60.97  E-value=8.1  Score=20.01  Aligned_cols=42  Identities=17%  Similarity=0.337  Sum_probs=29.4

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHhcc
Q 033761           69 EEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        69 ~~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      +.+....|+..|.....+ .-|..-+.|+..+..|..||..+.
T Consensus        10 d~~~a~~Wl~~p~~~l~g-~~Plel~~t~~G~~~V~~~L~~~~   51 (54)
T PF09722_consen   10 DEDKARRWLRTPNPALGG-RTPLELLRTEAGAERVLDYLDRIE   51 (54)
T ss_pred             CHHHHHHHHHChHHHhCC-CCHHHHHcChHHHHHHHHHHHHHH
Confidence            677889999987765544 233222336899999999998753


No 72 
>PF09699 Paired_CXXCH_1:  Doubled CXXCH motif (Paired_CXXCH_1)
Probab=60.13  E-value=2.7  Score=20.58  Aligned_cols=10  Identities=30%  Similarity=0.959  Sum_probs=8.0

Q ss_pred             cCCccccCcC
Q 033761           22 KCAQCHTVEK   31 (112)
Q Consensus        22 ~C~~CH~~~~   31 (112)
                      .|.+||.+.+
T Consensus         8 ~C~~CH~~H~   17 (41)
T PF09699_consen    8 QCTSCHDPHG   17 (41)
T ss_pred             ChhHhccccc
Confidence            4999998654


No 73 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=59.63  E-value=4.6  Score=17.94  Aligned_cols=8  Identities=75%  Similarity=1.564  Sum_probs=6.3

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      .|+.||.+
T Consensus        18 rCa~C~~V   25 (25)
T PF06943_consen   18 RCACCHTV   25 (25)
T ss_pred             ECCccCcC
Confidence            49999964


No 74 
>TIGR01904 GSu_C4xC__C2xCH Geobacter sulfurreducens CxxxxCH...CXXCH domain. This domain occurs from three to eight times in eight different proteins of Geobacter sulfurreducens. The final CXXCH motif matches ProSite motif PS00190, the cytochrome c family heme-binding site signature, suggesting
Probab=58.38  E-value=4.3  Score=20.40  Aligned_cols=6  Identities=50%  Similarity=1.475  Sum_probs=5.4

Q ss_pred             cCCccc
Q 033761           22 KCAQCH   27 (112)
Q Consensus        22 ~C~~CH   27 (112)
                      .|.+||
T Consensus        37 ~C~~CH   42 (42)
T TIGR01904        37 GCNGCH   42 (42)
T ss_pred             cCcccC
Confidence            599999


No 75 
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=55.19  E-value=18  Score=19.54  Aligned_cols=18  Identities=22%  Similarity=0.161  Sum_probs=14.9

Q ss_pred             CCCHHHHHHHHHHHHhcc
Q 033761           94 LKKPQDRADLIAYLKQST  111 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~l~  111 (112)
                      .-|++|+.+|++-|..+.
T Consensus        10 nPt~eElAAL~aVlaa~~   27 (62)
T PF13822_consen   10 NPTDEELAALTAVLAARA   27 (62)
T ss_pred             CCCHHHHHHHHHHHHHHh
Confidence            358999999999987654


No 76 
>PHA02119 hypothetical protein
Probab=55.16  E-value=8.8  Score=21.51  Aligned_cols=10  Identities=30%  Similarity=0.750  Sum_probs=8.5

Q ss_pred             HHHHHHHHhc
Q 033761          101 ADLIAYLKQS  110 (112)
Q Consensus       101 ~~l~ayl~~l  110 (112)
                      .+|++||++|
T Consensus        57 ~divdylr~l   66 (87)
T PHA02119         57 KDIVDYLRSL   66 (87)
T ss_pred             HHHHHHHHHc
Confidence            4789999987


No 77 
>PF12162 STAT1_TAZ2bind:  STAT1 TAZ2 binding domain;  InterPro: IPR022752 This entry represents the C-terminal domain of STAT1, which selectively binds the TAZ2 domain of CRB (CREB-binding protein) []. This group of eukaryotic proteins is approximately 20 amino acids in length, and is found in association with PF02865 from PFAM, PF00017 from PFAM, PF01017 from PFAM, PF02864 from PFAM. By binding to CRB, it becomes a transcriptional activator and can initiate transcription of certain genes. ; GO: 0003700 sequence-specific DNA binding transcription factor activity; PDB: 2KA6_B.
Probab=54.87  E-value=18  Score=15.69  Aligned_cols=18  Identities=22%  Similarity=0.307  Sum_probs=10.5

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHH
Q 033761           86 GTKMVFPGLKKPQDRADLIAYL  107 (112)
Q Consensus        86 ~~~m~~~~~ls~~e~~~l~ayl  107 (112)
                      .++||    +|++|-..|..++
T Consensus         5 dnmmP----MSPddy~~l~~~V   22 (23)
T PF12162_consen    5 DNMMP----MSPDDYDELERMV   22 (23)
T ss_dssp             TS-------S-HHHHHHHHHHH
T ss_pred             hcccC----CCHHHHHHHHHhh
Confidence            35778    6799998887765


No 78 
>PF13986 DUF4224:  Domain of unknown function (DUF4224)
Probab=53.33  E-value=8.6  Score=19.68  Aligned_cols=14  Identities=14%  Similarity=0.325  Sum_probs=11.5

Q ss_pred             CCCHHHHHHHHHHH
Q 033761           94 LKKPQDRADLIAYL  107 (112)
Q Consensus        94 ~ls~~e~~~l~ayl  107 (112)
                      .||++|+.+|..|-
T Consensus         2 fLT~~El~elTG~k   15 (47)
T PF13986_consen    2 FLTDEELQELTGYK   15 (47)
T ss_pred             CCCHHHHHHHHCCC
Confidence            47999999998764


No 79 
>COG3005 TorC Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit [Energy production and conversion]
Probab=50.33  E-value=6.2  Score=26.43  Aligned_cols=16  Identities=19%  Similarity=0.571  Sum_probs=10.7

Q ss_pred             HHHHHhcCCccccCcC
Q 033761           16 EKIFKTKCAQCHTVEK   31 (112)
Q Consensus        16 ~~lf~~~C~~CH~~~~   31 (112)
                      +..+-..|.+||..+.
T Consensus       130 kan~s~eCr~CH~~~~  145 (190)
T COG3005         130 KANDSAECRNCHNFDA  145 (190)
T ss_pred             Hhhcchhhhhccchhh
Confidence            3344446999998763


No 80 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=50.07  E-value=6.6  Score=18.33  Aligned_cols=9  Identities=56%  Similarity=1.276  Sum_probs=7.2

Q ss_pred             cCCccccCc
Q 033761           22 KCAQCHTVE   30 (112)
Q Consensus        22 ~C~~CH~~~   30 (112)
                      .|+.||.++
T Consensus        21 rCs~C~~vt   29 (31)
T TIGR01053        21 RCALCQTVN   29 (31)
T ss_pred             ECCCCCeEe
Confidence            499999864


No 81 
>PF11256 DUF3055:  Protein of unknown function (DUF3055);  InterPro: IPR021415  This family of proteins with unknown function appear to be restricted to Firmicutes. 
Probab=47.52  E-value=22  Score=20.55  Aligned_cols=16  Identities=13%  Similarity=0.256  Sum_probs=14.0

Q ss_pred             CCHHHHHHHHHHHHhc
Q 033761           95 KKPQDRADLIAYLKQS  110 (112)
Q Consensus        95 ls~~e~~~l~ayl~~l  110 (112)
                      ++++|.++|.+||..+
T Consensus        66 l~~eea~eL~~fl~~~   81 (81)
T PF11256_consen   66 LSEEEAEELREFLYEL   81 (81)
T ss_pred             CCHHHHHHHHHHHhhC
Confidence            4899999999999864


No 82 
>CHL00037 petA cytochrome f
Probab=45.26  E-value=7.1  Score=28.07  Aligned_cols=7  Identities=57%  Similarity=1.383  Sum_probs=6.0

Q ss_pred             cCCcccc
Q 033761           22 KCAQCHT   28 (112)
Q Consensus        22 ~C~~CH~   28 (112)
                      .|+.||-
T Consensus        55 VCANCHL   61 (320)
T CHL00037         55 VCANCHL   61 (320)
T ss_pred             Eeecccc
Confidence            4999996


No 83 
>PHA02902 putative IMV membrane protein; Provisional
Probab=44.35  E-value=27  Score=19.25  Aligned_cols=20  Identities=15%  Similarity=0.202  Sum_probs=15.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHh
Q 033761           90 VFPGLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        90 ~~~~~ls~~e~~~l~ayl~~  109 (112)
                      .|...||++|+.++-.++.+
T Consensus        49 ~F~D~lTpDQirAlHrlvT~   68 (70)
T PHA02902         49 LFKDSLTPDQIKALHRLVSL   68 (70)
T ss_pred             hhhccCCHHHHHHHHHHHhc
Confidence            37778999999998877643


No 84 
>cd07321 Extradiol_Dioxygenase_3A_like Subunit A of Class III extradiol dioxygenases. Extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into substrates using a variety of reaction mechanisms, resulting in the cleavage of aromatic rings.  There are two major groups of dioxygenases according to the cleavage site of the aromatic ring. Intradiol enzymes cleave the aromatic ring between two hydroxyl groups, whereas extradiol enzymes cleave the aromatic ring between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Extradiol dioxygenases can be divided into three classes. Class I and II enzymes are evolutionary related and show sequence similarity, with the two domain class II enzymes evolving from the class I enzyme through gene duplication. Class III enzymes are different in sequence and structure and usually have two subunits, designated A and B, which form a tetramer composed of two copies of each subunit. This model represents subunit A of c
Probab=44.28  E-value=12  Score=21.27  Aligned_cols=31  Identities=16%  Similarity=0.379  Sum_probs=20.5

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q 033761           69 EEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIA  105 (112)
Q Consensus        69 ~~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~~l~a  105 (112)
                      +.+...+|+.+|......    +  -||++|+++|.+
T Consensus        15 ~~~~re~f~~dp~a~~~~----~--~Lt~eE~~al~~   45 (77)
T cd07321          15 KPEVKERFKADPEAVLAE----Y--GLTPEEKAALLA   45 (77)
T ss_pred             CHHHHHHHHhCHHHHHHH----c--CCCHHHHHHHHc
Confidence            466777888876643321    2  378999998863


No 85 
>PRK02693 apocytochrome f; Reviewed
Probab=44.20  E-value=7.6  Score=27.70  Aligned_cols=7  Identities=57%  Similarity=1.383  Sum_probs=6.0

Q ss_pred             cCCcccc
Q 033761           22 KCAQCHT   28 (112)
Q Consensus        22 ~C~~CH~   28 (112)
                      .|+.||-
T Consensus        48 VCANCHL   54 (312)
T PRK02693         48 VCANCHL   54 (312)
T ss_pred             Eeecccc
Confidence            3999996


No 86 
>COG3303 NrfA Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit [Inorganic ion transport and metabolism]
Probab=43.91  E-value=6.8  Score=29.27  Aligned_cols=17  Identities=35%  Similarity=0.655  Sum_probs=12.4

Q ss_pred             HHHHHHHhcCCccccCc
Q 033761           14 AGEKIFKTKCAQCHTVE   30 (112)
Q Consensus        14 ~G~~lf~~~C~~CH~~~   30 (112)
                      +-..-|.+.|++||..+
T Consensus       324 nPf~~f~stCanCH~Qs  340 (501)
T COG3303         324 NPFDNFASTCANCHTQS  340 (501)
T ss_pred             ChhHHHHHHHhhhhhhh
Confidence            34556777899999843


No 87 
>PF13435 Cytochrome_C554:  Cytochrome c554 and c-prime; PDB: 1BVB_A 1FT5_A 1FT6_A 1SP3_A.
Probab=42.67  E-value=12  Score=22.05  Aligned_cols=10  Identities=40%  Similarity=0.992  Sum_probs=8.0

Q ss_pred             hcCCccccCc
Q 033761           21 TKCAQCHTVE   30 (112)
Q Consensus        21 ~~C~~CH~~~   30 (112)
                      ..|..||...
T Consensus        49 ~~C~~CH~~~   58 (130)
T PF13435_consen   49 DSCTSCHTPG   58 (130)
T ss_dssp             CCCGGGSCCT
T ss_pred             CcccccCCCc
Confidence            3699999865


No 88 
>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein. Members of this family represent a set of proteins related to, yet architecturally different from, the activating protein for the glycine radical-containing, oxygen-sensitive ribonucleoside-triphosphate reductase (RNR) as described in model TIGR02491. Members of this family are found paired with members of a similarly divergent set of anaerobic ribonucleoside-triphosphate reductases. Identification of this protein as an RNR activitating protein is partly from pairing with a candidate RNR. It is further supported by our finding that upstream of these operons are examples of a conserved regulatory element (described Rodionov and Gelfand) that is found in nearly all bacteria and that occurs specifically upstream of operons for all three classes of RNR genes.
Probab=41.73  E-value=65  Score=20.51  Aligned_cols=9  Identities=44%  Similarity=1.102  Sum_probs=7.4

Q ss_pred             cCCccccCc
Q 033761           22 KCAQCHTVE   30 (112)
Q Consensus        22 ~C~~CH~~~   30 (112)
                      .|..||...
T Consensus        28 rC~~C~n~~   36 (147)
T TIGR02826        28 GCKGCHSPE   36 (147)
T ss_pred             CCCCCCChH
Confidence            599999864


No 89 
>PF14522 Cytochrome_C7:  Cytochrome c7; PDB: 3OV0_A 3OUQ_A 3H4N_A 3BXU_B 1OS6_A 2LDO_A 3OUE_A 3H33_A 1RWJ_A 1LM2_A ....
Probab=41.68  E-value=11  Score=19.95  Aligned_cols=8  Identities=50%  Similarity=1.290  Sum_probs=7.0

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      .|..||+.
T Consensus        14 ~C~~CH~~   21 (65)
T PF14522_consen   14 NCASCHSD   21 (65)
T ss_dssp             CGCCTSTT
T ss_pred             ChhhhCCC
Confidence            69999985


No 90 
>PF07128 DUF1380:  Protein of unknown function (DUF1380);  InterPro: IPR009811 This family consists of several hypothetical bacterial proteins of around 140 residues in length. Members of this family seem to be specific to Enterobacteria. The function of this family is unknown.
Probab=40.36  E-value=56  Score=20.89  Aligned_cols=36  Identities=8%  Similarity=0.165  Sum_probs=24.7

Q ss_pred             ccccccHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHhc
Q 033761           64 MAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKQS  110 (112)
Q Consensus        64 ~~~~~~~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~~l~ayl~~l  110 (112)
                      .-++|+.+.+.....+         |-+  .+|++|+..|..+|-..
T Consensus        23 ~LlIWT~eDV~~~a~g---------me~--~lTd~E~~aVL~~I~~~   58 (139)
T PF07128_consen   23 ALLIWTREDVRALADG---------MEY--NLTDDEARAVLARIGDI   58 (139)
T ss_pred             EEEEecHHHHHHHHhc---------CCC--CCCHHHHHHHHHHHhcC
Confidence            3467888888777331         322  26899999999988654


No 91 
>COG5204 SPT4 Transcription elongation factor SPT4 [Transcription]
Probab=39.91  E-value=47  Score=19.89  Aligned_cols=35  Identities=17%  Similarity=0.136  Sum_probs=19.5

Q ss_pred             cHHHHHHHHhCCCCCCCC-CCCCCCCCCCHHHHHHHH
Q 033761           69 EEKTLYDYLLNPKKYIPG-TKMVFPGLKKPQDRADLI  104 (112)
Q Consensus        69 ~~~~l~~~l~~~~~~~~~-~~m~~~~~ls~~e~~~l~  104 (112)
                      +..|..+|.+=. ...+| ..|-..+.|+++=+++|-
T Consensus        62 t~SWVakWqrid-~f~~GlYA~~V~G~L~edvve~L~   97 (112)
T COG5204          62 TNSWVAKWQRID-EFRKGLYAMVVEGALSEDVVEDLE   97 (112)
T ss_pred             cHHHHHHHhhhc-ccccceeEEEEcccCCHHHHHHHH
Confidence            455777776421 12222 134466788877777665


No 92 
>cd07922 CarBa CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and   subsequent ring-opening of 2-aminophenyl-2,3-diol. CarBa is the A subunit of 2-aminophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-aminophenyl-2,3-diol. 2-aminophenol 1,6-dioxygenase is a key enzyme in the carbazole degradation pathway isolated from bacterial strains with carbazole degradation ability. The enzyme is a heterotetramer composed of two A and two B subunits. CarB belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Although the enzyme was originally isolated as a meta-cleavage enzyme for 2'-aminobiphenyl-2,3-diol involved in carbazole degradation, the enzyme has also shown high specificity for 2,3-dihydroxybiphenyl.
Probab=39.56  E-value=16  Score=21.06  Aligned_cols=30  Identities=17%  Similarity=0.261  Sum_probs=20.6

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHH
Q 033761           69 EEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLI  104 (112)
Q Consensus        69 ~~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~~l~  104 (112)
                      +.+...+|+.+|.....    .+  -||++|+.+|.
T Consensus        16 dp~~rerF~~DPea~~~----~~--gLt~eE~~aL~   45 (81)
T cd07922          16 DPGLIERFQDDPSAVFE----EY--GLTPAERAALR   45 (81)
T ss_pred             CHHHHHHHHHCHHHHHH----Hc--CCCHHHHHHHH
Confidence            67788888888764322    12  27899998875


No 93 
>PF06883 RNA_pol_Rpa2_4:  RNA polymerase I, Rpa2 specific domain ;  InterPro: IPR009674 This domain is found between domain 3 and domain 5, but shows no homology to domain 4 of Rpb2. The external domains in multisubunit RNA polymerase (those most distant from the active site) are known to demonstrate more sequence variability [].; GO: 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus
Probab=38.70  E-value=34  Score=18.30  Aligned_cols=18  Identities=11%  Similarity=0.255  Sum_probs=14.8

Q ss_pred             CCCHHHHHHHHHHHHhcc
Q 033761           94 LKKPQDRADLIAYLKQST  111 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~l~  111 (112)
                      .+++++...+++.||.++
T Consensus         3 ~~~~~~a~~~~~~LR~~K   20 (58)
T PF06883_consen    3 YVSPEEAEQIADQLRYLK   20 (58)
T ss_pred             eecHHHHHHHHHHHHHHH
Confidence            357889999999998775


No 94 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=37.95  E-value=13  Score=19.59  Aligned_cols=11  Identities=18%  Similarity=0.555  Sum_probs=9.0

Q ss_pred             cCCccccCcCC
Q 033761           22 KCAQCHTVEKG   32 (112)
Q Consensus        22 ~C~~CH~~~~~   32 (112)
                      .|..||..+|.
T Consensus        24 IC~~C~~hNGl   34 (54)
T PF10058_consen   24 ICSKCFSHNGL   34 (54)
T ss_pred             ECcccchhhcc
Confidence            49999998764


No 95 
>PF11829 DUF3349:  Protein of unknown function (DUF3349);  InterPro: IPR021784  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 99 to 124 amino acids in length. ; PDB: 2KVC_A 3OL3_B 3OL4_A 2LKY_A.
Probab=37.81  E-value=45  Score=19.90  Aligned_cols=17  Identities=18%  Similarity=0.085  Sum_probs=13.2

Q ss_pred             CCCCCHHHHHHHHHHHH
Q 033761           92 PGLKKPQDRADLIAYLK  108 (112)
Q Consensus        92 ~~~ls~~e~~~l~ayl~  108 (112)
                      ...||++|+.+|++-|.
T Consensus        33 ~r~Ltd~ev~~Va~~L~   49 (96)
T PF11829_consen   33 RRRLTDDEVAEVAAELA   49 (96)
T ss_dssp             TTTS-HHHHHHHHHHHH
T ss_pred             cccCCHHHHHHHHHHHH
Confidence            44689999999998874


No 96 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=36.71  E-value=14  Score=18.04  Aligned_cols=8  Identities=25%  Similarity=0.933  Sum_probs=6.7

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      .|.+|||+
T Consensus        21 ~C~~C~G~   28 (41)
T PF13453_consen   21 VCPSCGGI   28 (41)
T ss_pred             ECCCCCeE
Confidence            59999984


No 97 
>PHA02681 ORF089 virion membrane protein; Provisional
Probab=36.50  E-value=37  Score=19.73  Aligned_cols=19  Identities=11%  Similarity=0.102  Sum_probs=15.9

Q ss_pred             CCCCCCHHHHHHHHHHHHh
Q 033761           91 FPGLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        91 ~~~~ls~~e~~~l~ayl~~  109 (112)
                      |...||++|++++=.++.+
T Consensus        48 F~D~lTpDQVrAlHRlvTs   66 (92)
T PHA02681         48 FEDKMTDDQVRAFHALVTS   66 (92)
T ss_pred             hhccCCHHHHHHHHHHHhC
Confidence            7778999999999888754


No 98 
>PF15161 Neuropep_like:  Neuropeptide-like
Probab=35.77  E-value=11  Score=20.23  Aligned_cols=8  Identities=38%  Similarity=1.252  Sum_probs=6.7

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      -|+.||..
T Consensus        15 PCVDCHAF   22 (65)
T PF15161_consen   15 PCVDCHAF   22 (65)
T ss_pred             CchhhHHH
Confidence            49999984


No 99 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=35.76  E-value=10  Score=21.63  Aligned_cols=13  Identities=38%  Similarity=0.846  Sum_probs=11.1

Q ss_pred             CCCHHHHHHHHHH
Q 033761           94 LKKPQDRADLIAY  106 (112)
Q Consensus        94 ~ls~~e~~~l~ay  106 (112)
                      .||++|+++++.|
T Consensus        31 ~Lt~eEr~dmI~~   43 (76)
T PF10955_consen   31 HLTPEERQDMISY   43 (76)
T ss_pred             cCCHHHHhhheEE
Confidence            4789999999876


No 100
>PF02304 Phage_B:  Scaffold protein B;  InterPro: IPR003513 This is a family of proteins from single-stranded DNA bacteriophages. Scaffold proteins B and D are required for procapsid formation. Sixty copies of the internal scaffold protein B are found in the procapsid.; GO: 0019069 viral capsid assembly, 0046729 viral procapsid; PDB: 1CD3_B 1AL0_B.
Probab=35.29  E-value=24  Score=21.44  Aligned_cols=19  Identities=26%  Similarity=0.600  Sum_probs=13.5

Q ss_pred             ccHHHHHHHHHhc--CCcccc
Q 033761           10 GNAKAGEKIFKTK--CAQCHT   28 (112)
Q Consensus        10 ~~~~~G~~lf~~~--C~~CH~   28 (112)
                      .+++.|+.+|..+  |+-|--
T Consensus        62 ~~iE~~ka~~~R~FG~A~~~d   82 (117)
T PF02304_consen   62 IDIEAGKAACARRFGCATCDD   82 (117)
T ss_dssp             HHHHHHHHHHHHHHHSS--SC
T ss_pred             HHHHHHHHHHHHHcCCCCcch
Confidence            4678899999874  999974


No 101
>COG0099 RpsM Ribosomal protein S13 [Translation, ribosomal structure and biogenesis]
Probab=34.79  E-value=47  Score=20.69  Aligned_cols=16  Identities=13%  Similarity=0.135  Sum_probs=14.0

Q ss_pred             CCCCHHHHHHHHHHHH
Q 033761           93 GLKKPQDRADLIAYLK  108 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~  108 (112)
                      +.|||+|+..|..++.
T Consensus        46 ~eLteeei~~ir~~i~   61 (121)
T COG0099          46 GELTEEEIERLRDAIQ   61 (121)
T ss_pred             ccCCHHHHHHHHHHHH
Confidence            3589999999999987


No 102
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the Pfam model pfam03031.
Probab=34.76  E-value=52  Score=21.10  Aligned_cols=23  Identities=17%  Similarity=0.225  Sum_probs=19.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHhccC
Q 033761           90 VFPGLKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        90 ~~~~~ls~~e~~~l~ayl~~l~~  112 (112)
                      +|.+...|.++..|..||.+|++
T Consensus       137 ~f~~~~~D~~L~~l~~~L~~l~~  159 (162)
T TIGR02251       137 SWFGDPNDTELLNLIPFLEGLRF  159 (162)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHhc
Confidence            57777789999999999998864


No 103
>PHA00003 B internal scaffolding protein
Probab=34.38  E-value=30  Score=21.10  Aligned_cols=19  Identities=26%  Similarity=0.536  Sum_probs=15.2

Q ss_pred             ccHHHHHHHHHhc--CCcccc
Q 033761           10 GNAKAGEKIFKTK--CAQCHT   28 (112)
Q Consensus        10 ~~~~~G~~lf~~~--C~~CH~   28 (112)
                      .+++.|+.+|...  |+-|--
T Consensus        65 ~~iEagk~~c~RrFGgAtcdd   85 (120)
T PHA00003         65 ADIEAGKAICARRFGGATCDD   85 (120)
T ss_pred             HHHHHHHHHHHHHcCCCCcch
Confidence            4678899999874  999974


No 104
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=34.20  E-value=43  Score=19.43  Aligned_cols=14  Identities=7%  Similarity=0.318  Sum_probs=12.2

Q ss_pred             CHHHHHHHHHHHHh
Q 033761           96 KPQDRADLIAYLKQ  109 (112)
Q Consensus        96 s~~e~~~l~ayl~~  109 (112)
                      ||+|+++++.|.-+
T Consensus        58 SDeEm~AMlsyy~~   71 (91)
T cd06395          58 SDEEMKAMLSYYCS   71 (91)
T ss_pred             chHHHHHHHHHHHH
Confidence            89999999999754


No 105
>PF14537 Cytochrom_c3_2:  Cytochrome c3; PDB: 1D4C_A 1D4E_A 1D4D_A 2K3V_A 1QO8_D 2P0B_A 2OZY_A 1M64_A 1JRX_A 1QJD_A ....
Probab=34.16  E-value=15  Score=20.07  Aligned_cols=8  Identities=38%  Similarity=1.161  Sum_probs=6.7

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      .|..||+.
T Consensus         8 ~C~~CH~~   15 (80)
T PF14537_consen    8 NCVDCHGP   15 (80)
T ss_dssp             TGGGTSSS
T ss_pred             ChhHhCCC
Confidence            69999974


No 106
>cd07921 PCA_45_Doxase_A_like Subunit A of the Class III Extradiol dioxygenase, Protocatechuate 4,5-dioxygenase, and similar enzymes. This subfamily includes the A subunit of protocatechuate (PCA) 4,5-dioxygenase (LigAB) and two subfamilies of unknown function. The A subunit is the smaller, non-catalytic subunit of LigAB. PCA 4,5-dioxygenase catalyzes the oxidization and subsequent ring-opening of PCA (or 3,4-dihydroxybenzoic acid), which is an intermediate in the breakdown of lignin and other compounds. PCA 4,5-dioxygenase is one of the aromatic ring opening dioxygenases which play key roles in the degradation of aromatic compounds. As members of the Class III extradiol dioxygenase family, the enzymes use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. LigAB-like class III enzymes are usually composed of two subunits, designated A and B, which form a tetramer composed of two copies of each subunit.
Probab=33.87  E-value=24  Score=21.46  Aligned_cols=31  Identities=6%  Similarity=0.175  Sum_probs=20.0

Q ss_pred             cHHHHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q 033761           69 EEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIA  105 (112)
Q Consensus        69 ~~~~l~~~l~~~~~~~~~~~m~~~~~ls~~e~~~l~a  105 (112)
                      +.++..+|+.||..+...    +  -||+||+++|.+
T Consensus        25 ~a~~Re~F~aD~eAy~~~----~--gLTeEe~~AV~~   55 (106)
T cd07921          25 KAENREAFKADEEAYCDK----F--GLTEEQKQAVLD   55 (106)
T ss_pred             CHHHHHHHHhCHHHHHHH----c--CCCHHHHHHHHh
Confidence            456777787776643221    2  278999998863


No 107
>PF04320 DUF469:  Protein with unknown function (DUF469);  InterPro: IPR007416 This entry represents a family of uncharacterised proteins which are predicted to function as phosphotransferases.
Probab=33.20  E-value=60  Score=19.55  Aligned_cols=19  Identities=37%  Similarity=0.475  Sum_probs=15.7

Q ss_pred             CCCCHHHHHHHHHHHHhcc
Q 033761           93 GLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~l~  111 (112)
                      +..|++++.+|.+||...+
T Consensus        68 gs~tee~R~~v~~WL~~~~   86 (101)
T PF04320_consen   68 GSCTEEDRAAVEAWLKARP   86 (101)
T ss_pred             CCCCHHHHHHHHHHHHhCC
Confidence            4569999999999998653


No 108
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=32.06  E-value=47  Score=21.33  Aligned_cols=17  Identities=35%  Similarity=0.401  Sum_probs=14.4

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      +.||.+|++.|.+||+.
T Consensus        31 ~elT~eEl~lv~~ylkR   47 (146)
T PF07295_consen   31 GELTREELALVSAYLKR   47 (146)
T ss_pred             hhcCHHHHHHHHHHHHH
Confidence            35799999999999963


No 109
>cd04860 AE_Prim_S AE_Prim_S: primase domain similar to that found in the small subunit of archaeal and eukaryotic (A/E) DNA primases. Primases are DNA-dependent RNA polymerases which synthesis the short RNA primers required for DNA replication. In addition to its catalytic role in replication, DNA primase may play a role in coupling replication to DNA damage repair and in checkpoint control during S phase. In eukaryotes, this small catalytically active primase subunit (p50) and a larger primase subunit (p60), referred to jointly as the core primase, associate with the B subunit and the DNA polymerase alpha subunit in a complex, called Pol alpha-pri. The function of the larger primase subunit is unclear. Included in this group are Pfu41 and Pfu46, these two proteins comprise the primase complex of the archaea Pyrococcus furiosus; Pfu41 and Pfu46 have sequence identity to the eukaryotic p50 and p60 primase proteins respectively. Pfu41 preferentially uses dNTPs as substrate. Pfu46 regulat
Probab=31.91  E-value=46  Score=23.02  Aligned_cols=17  Identities=18%  Similarity=0.442  Sum_probs=14.7

Q ss_pred             CCCHHHHHHHHHHHHhc
Q 033761           94 LKKPQDRADLIAYLKQS  110 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~l  110 (112)
                      .|+++++.+|+.||...
T Consensus       150 ~L~~~~R~~Iv~Yl~~~  166 (232)
T cd04860         150 KLDSDERREIVDYLNGI  166 (232)
T ss_pred             hCCHHHHHHHHHHHHHh
Confidence            47999999999999754


No 110
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=31.63  E-value=43  Score=17.70  Aligned_cols=14  Identities=21%  Similarity=0.534  Sum_probs=11.9

Q ss_pred             CHHHHHHHHHHHHh
Q 033761           96 KPQDRADLIAYLKQ  109 (112)
Q Consensus        96 s~~e~~~l~ayl~~  109 (112)
                      ..+.+..|+.|||+
T Consensus        12 ~~e~L~~l~~YLR~   25 (55)
T PF13821_consen   12 PEERLDKLLSYLRE   25 (55)
T ss_pred             HHHHHHHHHHHHHh
Confidence            47888999999986


No 111
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=31.59  E-value=41  Score=16.70  Aligned_cols=17  Identities=24%  Similarity=0.583  Sum_probs=13.3

Q ss_pred             HHHHHHHHHhcCCcccc
Q 033761           12 AKAGEKIFKTKCAQCHT   28 (112)
Q Consensus        12 ~~~G~~lf~~~C~~CH~   28 (112)
                      ..+|..+....|..|..
T Consensus         9 LL~G~~ML~~~Cp~C~~   25 (41)
T PF06677_consen    9 LLQGWTMLDEHCPDCGT   25 (41)
T ss_pred             HHHhHhHhcCccCCCCC
Confidence            45688888888999965


No 112
>PRK11659 cytochrome c nitrite reductase pentaheme subunit; Provisional
Probab=31.50  E-value=14  Score=24.48  Aligned_cols=10  Identities=40%  Similarity=1.158  Sum_probs=8.4

Q ss_pred             cCCccccCcC
Q 033761           22 KCAQCHTVEK   31 (112)
Q Consensus        22 ~C~~CH~~~~   31 (112)
                      .|++||.+-+
T Consensus       134 ~C~~CH~~H~  143 (183)
T PRK11659        134 TCASCHSLHP  143 (183)
T ss_pred             chhhhhhccc
Confidence            5999999764


No 113
>PF04674 Phi_1:  Phosphate-induced protein 1 conserved region;  InterPro: IPR006766 This entry represents a family of conserved plant proteins. A conserved region in these proteins was identified in a phosphate-induced protein of unknown function [].
Probab=31.26  E-value=45  Score=23.80  Aligned_cols=21  Identities=19%  Similarity=0.363  Sum_probs=17.0

Q ss_pred             CCCCCCHHHHHHHHHHHHhcc
Q 033761           91 FPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        91 ~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      |++..++.|+.-|.+||++|+
T Consensus        19 WYG~ftp~QkaiI~DFl~SLs   39 (273)
T PF04674_consen   19 WYGRFTPAQKAIIRDFLRSLS   39 (273)
T ss_pred             EeeCCCHHHHHHHHHHHHhcC
Confidence            344568999999999999986


No 114
>PF14769 CLAMP:  Flagellar C1a complex subunit C1a-32
Probab=30.57  E-value=63  Score=19.02  Aligned_cols=17  Identities=18%  Similarity=0.415  Sum_probs=14.5

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      ++.|.+|+.+|++|+.+
T Consensus        62 ~iFs~~~~~~i~~y~~~   78 (101)
T PF14769_consen   62 GIFSVDQVKAIIDYFHN   78 (101)
T ss_pred             CcCCHHHHHHHHHHHHH
Confidence            46799999999999864


No 115
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription]
Probab=30.43  E-value=94  Score=22.03  Aligned_cols=22  Identities=9%  Similarity=0.141  Sum_probs=18.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHhcc
Q 033761           90 VFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        90 ~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      +|..-.+|.|+-.|+-||.+|.
T Consensus       226 sw~~d~~D~eLL~LlpfLe~L~  247 (262)
T KOG1605|consen  226 SWFDDPTDTELLKLLPFLEALA  247 (262)
T ss_pred             ccccCCChHHHHHHHHHHHHhc
Confidence            5666678999999999999875


No 116
>TIGR03152 cyto_c552_HCOOH formate-dependent cytochrome c nitrite reductase, c552 subunit. Members of this protein family are cytochrome c552, a component of cytochrome c nitrite reductase, which is known more formally as nitrite reductase (cytochrome; ammonia-forming) (EC 1.7.2.2). Nitrate can be reduced by several enzymes. EC 1.7.2.2 reduces nitrite all the way to ammonia, rather than to ammonium hydroxide (nitrite reductase (NAD(P)H), EC 1.7.1.4) or nitric oxide (nitrite reductase (NO-forming), EC 1.7.2.1). Some examples of EC 1.7.2.2 occur in a seven gene system that enables formate-dependent nitrite reduction, but is also found in simpler contexts. Members of this protein family, however, belong to the formate-dependent system.
Probab=30.15  E-value=25  Score=26.81  Aligned_cols=10  Identities=40%  Similarity=1.039  Sum_probs=7.9

Q ss_pred             cCCccccCcC
Q 033761           22 KCAQCHTVEK   31 (112)
Q Consensus        22 ~C~~CH~~~~   31 (112)
                      .|+.||.+..
T Consensus       122 gCadCHd~es  131 (439)
T TIGR03152       122 GCADCHDTTS  131 (439)
T ss_pred             ChhhcCCCcc
Confidence            4999998654


No 117
>PF10281 Ish1:  Putative stress-responsive nuclear envelope protein;  InterPro: IPR018803  This group of proteins, found primarily in fungi, consists of putative stress-responsive nuclear envelope protein Ish1 and homologues []. 
Probab=30.05  E-value=72  Score=15.15  Aligned_cols=13  Identities=23%  Similarity=0.693  Sum_probs=11.4

Q ss_pred             cccHHHHHHHHhC
Q 033761           67 NWEEKTLYDYLLN   79 (112)
Q Consensus        67 ~~~~~~l~~~l~~   79 (112)
                      .|+.+.|..||..
T Consensus         3 tWs~~~L~~wL~~   15 (38)
T PF10281_consen    3 TWSDSDLKSWLKS   15 (38)
T ss_pred             CCCHHHHHHHHHH
Confidence            4899999999976


No 118
>TIGR03146 cyt_nit_nrfB cytochrome c nitrite reductase, pentaheme subunit. Members of this protein family contain five copies of the CXXCH heme-binding motif, and are the NrfB component of the multisubunit enzyme, cytochrome c nitrite reductase.
Probab=29.27  E-value=18  Score=22.93  Aligned_cols=10  Identities=50%  Similarity=1.192  Sum_probs=8.1

Q ss_pred             cCCccccCcC
Q 033761           22 KCAQCHTVEK   31 (112)
Q Consensus        22 ~C~~CH~~~~   31 (112)
                      .|.+||++-+
T Consensus       111 ~C~~CH~~H~  120 (145)
T TIGR03146       111 TCASCHTLHP  120 (145)
T ss_pred             Chhhhccccc
Confidence            4999998763


No 119
>PF07095 IgaA:  Intracellular growth attenuator protein IgaA;  InterPro: IPR010771 This family consists of several bacterial intracellular growth attenuator (IgaA) proteins. IgaA is involved in negative control of bacterial proliferation within fibroblasts. IgaA is homologous to the Escherichia coli YrfF and Proteus mirabilis UmoB proteins. Whereas the biological function of YrfF is currently unknown, UmoB has been shown elsewhere to act as a positive regulator of FlhDC, the master regulator of flagella and swarming. FlhDC has been shown to repress cell division during P. mirabilis swarming, suggesting that UmoB could repress cell division via FlhDC. This biological function, if maintained in Salmonella enterica, could sustain a putative negative control of cell division and growth exerted by IgaA in intracellular bacteria [].; GO: 0009276 Gram-negative-bacterium-type cell wall, 0016021 integral to membrane
Probab=29.19  E-value=95  Score=25.19  Aligned_cols=22  Identities=18%  Similarity=0.188  Sum_probs=17.6

Q ss_pred             CCCCCCCHHHHHHHHHHHHhcc
Q 033761           90 VFPGLKKPQDRADLIAYLKQST  111 (112)
Q Consensus        90 ~~~~~ls~~e~~~l~ayl~~l~  111 (112)
                      |....|+++|..+|..||..+.
T Consensus        41 ~~~RKLt~eEr~aIe~YL~~~~   62 (705)
T PF07095_consen   41 PTHRKLTAEERQAIEQYLNQLN   62 (705)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhh
Confidence            3445789999999999998543


No 120
>CHL00137 rps13 ribosomal protein S13; Validated
Probab=29.10  E-value=64  Score=20.03  Aligned_cols=15  Identities=7%  Similarity=-0.015  Sum_probs=13.6

Q ss_pred             CCCHHHHHHHHHHHH
Q 033761           94 LKKPQDRADLIAYLK  108 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~  108 (112)
                      .||++|+..|..+|.
T Consensus        47 ~Lt~~qi~~l~~~i~   61 (122)
T CHL00137         47 DLTDEQISALREIIE   61 (122)
T ss_pred             cCCHHHHHHHHHHHH
Confidence            579999999999996


No 121
>CHL00136 rpl31 ribosomal protein L31; Validated
Probab=29.07  E-value=24  Score=19.58  Aligned_cols=9  Identities=11%  Similarity=0.054  Sum_probs=7.0

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ..|+.||-.
T Consensus        36 dv~s~~HPf   44 (68)
T CHL00136         36 DIWSGNHPF   44 (68)
T ss_pred             EeCCCCCcc
Confidence            469999963


No 122
>PF08263 LRRNT_2:  Leucine rich repeat N-terminal domain;  InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [, ].Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response []. Sequence analyses of LRR proteins suggested the existence of several different subfamilies of LRRs. The significance of this classification is that repeats from different subfamilies never occur simultaneously and have most probably evolved independently. It is, however, now clear that all major classes of LRR have curved horseshoe structures with a parallel beta sheet on the concave side and mostly helical elements on the convex side. At least six families of LRR proteins, characterised by different lengths and consensus sequences of the repeats, have been identified. Eleven-residue segments of the LRRs (LxxLxLxxN/CxL), corresponding to the beta-strand and adjacent loop regions, are conserved in LRR proteins, whereas the remaining parts of the repeats (herein termed variable) may be very different. Despite the differences, each of the variable parts contains two half-turns at both ends and a "linear" segment (as the chain follows a linear path overall), usually formed by a helix, in the middle. The concave face and the adjacent loops are the most common protein interaction surfaces on LRR proteins. 3D structure of some LRR proteins-ligand complexes show that the concave surface of LRR domain is ideal for interaction with alpha-helix, thus supporting earlier conclusions that the elongated and curved LRR structure provides an outstanding framework for achieving diverse protein-protein interactions []. Molecular modeling suggests that the conserved pattern LxxLxL, which is shorter than the previously proposed LxxLxLxxN/CxL is sufficient to impart the characteristic horseshoe curvature to proteins with 20- to 30-residue repeats [].  This domain is often found at the N terminus of tandem leucine rich repeats.; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1OGQ_A.
Probab=29.05  E-value=58  Score=15.73  Aligned_cols=15  Identities=40%  Similarity=0.550  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHhcc
Q 033761           97 PQDRADLIAYLKQST  111 (112)
Q Consensus        97 ~~e~~~l~ayl~~l~  111 (112)
                      ++|+++|.+|-++|.
T Consensus         2 ~~d~~aLl~~k~~l~   16 (43)
T PF08263_consen    2 NQDRQALLAFKKSLN   16 (43)
T ss_dssp             HHHHHHHHHHHHCTT
T ss_pred             cHHHHHHHHHHHhcc
Confidence            678999999887764


No 123
>TIGR03631 bact_S13 30S ribosomal protein S13. This model describes bacterial ribosomal protein S13, to the exclusion of the homologous archaeal S13P and eukaryotic ribosomal protein S18. This model identifies some (but not all) instances of chloroplast and mitochondrial S13, which is of bacterial type.
Probab=28.88  E-value=63  Score=19.72  Aligned_cols=16  Identities=0%  Similarity=-0.087  Sum_probs=13.9

Q ss_pred             CCCCHHHHHHHHHHHH
Q 033761           93 GLKKPQDRADLIAYLK  108 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~  108 (112)
                      +.|+++|+..|..+|.
T Consensus        44 ~~L~~~qi~~l~~~l~   59 (113)
T TIGR03631        44 KDLTEEELNAIREEIE   59 (113)
T ss_pred             ccCCHHHHHHHHHHHH
Confidence            3579999999999995


No 124
>TIGR02161 napC_nirT periplasmic nitrate (or nitrite) reductase c-type cytochrome, NapC/NirT family. Nearly every member of this subfamily is NapC, a predicted membrane-anchored four-heme c-type cytochrome that forms one component of the periplasmic nitrate reductase along with NapA, NapB, NapD, NapE, and NapF subunits. A single known exception at this time is NirT, which is instead a component of a nitrite reductase. This family excludes TorC subunits of trimethylamine N-oxide (TMAO) reductases.
Probab=28.27  E-value=28  Score=23.24  Aligned_cols=9  Identities=33%  Similarity=1.069  Sum_probs=7.6

Q ss_pred             cCCccccCc
Q 033761           22 KCAQCHTVE   30 (112)
Q Consensus        22 ~C~~CH~~~   30 (112)
                      .|..||.+.
T Consensus        77 ~C~dCH~ph   85 (185)
T TIGR02161        77 TCPDCHVPH   85 (185)
T ss_pred             cCcccCCCC
Confidence            599999875


No 125
>PF12123 Amidase02_C:  N-acetylmuramoyl-l-alanine amidase;  InterPro: IPR021976  This domain is found in bacteria and viruses. This domain is about 50 amino acids in length. This domain is classified with the enzyme classification code 3.5.1.28 from EC. This domain is the C-terminal of the enzyme which hydrolyses the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides. ; PDB: 2L48_B.
Probab=28.09  E-value=74  Score=16.16  Aligned_cols=17  Identities=12%  Similarity=0.192  Sum_probs=11.6

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      +.+|+.|++.+.+||..
T Consensus        22 ~~~s~~~L~k~~~wld~   38 (45)
T PF12123_consen   22 DPLSDAELDKFTAWLDE   38 (45)
T ss_dssp             ----HHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHh
Confidence            45789999999999864


No 126
>PRK11032 hypothetical protein; Provisional
Probab=27.99  E-value=62  Score=21.17  Aligned_cols=17  Identities=6%  Similarity=0.073  Sum_probs=14.4

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      +.||.+|++.|.+||+.
T Consensus        41 ~elT~dEl~lv~~ylkR   57 (160)
T PRK11032         41 GELTRDEVDLITRAVRR   57 (160)
T ss_pred             HhcCHHHHHHHHHHHHH
Confidence            35799999999999963


No 127
>PF07102 DUF1364:  Protein of unknown function (DUF1364);  InterPro: IPR010774 This entry is represented by Bacteriophage 82, YbcO. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several bacterial and phage proteins of around 95 residues in length. The function of this family is unknown.; PDB: 3G27_A.
Probab=27.98  E-value=11  Score=22.47  Aligned_cols=9  Identities=33%  Similarity=0.922  Sum_probs=6.0

Q ss_pred             cCCccccCc
Q 033761           22 KCAQCHTVE   30 (112)
Q Consensus        22 ~C~~CH~~~   30 (112)
                      .|+.||..=
T Consensus        53 aCs~CHd~i   61 (94)
T PF07102_consen   53 ACSACHDEI   61 (94)
T ss_dssp             E-HHHHHHH
T ss_pred             hHHHHHHHH
Confidence            499999743


No 128
>PRK00019 rpmE 50S ribosomal protein L31; Reviewed
Probab=27.85  E-value=26  Score=19.69  Aligned_cols=9  Identities=33%  Similarity=1.113  Sum_probs=7.0

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ..|+.||-.
T Consensus        36 di~s~~HPF   44 (72)
T PRK00019         36 DVCSKCHPF   44 (72)
T ss_pred             EeCCCCCCc
Confidence            469999963


No 129
>PRK11125 nrfA cytochrome c nitrite reductase subunit c552; Provisional
Probab=27.63  E-value=29  Score=26.76  Aligned_cols=10  Identities=40%  Similarity=1.042  Sum_probs=7.5

Q ss_pred             cCCccccCcC
Q 033761           22 KCAQCHTVEK   31 (112)
Q Consensus        22 ~C~~CH~~~~   31 (112)
                      .|+.||....
T Consensus       160 ~CadCHd~~~  169 (480)
T PRK11125        160 GCADCHDTAS  169 (480)
T ss_pred             ChhhcCCCcc
Confidence            3999998654


No 130
>PF03264 Cytochrom_NNT:  NapC/NirT cytochrome c family, N-terminal region;  InterPro: IPR005126 Within the NapC/NirT family of cytochrome c proteins, some members, such as NapC P33932 from SWISSPROT and NirT P24038 from SWISSPROT, bind four haem groups, while others, such as TorC P33226 from SWISSPROT, bind five haems. This family aligns the common N-terminal region that contains four haem-binding C-X(2)-CH motifs.; PDB: 2VR0_F 2J7A_C.
Probab=27.59  E-value=15  Score=23.84  Aligned_cols=18  Identities=33%  Similarity=0.625  Sum_probs=11.6

Q ss_pred             HHHHHHHHhc----CCccccCc
Q 033761           13 KAGEKIFKTK----CAQCHTVE   30 (112)
Q Consensus        13 ~~G~~lf~~~----C~~CH~~~   30 (112)
                      .+.+..+..+    |..||+..
T Consensus       113 ~~~~~~~~~~~~~~C~~CH~~~  134 (173)
T PF03264_consen  113 EDSWKRFKANDDSTCLNCHSDL  134 (173)
T ss_dssp             -HHHHHHHHH---HHHHHCHHH
T ss_pred             HHHHHHHHhhhcccCcccCCCc
Confidence            3455555544    99999854


No 131
>PF02335 Cytochrom_C552:  Cytochrome c552;  InterPro: IPR003321 The enzyme cytochrome c nitrite reductase (c552) catalyses the six-electron reduction of nitrite to ammonia as one of the key steps in the biological nitrogen cycle, where it participates in the anaerobic energy metabolism of dissimilatory nitrate ammonification. Cytochrome c nitrite reductase from Sulfurospirillum deleyianum is a functional dimer, with 10 close-packed haem groups of type c and an unusual lysine-coordinated high-spin haem at the active site [].; GO: 0006807 nitrogen compound metabolic process, 0055114 oxidation-reduction process; PDB: 1QDB_B 3TTB_B 3BNJ_A 3BNG_A 1FS8_A 2E80_A 3BNH_A 1FS7_A 2E81_A 3BNF_A ....
Probab=27.23  E-value=32  Score=26.16  Aligned_cols=9  Identities=33%  Similarity=1.187  Sum_probs=7.5

Q ss_pred             HhcCCcccc
Q 033761           20 KTKCAQCHT   28 (112)
Q Consensus        20 ~~~C~~CH~   28 (112)
                      ...|..||.
T Consensus       272 ~~sC~~CH~  280 (434)
T PF02335_consen  272 ENSCQTCHS  280 (434)
T ss_dssp             HHCTTTTST
T ss_pred             hhHHhhhcC
Confidence            357999997


No 132
>PRK10617 cytochrome c-type protein NapC; Provisional
Probab=27.17  E-value=30  Score=23.45  Aligned_cols=10  Identities=30%  Similarity=1.002  Sum_probs=8.0

Q ss_pred             cCCccccCcC
Q 033761           22 KCAQCHTVEK   31 (112)
Q Consensus        22 ~C~~CH~~~~   31 (112)
                      .|..||.+.+
T Consensus        86 ~C~DCH~Ph~   95 (200)
T PRK10617         86 TCPDCHVPHE   95 (200)
T ss_pred             cCcccCCCCc
Confidence            5999998753


No 133
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=27.15  E-value=28  Score=24.42  Aligned_cols=16  Identities=19%  Similarity=0.196  Sum_probs=11.7

Q ss_pred             CCHHHHHHHHHHHHhc
Q 033761           95 KKPQDRADLIAYLKQS  110 (112)
Q Consensus        95 ls~~e~~~l~ayl~~l  110 (112)
                      |+.+++..|...|+.+
T Consensus       203 LD~~~~~~l~~~L~~l  218 (261)
T cd03271         203 LHFHDVKKLLEVLQRL  218 (261)
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            5677888887777665


No 134
>KOG0262 consensus RNA polymerase I, large subunit [Transcription]
Probab=26.77  E-value=1.5e+02  Score=26.26  Aligned_cols=52  Identities=15%  Similarity=0.236  Sum_probs=36.8

Q ss_pred             chhhhcccccccHHHHHHHHhCCCCCCCCC--------CCCCCCCCCHHHHHHHHHHHHh
Q 033761           58 SAANKNMAVNWEEKTLYDYLLNPKKYIPGT--------KMVFPGLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        58 ~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~--------~m~~~~~ls~~e~~~l~ayl~~  109 (112)
                      .-+..+....||.+.|+..+.++....||.        .+....-++++++.+|+.=|.+
T Consensus       477 KLTyPepVt~~NV~elr~aViNGP~~hPGA~~iqd~dg~~t~l~~~~~~qR~alA~qLLt  536 (1640)
T KOG0262|consen  477 KLTYPEPVTPWNVNELRKAVINGPDVHPGATYIQDEDGTLTLLSPMTDEQREALANQLLT  536 (1640)
T ss_pred             hccCCCcCCcccHHHHHHHHhcCCCCCCCcceeecCCCceeecCCCCHHHHHHHHHHhhc
Confidence            333444556799999999998887666552        3333334689999999988876


No 135
>PF13099 DUF3944:  Domain of unknown function (DUF3944)
Probab=26.77  E-value=30  Score=16.66  Aligned_cols=15  Identities=27%  Similarity=0.275  Sum_probs=12.4

Q ss_pred             CCCHHHHHHHHHHHH
Q 033761           94 LKKPQDRADLIAYLK  108 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~  108 (112)
                      ..|.+|+.+|+.+|-
T Consensus        12 ~cs~edL~~L~~~Lt   26 (35)
T PF13099_consen   12 ECSNEDLKDLVDILT   26 (35)
T ss_pred             HCCHHHHHHHHHHHh
Confidence            468999999998874


No 136
>PRK05179 rpsM 30S ribosomal protein S13; Validated
Probab=26.58  E-value=71  Score=19.81  Aligned_cols=16  Identities=0%  Similarity=-0.035  Sum_probs=14.0

Q ss_pred             CCCHHHHHHHHHHHHh
Q 033761           94 LKKPQDRADLIAYLKQ  109 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~  109 (112)
                      .||++|+..|.++|..
T Consensus        47 ~L~~~qi~~l~~~i~~   62 (122)
T PRK05179         47 DLTDEELDKIREEIDK   62 (122)
T ss_pred             cCCHHHHHHHHHHHHh
Confidence            5799999999999963


No 137
>TIGR03629 arch_S13P archaeal ribosomal protein S13P. This model describes exclusively the archaeal ribosomal protein S13P. It excludes the homologous eukaryotic 40S ribosomal protein S18 and bacterial 30S ribosomal protein S13.
Probab=26.08  E-value=76  Score=20.33  Aligned_cols=16  Identities=6%  Similarity=0.065  Sum_probs=14.4

Q ss_pred             CCCHHHHHHHHHHHHh
Q 033761           94 LKKPQDRADLIAYLKQ  109 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~  109 (112)
                      .||++|+..|..||..
T Consensus        51 ~Lt~~qi~~l~~~i~~   66 (144)
T TIGR03629        51 YLDDEEIEKLEEAVEN   66 (144)
T ss_pred             cCCHHHHHHHHHHHHh
Confidence            5899999999999975


No 138
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245. This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.
Probab=25.52  E-value=1.4e+02  Score=20.02  Aligned_cols=18  Identities=28%  Similarity=0.290  Sum_probs=15.4

Q ss_pred             CCCHHHHHHHHHHHHhcc
Q 033761           94 LKKPQDRADLIAYLKQST  111 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~l~  111 (112)
                      ..+|.|+.+|..||..+.
T Consensus       162 ~~~D~eL~~L~~yL~~la  179 (195)
T TIGR02245       162 RGTDQELLKLTQYLKTIA  179 (195)
T ss_pred             CcccHHHHHHHHHHHHHh
Confidence            357899999999999875


No 139
>PF09630 DUF2024:  Domain of unknown function (DUF2024);  InterPro: IPR018592  This protein of 86 residues is expressed in bacteria. It consists of two alpha helices and four beta strands. Its function is unknown.; PDB: 2HFQ_A.
Probab=25.50  E-value=9.4  Score=22.04  Aligned_cols=13  Identities=23%  Similarity=0.759  Sum_probs=8.0

Q ss_pred             HHHHhcCCccccC
Q 033761           17 KIFKTKCAQCHTV   29 (112)
Q Consensus        17 ~lf~~~C~~CH~~   29 (112)
                      .|-...|.-||+.
T Consensus        49 ~vt~~eC~FCHse   61 (81)
T PF09630_consen   49 DVTQKECRFCHSE   61 (81)
T ss_dssp             ---TTTEEEEEEE
T ss_pred             ccccccCcccccc
Confidence            3434569999985


No 140
>PF05927 Penaeidin:  Penaeidin;  InterPro: IPR009226 This family consists of several isoforms of the penaeidin protein, which is specific to shrimps. Penaeidins, a unique family of antimicrobial peptides (AMPs) with both proline and cysteine-rich domains, were initially identified in the hemolymph of the Pacific white shrimp, Penaeus vannamei [].; GO: 0008061 chitin binding, 0005737 cytoplasm; PDB: 1UEO_A 1XV3_A.
Probab=25.20  E-value=36  Score=18.95  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=7.5

Q ss_pred             hcCCccccCc
Q 033761           21 TKCAQCHTVE   30 (112)
Q Consensus        21 ~~C~~CH~~~   30 (112)
                      ..|.+||.+.
T Consensus        44 ~~C~sC~~i~   53 (73)
T PF05927_consen   44 PVCNSCYRIS   53 (73)
T ss_dssp             SSTTTTTTS-
T ss_pred             cccccccccC
Confidence            4699999864


No 141
>PF12408 DUF3666:  Ribose-5-phosphate isomerase ;  InterPro: IPR022133  This domain family is found in bacteria, and is approximately 50 amino acids in length. The family is found in association with PF02502 from PFAM. There are two completely conserved residues (D and F) that may be functionally important. ; PDB: 3ONO_A 3C5Y_N 2PPW_A.
Probab=25.06  E-value=49  Score=17.11  Aligned_cols=12  Identities=25%  Similarity=0.559  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHhc
Q 033761           99 DRADLIAYLKQS  110 (112)
Q Consensus        99 e~~~l~ayl~~l  110 (112)
                      +-..|++||+++
T Consensus        37 qd~eI~~yvk~l   48 (48)
T PF12408_consen   37 QDEEIAAYVKEL   48 (48)
T ss_dssp             --HHHHHHHHCC
T ss_pred             CcHHHHHHHHcC
Confidence            345677777754


No 142
>PRK01397 50S ribosomal protein L31; Provisional
Probab=25.00  E-value=32  Score=19.69  Aligned_cols=9  Identities=11%  Similarity=-0.082  Sum_probs=7.1

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ..|+.||-.
T Consensus        35 di~s~~HPF   43 (78)
T PRK01397         35 DVDFRKHPA   43 (78)
T ss_pred             EeCCCCCCc
Confidence            469999953


No 143
>PF14053 DUF4248:  Domain of unknown function (DUF4248)
Probab=24.89  E-value=1.3e+02  Score=16.57  Aligned_cols=39  Identities=10%  Similarity=0.065  Sum_probs=23.7

Q ss_pred             HHHHHHHHhCCCCC----CCCCCCCCCCCCCHHHHHHHHHHHH
Q 033761           70 EKTLYDYLLNPKKY----IPGTKMVFPGLKKPQDRADLIAYLK  108 (112)
Q Consensus        70 ~~~l~~~l~~~~~~----~~~~~m~~~~~ls~~e~~~l~ayl~  108 (112)
                      ...|.+||+.-..-    ...+.-+....+|+.|+.-|+.||-
T Consensus        25 ~r~L~rwI~~~~~L~~~L~~~Gy~~~~r~~TP~QV~lIv~~LG   67 (69)
T PF14053_consen   25 VRKLRRWIRRNPELLEELEATGYHPRQRSFTPRQVRLIVRYLG   67 (69)
T ss_pred             HHHHHHHHHHCHHHHHHHHHcCCCCCCEecCHHHHHHHHHHcC
Confidence            44677777542210    0112234455689999999999984


No 144
>PLN03217 transcription factor ATBS1; Provisional
Probab=24.30  E-value=90  Score=18.27  Aligned_cols=17  Identities=29%  Similarity=0.204  Sum_probs=13.6

Q ss_pred             CCCHHHHHHHHHHHHhc
Q 033761           94 LKKPQDRADLIAYLKQS  110 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~l  110 (112)
                      ..||+||.+|+.=|+.|
T Consensus        16 risddqi~dLvsKLq~l   32 (93)
T PLN03217         16 RISEDQINDLIIKLQQL   32 (93)
T ss_pred             CCCHHHHHHHHHHHHHH
Confidence            46899999999887754


No 145
>PTZ00134 40S ribosomal protein S18; Provisional
Probab=24.01  E-value=79  Score=20.54  Aligned_cols=17  Identities=6%  Similarity=0.255  Sum_probs=14.7

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      +.||++|+..|..+|..
T Consensus        59 ~~Lt~~qi~~l~~~i~~   75 (154)
T PTZ00134         59 GELTAEEIEKIVEIIAN   75 (154)
T ss_pred             ccCCHHHHHHHHHHHhc
Confidence            35899999999999975


No 146
>PRK11702 hypothetical protein; Provisional
Probab=23.96  E-value=1e+02  Score=18.79  Aligned_cols=17  Identities=24%  Similarity=0.278  Sum_probs=14.6

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      +..|++++..|.+||..
T Consensus        75 gs~tEe~R~~V~~WL~~   91 (108)
T PRK11702         75 GKCTEEHRALVKKWLEG   91 (108)
T ss_pred             CCCCHHHHHHHHHHHHh
Confidence            45699999999999975


No 147
>PF04270 Strep_his_triad:  Streptococcal histidine triad protein ;  InterPro: IPR006270 This entry represents a repeated sequence region that includes a His-X-X-His-X-His (histidine triad) motif, which is found in family of Streptococcal proteins. Members of the family are suggested to cleave human complement component 3, and family member PhpA has been shown in vaccine studies to be a protective antigen in mice []. ; PDB: 2CS7_C.
Probab=23.85  E-value=94  Score=16.39  Aligned_cols=17  Identities=18%  Similarity=0.089  Sum_probs=12.9

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      ..||+.|+++.-+||..
T Consensus        36 ~dLs~~E~~aA~~~~~~   52 (53)
T PF04270_consen   36 SDLSASELKAAQAYLAG   52 (53)
T ss_dssp             GGS-HHHHHHHHHHHH-
T ss_pred             hhCCHHHHHHHHHHHhc
Confidence            35899999999999874


No 148
>COG3086 RseC Positive regulator of sigma E activity [Signal transduction mechanisms]
Probab=23.81  E-value=30  Score=22.35  Aligned_cols=22  Identities=14%  Similarity=0.359  Sum_probs=13.6

Q ss_pred             HHHHHHHHH----hcCCccccCcCCC
Q 033761           12 AKAGEKIFK----TKCAQCHTVEKGA   33 (112)
Q Consensus        12 ~~~G~~lf~----~~C~~CH~~~~~g   33 (112)
                      .++|+.+..    ..|.+||+-++=|
T Consensus        11 ~q~G~a~V~c~~~S~CgsC~a~~~CG   36 (150)
T COG3086          11 WQNGQAKVSCQRQSACGSCAARAGCG   36 (150)
T ss_pred             ccCCeEEEEeeccCccccchhhcccc
Confidence            445554442    3599999976533


No 149
>PF00432 Prenyltrans:  Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family.;  InterPro: IPR001330 The beta subunit of the farnesyltransferases is responsible for peptide binding. Squalene-hopene cyclase is a bacterial enzyme that catalyzes the cyclization of squalene into hopene, a key step in hopanoid (triterpenoid) metabolism []. Lanosterol synthase (5.4.99.7 from EC) (oxidosqualene-lanosterol cyclase) catalyzes the cyclization of (S)-2,3-epoxysqualene to lanosterol, the initial precursor of cholesterol, steroid hormones and vitamin D in vertebrates and of ergosterol in fungi []. Cycloartenol synthase () (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ....
Probab=23.75  E-value=86  Score=15.21  Aligned_cols=13  Identities=31%  Similarity=0.460  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHhcc
Q 033761           99 DRADLIAYLKQST  111 (112)
Q Consensus        99 e~~~l~ayl~~l~  111 (112)
                      +++.++.||++.+
T Consensus         2 d~~~~~~~l~~~Q   14 (44)
T PF00432_consen    2 DVEKLIRFLLSCQ   14 (44)
T ss_dssp             HHHHHHHHHHHTB
T ss_pred             CHHHHHHHHHHHC
Confidence            5678888887643


No 150
>PF02085 Cytochrom_CIII:  Class III cytochrome C family;  InterPro: IPR020942 Cytochromes c (cytC) can be defined as electron-transfer proteins having one or several haem c groups, bound to the protein by one or, more generally, two thioether bonds involving sulphydryl groups of cysteine residues. The fifth haem iron ligand is always provided by a histidine residue. CytC possess a wide range of properties and function in a large number of different redox processes []. Ambler [] recognised four classes of cytC. Class III comprises the low redox potential multiple haem cytochromes: cyt C7 (trihaem), C3 (tetrahaem), and high-molecular-weight cytC, HMC (hexadecahaem), with only 30-40 residues per haem group. The haem c groups, all bis-histidinyl coordinated, are structurally and functionally nonequivalent and present different redox potentials in the range 0 to -400 mV []. The 3D structures of a number of cyt C3 proteins have been determined. The proteins consist of 4-5 alpha-helices and 2 beta-strands wrapped around a compact core of four non-parallel haems, which present a relatively high degree of exposure to the solvent. The overall protein architecture, haem plane orientations and iron-iron distances are highly conserved [].; GO: 0009055 electron carrier activity, 0020037 heme binding; PDB: 1AQE_A 1CZJ_A 1H29_B 1GWS_A 2CVC_A 2KMY_A 1DUW_A 1UPD_A 1I77_A 1GMB_A ....
Probab=23.74  E-value=43  Score=19.59  Aligned_cols=9  Identities=33%  Similarity=1.021  Sum_probs=7.1

Q ss_pred             cCCccccCc
Q 033761           22 KCAQCHTVE   30 (112)
Q Consensus        22 ~C~~CH~~~   30 (112)
                      .|.+||...
T Consensus        49 ~C~~CH~~~   57 (102)
T PF02085_consen   49 SCMSCHDEN   57 (102)
T ss_dssp             SCTCSSSSS
T ss_pred             hHHHhcCcc
Confidence            599999764


No 151
>TIGR03823 FliZ flagellar regulatory protein FliZ. FliZ is involved in the regulation of flagellar assembly and possibly also the down-regulation of the motile phenotype. FliZ interacts with the flagellar translational activator FlhCD complex.
Probab=23.38  E-value=25  Score=22.92  Aligned_cols=10  Identities=40%  Similarity=1.115  Sum_probs=7.8

Q ss_pred             hcCCccccCc
Q 033761           21 TKCAQCHTVE   30 (112)
Q Consensus        21 ~~C~~CH~~~   30 (112)
                      .+|+.||..-
T Consensus        23 thCshC~K~L   32 (168)
T TIGR03823        23 THCSHCHKLL   32 (168)
T ss_pred             chhhhhcchh
Confidence            4799999743


No 152
>PF11310 DUF3113:  Protein of unknown function (DUF3113);  InterPro: IPR021461 This entry is represented by Bacteriophage 92, Orf93. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=23.29  E-value=71  Score=17.04  Aligned_cols=12  Identities=25%  Similarity=0.515  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHH
Q 033761           97 PQDRADLIAYLK  108 (112)
Q Consensus        97 ~~e~~~l~ayl~  108 (112)
                      |+|.+.|+.||-
T Consensus        28 D~eKe~LAdyLy   39 (60)
T PF11310_consen   28 DKEKEALADYLY   39 (60)
T ss_pred             hhHHHHHHHHHh
Confidence            889999999984


No 153
>PF01197 Ribosomal_L31:  Ribosomal protein L31;  InterPro: IPR002150 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L31 is one of the proteins from the large ribosomal subunit. L31 is a protein of 66 to 97 amino-acid residues which has only been found so far in bacteria and in some plant and algal chloroplasts.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3D5D_4 3PYO_1 3D5B_4 3PYV_1 3PYT_1 3MRZ_1 3MS1_1 3PYR_1 3F1F_4 3F1H_4 ....
Probab=23.27  E-value=38  Score=18.74  Aligned_cols=9  Identities=33%  Similarity=1.069  Sum_probs=7.0

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ..|+.||-.
T Consensus        37 di~s~~HPf   45 (69)
T PF01197_consen   37 DICSNCHPF   45 (69)
T ss_dssp             CSCSSSSCT
T ss_pred             eecCCCCEE
Confidence            469999963


No 154
>TIGR00105 L31 ribosomal protein L31. This family consists exclusively of bacterial (and organellar) 50S ribosomal protein L31. In some species, such as Bacillus subtilis, this protein exists in two forms (RpmE and YtiA), one of which (RpmE) contains a pair of motifs, CXC and CXXC, for binding zinc.
Probab=23.23  E-value=36  Score=18.83  Aligned_cols=9  Identities=33%  Similarity=1.099  Sum_probs=7.0

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ..|+.||-.
T Consensus        36 di~s~~HPf   44 (68)
T TIGR00105        36 DICSKCHPF   44 (68)
T ss_pred             EECCCCccc
Confidence            459999963


No 155
>cd08168 Cytochrom_C3 Heme-binding domain of the class III cytochrome C family and related proteins. This alignment models heme binding core motifs as encountered in the cytochrome C3 family and related proteins. Cytochrome C3 is a tetraheme protein found in sulfate-reducing bacteria which use either thiosulfate or sulfate as the ultimate electron acceptors. C3 is an integral part of a complex electron transfer chain. The model also contains triheme cytochromes C7 which function in electron transfer during Fe(III) respiration by Geobacter sulfurreducens (PpcA, PpcB, PpcC, PpcD, and PpcE) and four repeated core motifs as found in the 16-heme cytochrome C HmcA of Desulfovibrio vulgaris Hildenborough which plays a role in electron transfer through the membrane following periplasmic oxidation of hydrogen (resulting in sulfate reduction in the cytoplasm).
Probab=23.21  E-value=34  Score=19.26  Aligned_cols=9  Identities=56%  Similarity=1.424  Sum_probs=6.3

Q ss_pred             cCCccccCc
Q 033761           22 KCAQCHTVE   30 (112)
Q Consensus        22 ~C~~CH~~~   30 (112)
                      .|..||+..
T Consensus        35 ~C~~CH~~~   43 (85)
T cd08168          35 KCAECHSHD   43 (85)
T ss_pred             chhhcCCCC
Confidence            588888753


No 156
>COG0633 Fdx Ferredoxin [Energy production and conversion]
Probab=23.12  E-value=31  Score=20.46  Aligned_cols=8  Identities=25%  Similarity=0.916  Sum_probs=6.7

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      .|+.||..
T Consensus        44 ~C~TC~v~   51 (102)
T COG0633          44 ACGTCRVK   51 (102)
T ss_pred             ccCccEEE
Confidence            69999973


No 157
>PF13447 Multi-haem_cyto:  Seven times multi-haem cytochrome CxxCH; PDB: 1FGJ_B.
Probab=23.06  E-value=36  Score=24.09  Aligned_cols=13  Identities=38%  Similarity=0.874  Sum_probs=8.5

Q ss_pred             HHHHhcCCccccC
Q 033761           17 KIFKTKCAQCHTV   29 (112)
Q Consensus        17 ~lf~~~C~~CH~~   29 (112)
                      .-....|..||+.
T Consensus       210 ~~m~~vC~~CHS~  222 (267)
T PF13447_consen  210 DKMKKVCSQCHSP  222 (267)
T ss_dssp             HHHHHHHTTTS-H
T ss_pred             HHHHHhhhccCCH
Confidence            3445579999984


No 158
>PF06648 DUF1160:  Protein of unknown function (DUF1160);  InterPro: IPR010594 This entry is represented by Autographa californica nuclear polyhedrosis virus (AcMNPV), Orf75; it is a family of uncharacterised viral proteins.
Probab=23.06  E-value=63  Score=20.15  Aligned_cols=15  Identities=20%  Similarity=0.147  Sum_probs=13.3

Q ss_pred             CCCHHHHHHHHHHHH
Q 033761           94 LKKPQDRADLIAYLK  108 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~  108 (112)
                      .|+++|+.+|+.||-
T Consensus        98 ~l~dddi~~ls~FLV  112 (122)
T PF06648_consen   98 HLTDDDISYLSEFLV  112 (122)
T ss_pred             cCCcccHHHHHHHHH
Confidence            478999999999985


No 159
>PRK00528 rpmE 50S ribosomal protein L31; Reviewed
Probab=22.90  E-value=37  Score=18.97  Aligned_cols=9  Identities=11%  Similarity=-0.027  Sum_probs=7.1

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ..|..||-.
T Consensus        38 dv~s~~HPf   46 (71)
T PRK00528         38 DIDSGNHPA   46 (71)
T ss_pred             EECCCCCcc
Confidence            469999964


No 160
>PF12797 Fer4_2:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=22.78  E-value=34  Score=14.63  Aligned_cols=8  Identities=25%  Similarity=0.958  Sum_probs=5.9

Q ss_pred             hcCCcccc
Q 033761           21 TKCAQCHT   28 (112)
Q Consensus        21 ~~C~~CH~   28 (112)
                      ..|..|+.
T Consensus         8 ~rCiGC~~   15 (22)
T PF12797_consen    8 ERCIGCGA   15 (22)
T ss_pred             ccccCchh
Confidence            35888885


No 161
>PF14566 PTPlike_phytase:  Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B ....
Probab=22.75  E-value=81  Score=19.97  Aligned_cols=18  Identities=22%  Similarity=0.455  Sum_probs=13.8

Q ss_pred             CCHHHHHHHHHHHHhccC
Q 033761           95 KKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        95 ls~~e~~~l~ayl~~l~~  112 (112)
                      .+++++++++++++++++
T Consensus       106 P~~~~iD~fi~~v~~~p~  123 (149)
T PF14566_consen  106 PDPEDIDAFINFVKSLPK  123 (149)
T ss_dssp             --HHHHHHHHHHHHTS-T
T ss_pred             CCHHHHHHHHHHHHhCCC
Confidence            379999999999998753


No 162
>PF10180 DUF2373:  Uncharacterised conserved protein (DUF2373);  InterPro: IPR019327  This is a conserved family of proteins found from fungi to humans. The function is not known. 
Probab=22.66  E-value=1.2e+02  Score=16.59  Aligned_cols=17  Identities=24%  Similarity=0.172  Sum_probs=14.3

Q ss_pred             CCHHHHHHHHHHHHhcc
Q 033761           95 KKPQDRADLIAYLKQST  111 (112)
Q Consensus        95 ls~~e~~~l~ayl~~l~  111 (112)
                      ++++.-..+.+||..|+
T Consensus        34 IP~~~~~~ll~Yl~glk   50 (65)
T PF10180_consen   34 IPSEYFPILLEYLKGLK   50 (65)
T ss_pred             CCHHHHHHHHHHHHhCc
Confidence            46888889999999875


No 163
>COG3184 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.31  E-value=67  Score=21.45  Aligned_cols=17  Identities=6%  Similarity=0.167  Sum_probs=14.4

Q ss_pred             CCCCHHHHHHHHHHHHh
Q 033761           93 GLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~~  109 (112)
                      ...|++|+.+|.+|..|
T Consensus       106 ~~FT~eEl~ai~aFY~S  122 (183)
T COG3184         106 KIFTEEELNAITAFYGS  122 (183)
T ss_pred             HhcCHHHHHHHHHHHcC
Confidence            45689999999999865


No 164
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=22.25  E-value=34  Score=23.91  Aligned_cols=8  Identities=38%  Similarity=1.020  Sum_probs=6.6

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      .|++||-.
T Consensus       199 ~C~GC~m~  206 (239)
T COG1579         199 VCGGCHMK  206 (239)
T ss_pred             cccCCeee
Confidence            49999974


No 165
>PF10820 DUF2543:  Protein of unknown function (DUF2543);  InterPro: IPR020251 This entry contains proteins with no known function.
Probab=22.20  E-value=77  Score=17.83  Aligned_cols=16  Identities=19%  Similarity=0.304  Sum_probs=13.1

Q ss_pred             CCHHHHHHHHHHHHhc
Q 033761           95 KKPQDRADLIAYLKQS  110 (112)
Q Consensus        95 ls~~e~~~l~ayl~~l  110 (112)
                      .|+.|+..|+-|+.-|
T Consensus        24 Vse~erd~LAhYFQlL   39 (81)
T PF10820_consen   24 VSEAERDALAHYFQLL   39 (81)
T ss_pred             cchhhhhHHHHHHHHH
Confidence            4789999999998654


No 166
>PRK04053 rps13p 30S ribosomal protein S13P; Reviewed
Probab=22.09  E-value=1e+02  Score=19.90  Aligned_cols=16  Identities=13%  Similarity=0.200  Sum_probs=14.0

Q ss_pred             CCCCHHHHHHHHHHHH
Q 033761           93 GLKKPQDRADLIAYLK  108 (112)
Q Consensus        93 ~~ls~~e~~~l~ayl~  108 (112)
                      +.||++|+..|..||.
T Consensus        54 ~~Lt~~qi~~l~~~i~   69 (149)
T PRK04053         54 GYLSDEEIEKIEEALE   69 (149)
T ss_pred             CcCCHHHHHHHHHHHH
Confidence            3589999999999995


No 167
>PRK11582 flagella biosynthesis protein FliZ; Provisional
Probab=22.04  E-value=29  Score=22.69  Aligned_cols=10  Identities=40%  Similarity=0.979  Sum_probs=7.8

Q ss_pred             hcCCccccCc
Q 033761           21 TKCAQCHTVE   30 (112)
Q Consensus        21 ~~C~~CH~~~   30 (112)
                      .+|+.||..-
T Consensus        23 thCshC~K~L   32 (169)
T PRK11582         23 THCAHCRKLL   32 (169)
T ss_pred             cchhhhccch
Confidence            4799999743


No 168
>PRK01678 rpmE2 50S ribosomal protein L31 type B; Reviewed
Probab=21.80  E-value=39  Score=19.74  Aligned_cols=9  Identities=11%  Similarity=0.191  Sum_probs=7.1

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ..|+.||-.
T Consensus        49 di~S~~HPF   57 (87)
T PRK01678         49 EISSASHPF   57 (87)
T ss_pred             EeCCCCCCc
Confidence            469999963


No 169
>PF07637 PSD5:  Protein of unknown function (DUF1595);  InterPro: IPR013043  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013042 from INTERPRO.
Probab=21.70  E-value=1.4e+02  Score=16.02  Aligned_cols=19  Identities=11%  Similarity=0.139  Sum_probs=14.5

Q ss_pred             CCCCCCHHHHHHHHHHHHh
Q 033761           91 FPGLKKPQDRADLIAYLKQ  109 (112)
Q Consensus        91 ~~~~ls~~e~~~l~ayl~~  109 (112)
                      |..-++++|++.+++++..
T Consensus        15 fRRp~~~~e~~~~~~~~~~   33 (64)
T PF07637_consen   15 FRRPLTDEEVDRYLALYDS   33 (64)
T ss_pred             hCCCCCHHHHHHHHHHHHH
Confidence            4555789999998888754


No 170
>PF09601 DUF2459:  Protein of unknown function (DUF2459);  InterPro: IPR011727 This conserved hypothetical protein of unknown function is predominantly found in proteobacteria. Its function is unknown and its genome context is not well-conserved. It is found amid urease genes in at least one species.
Probab=21.67  E-value=93  Score=20.47  Aligned_cols=15  Identities=13%  Similarity=0.344  Sum_probs=13.6

Q ss_pred             CCHHHHHHHHHHHHh
Q 033761           95 KKPQDRADLIAYLKQ  109 (112)
Q Consensus        95 ls~~e~~~l~ayl~~  109 (112)
                      +|++|.+.|++||+.
T Consensus        98 ls~~~y~~L~~~I~~  112 (173)
T PF09601_consen   98 LSEAQYRRLVAFIRA  112 (173)
T ss_pred             cCHHHHHHHHHHHHH
Confidence            699999999999974


No 171
>PF13709 DUF4159:  Domain of unknown function (DUF4159)
Probab=21.44  E-value=88  Score=21.12  Aligned_cols=16  Identities=25%  Similarity=0.341  Sum_probs=14.0

Q ss_pred             CCCHHHHHHHHHHHHh
Q 033761           94 LKKPQDRADLIAYLKQ  109 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~  109 (112)
                      .+|++|++.|-+||+.
T Consensus        66 ~~s~~e~~~Lr~Yl~~   81 (207)
T PF13709_consen   66 PLSDEEIANLRRYLEN   81 (207)
T ss_pred             CCCHHHHHHHHHHHHc
Confidence            4799999999999963


No 172
>PF04369 Lactococcin:  Lactococcin-like family;  InterPro: IPR007464 Bacteriocins are produced by bacteria to inhibit the growth of similar or closely related bacterial strains. The class II bacteriocins are small heat-stable proteins for which disulphide bonds are the only modification to the peptide. Lactococcin A and B are class-IId bacteriocins (one-peptide non-pediocin-like bacteriocin) [, ].; GO: 0042742 defense response to bacterium, 0005576 extracellular region
Probab=21.43  E-value=53  Score=17.82  Aligned_cols=12  Identities=0%  Similarity=0.122  Sum_probs=9.4

Q ss_pred             CCCCHHHHHHHH
Q 033761           93 GLKKPQDRADLI  104 (112)
Q Consensus        93 ~~ls~~e~~~l~  104 (112)
                      .++||+|+..|.
T Consensus         8 ~~~sdeeL~~i~   19 (60)
T PF04369_consen    8 NILSDEELSKIN   19 (60)
T ss_pred             eecCHHHHhhcc
Confidence            367999998874


No 173
>cd07347 harmonin_N_like N-terminal protein-binding module of harmonin and similar domains. This domain is found in harmonin, and similar proteins such as delphilin, and whirlin. These are postsynaptic density-95/discs-large/ZO-1 (PDZ) domain-containing scaffold proteins. Harmonin and whirlin are organizers of the Usher protein network of the inner ear and the retina, delphilin is found at the cerebellar parallel fiber-Purkinje cell synapses. This harmonin_N_like domain is found in either one or two copies. Harmonin contains a single copy, which is found at its N-terminus and binds specifically to a short internal peptide fragment of the cadherin 23 cytoplasmic domain; cadherin 23 is a component of the Usher protein network. Whirlin contains two copies of the harmonin_N_like domain; the first of these has been assayed for interaction with the cytoplasmic domain of cadherin 23 and no interaction could be detected.
Probab=21.37  E-value=1e+02  Score=17.63  Aligned_cols=17  Identities=18%  Similarity=0.249  Sum_probs=14.1

Q ss_pred             CCCHHHHHHHHHHHHhc
Q 033761           94 LKKPQDRADLIAYLKQS  110 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~l  110 (112)
                      +|++.|+..+..||+..
T Consensus        15 LL~~~Er~~~~~~L~~Y   31 (78)
T cd07347          15 LLTDAEREQVTRALERY   31 (78)
T ss_pred             HCCHHHHHHHHHHHHHH
Confidence            57899999999998753


No 174
>COG3183 Predicted restriction endonuclease [Defense mechanisms]
Probab=21.19  E-value=30  Score=24.50  Aligned_cols=8  Identities=38%  Similarity=1.232  Sum_probs=6.8

Q ss_pred             cCCccccC
Q 033761           22 KCAQCHTV   29 (112)
Q Consensus        22 ~C~~CH~~   29 (112)
                      .|..||..
T Consensus       243 lCpNCH~m  250 (272)
T COG3183         243 LCPNCHKM  250 (272)
T ss_pred             cCccHHHH
Confidence            59999974


No 175
>PF15332 LIME1:  Lck-interacting transmembrane adapter 1
Probab=21.14  E-value=38  Score=23.03  Aligned_cols=8  Identities=38%  Similarity=1.252  Sum_probs=6.6

Q ss_pred             CCccccCc
Q 033761           23 CAQCHTVE   30 (112)
Q Consensus        23 C~~CH~~~   30 (112)
                      |+.||-.+
T Consensus         2 CtaC~R~d    9 (228)
T PF15332_consen    2 CTACHRPD    9 (228)
T ss_pred             cccccCch
Confidence            99999854


No 176
>PF09256 BaffR-Tall_bind:  BAFF-R, TALL-1 binding;  InterPro: IPR015336 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  The domain represented by this entry is predominantly found in the tumour necrosis factor receptor superfamily member 13c, BAFF-R and is required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 1P0T_c 2HFG_R 1OSX_A 1OQE_N.
Probab=21.08  E-value=23  Score=16.49  Aligned_cols=9  Identities=22%  Similarity=0.896  Sum_probs=6.9

Q ss_pred             hcCCccccC
Q 033761           21 TKCAQCHTV   29 (112)
Q Consensus        21 ~~C~~CH~~   29 (112)
                      ++|++|+-.
T Consensus        15 R~CV~C~Ll   23 (31)
T PF09256_consen   15 RHCVACELL   23 (31)
T ss_dssp             TEEEEGGGS
T ss_pred             hcceeeeee
Confidence            479999754


No 177
>PF02831 gpW:  gpW;  InterPro: IPR004174 GpW is a 68 residue protein known to be present in phage particles. Extracts of phage-infected cells lacking GpW contain DNA-filled heads, and active tails, but no infectious virions. GpW is required for the addition of GpFII to the head, which is, in turn, required for the attachment of tails. Since GpFII and tails are known to be attached at the connector, GpW is also likely to assemble at this site. The addition of GpW to filled heads increases the DNase resistance of the packaged DNA, suggesting that GpW either forms a plug at the connector to prevent ejection of the DNA, or binds directly to the DNA. The large number of positively charged residues in GpW (its calculated pI is 10.8) is consistent with a role in DNA interaction [].; GO: 0019067 viral assembly, maturation, egress, and release; PDB: 2L6Q_A 2L6R_A 1HYW_A.
Probab=20.99  E-value=46  Score=18.50  Aligned_cols=16  Identities=31%  Similarity=0.445  Sum_probs=12.6

Q ss_pred             CHHHHHHHHHHHHhcc
Q 033761           96 KPQDRADLIAYLKQST  111 (112)
Q Consensus        96 s~~e~~~l~ayl~~l~  111 (112)
                      +..++.+|.+|++.|.
T Consensus        36 t~a~i~~L~~yI~~L~   51 (68)
T PF02831_consen   36 TQANIGDLRAYIQQLE   51 (68)
T ss_dssp             EGGGHHHHHHHHHHHH
T ss_pred             ecCCHHHHHHHHHHHH
Confidence            5778888888888764


No 178
>PF06207 DUF1002:  Protein of unknown function (DUF1002);  InterPro: IPR009343 This protein family has no known function. Its members are about 300 amino acids in length. It has so far been detected in Firmicute bacteria and some archaebacteria.
Probab=20.95  E-value=95  Score=21.45  Aligned_cols=17  Identities=6%  Similarity=0.188  Sum_probs=14.6

Q ss_pred             CCHHHHHHHHHHHHhcc
Q 033761           95 KKPQDRADLIAYLKQST  111 (112)
Q Consensus        95 ls~~e~~~l~ayl~~l~  111 (112)
                      ||++++..|+.++..++
T Consensus       192 ls~~q~~~i~~l~~~~~  208 (225)
T PF06207_consen  192 LSDEQIQQIVNLMKKIQ  208 (225)
T ss_pred             CCHHHHHHHHHHHHHHH
Confidence            79999999999997664


No 179
>PF11116 DUF2624:  Protein of unknown function (DUF2624);  InterPro: IPR020277 This entry contains proteins with no known function.
Probab=20.92  E-value=99  Score=18.02  Aligned_cols=16  Identities=6%  Similarity=0.146  Sum_probs=14.0

Q ss_pred             CCHHHHHHHHHHHHhc
Q 033761           95 KKPQDRADLIAYLKQS  110 (112)
Q Consensus        95 ls~~e~~~l~ayl~~l  110 (112)
                      +|+++.+.|+.||+.-
T Consensus        31 it~~QA~~I~~~lr~k   46 (85)
T PF11116_consen   31 ITKKQAEQIANILRGK   46 (85)
T ss_pred             CCHHHHHHHHHHHhcC
Confidence            6899999999999863


No 180
>TIGR03507 decahem_SO1788 decaheme c-type cytochrome, OmcA/MtrC family. The protein SO_1778 (MtrC) of Shewanella oneidensis MR-1, and its paralog SO_1779 (OmcA), with which it intteracts, are large decaheme proteins, about 900 amino acids in length, involved in the use of manganese [Mn(III/IV)] and iron [Fe(III)] as terminal electron acceptors. This model represents these and similar decaheme proteins, found also in Rhodoferax ferrireducens DSM 15236, Aeromonas hydrophila ATCC7966, and a few other bacterial species.
Probab=20.68  E-value=39  Score=27.13  Aligned_cols=10  Identities=50%  Similarity=1.165  Sum_probs=7.7

Q ss_pred             hcCCccccCc
Q 033761           21 TKCAQCHTVE   30 (112)
Q Consensus        21 ~~C~~CH~~~   30 (112)
                      ..|++||+..
T Consensus       294 ~~C~~CH~~~  303 (664)
T TIGR03507       294 TQCAACHNAG  303 (664)
T ss_pred             CchhhccCCC
Confidence            4699999754


No 181
>COG4840 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.50  E-value=1.4e+02  Score=16.59  Aligned_cols=19  Identities=11%  Similarity=0.052  Sum_probs=15.3

Q ss_pred             CCCHHHHHHHHHHHHhccC
Q 033761           94 LKKPQDRADLIAYLKQSTA  112 (112)
Q Consensus        94 ~ls~~e~~~l~ayl~~l~~  112 (112)
                      .+|+.|+.+|+.=|.+|-|
T Consensus        53 nfSpsEmqaiA~eL~rlRk   71 (71)
T COG4840          53 NFSPSEMQAIADELGRLRK   71 (71)
T ss_pred             cCCHHHHHHHHHHHHHhhC
Confidence            3689999999998887754


Done!