Query         033772
Match_columns 112
No_of_seqs    163 out of 549
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 06:07:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033772.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033772hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4600 Mitochondrial ribosoma 100.0 8.3E-36 1.8E-40  224.6   6.0   84   14-112     2-89  (144)
  2 COG0211 RpmA Ribosomal protein 100.0 2.6E-34 5.5E-39  202.0   4.7   58   55-112     1-62  (87)
  3 PRK05435 rpmA 50S ribosomal pr 100.0 9.4E-34   2E-38  197.3   5.6   58   55-112     1-62  (82)
  4 CHL00121 rpl27 ribosomal prote 100.0 8.6E-34 1.9E-38  198.9   5.0   58   55-112     1-62  (86)
  5 TIGR00062 L27 ribosomal protei 100.0 1.3E-33 2.7E-38  196.9   5.0   58   55-112     1-62  (83)
  6 PF01016 Ribosomal_L27:  Riboso 100.0   5E-33 1.1E-37  192.8   4.9   57   56-112     1-61  (81)
  7 PF14382 ECR1_N:  Exosome compl  80.8     2.3 4.9E-05   25.7   2.9   28   84-112     1-30  (39)
  8 PF13533 Biotin_lipoyl_2:  Biot  78.8     1.9 4.1E-05   26.4   2.1   19   76-94     15-33  (50)
  9 COG4015 Predicted dinucleotide  45.1       6 0.00013   32.1  -0.4   25   77-101    48-73  (217)
 10 PF02749 QRPTase_N:  Quinolinat  39.0      20 0.00044   23.9   1.5   21   77-97     49-69  (88)
 11 PF00529 HlyD:  HlyD family sec  36.7      23  0.0005   26.8   1.6   17   77-93     15-31  (305)
 12 TIGR02971 heterocyst_DevB ABC   28.8      42 0.00091   26.4   2.0   23   72-94     25-47  (327)
 13 cd06850 biotinyl_domain The bi  26.2      67  0.0015   18.7   2.1   17   77-93     13-29  (67)
 14 PF00364 Biotin_lipoyl:  Biotin  22.7      56  0.0012   20.9   1.4   17   77-93     20-36  (74)
 15 COG0157 NadC Nicotinate-nucleo  22.6      64  0.0014   27.2   2.0   21   77-97     68-88  (280)
 16 PF07831 PYNP_C:  Pyrimidine nu  21.7      63  0.0014   21.5   1.5   28   67-94     24-53  (75)
 17 TIGR01000 bacteriocin_acc bact  21.7      64  0.0014   27.3   1.9   20   75-94     71-90  (457)
 18 COG1566 EmrA Multidrug resista  20.3      75  0.0016   27.1   2.1   17   77-93     67-83  (352)
 19 PRK08225 acetyl-CoA carboxylas  20.1      99  0.0021   19.2   2.1   17   77-93     52-68  (70)

No 1  
>KOG4600 consensus Mitochondrial ribosomal protein MRP7 (L2) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=8.3e-36  Score=224.57  Aligned_cols=84  Identities=51%  Similarity=0.699  Sum_probs=74.8

Q ss_pred             eeeeeeccCcccceecCCcccccCcceecCCCCCCcceeEEeeeccCCcccCCCCCCCCcccceEeeCCeEeecCcEEEe
Q 033772           14 FKGLSLSSSSSSSFLKGDFTVCPKSVTVSLPPTSPLPLTIESAHKKGAGSTKNGRDSRGQRLGVKIFGDQVAKPGAIIVR   93 (112)
Q Consensus        14 f~glsl~s~~sssf~~g~~~~~~~~~~~~~p~~~~~~~~ir~A~KK~gGStkNgrdS~~KrLGvK~~~Gq~V~~G~IIvR   93 (112)
                      |+.|.|++  +|+++.|+.+.+             ..++||+|+||++|||||+|||+|||||||+|+||+|+|||||+|
T Consensus         2 ~~~l~l~t--as~~~~~~ss~~-------------~~l~vR~AtKk~aGStKN~~dS~grrlGvKk~egq~V~~G~IIvr   66 (144)
T KOG4600|consen    2 VNALRLST--ASSSLDGSSSGL-------------SFLAVRWATKKGAGSTKNGRDSAGRRLGVKKYEGQSVIPGNIIVR   66 (144)
T ss_pred             ccceecch--hhhhhcCCCCcc-------------eeeeeeeecccccCccccCCCCCcccccceecCCeeeecccEEEE
Confidence            57788877  555666665322             467899999999999999999999999999999999999999999


Q ss_pred             ecCCC---CCceeecccc-eeeC
Q 033772           94 QRGTK---GKMWGLARTI-QYSL  112 (112)
Q Consensus        94 QRGtk---G~nVg~GrD~-lfAl  112 (112)
                      |||||   |+|||||||| ||||
T Consensus        67 QRgtkfHPG~nVGiGKDhtifaL   89 (144)
T KOG4600|consen   67 QRGTKFHPGDNVGIGKDHTIFAL   89 (144)
T ss_pred             ecccccCCCcccccCCcceEEEe
Confidence            99999   9999999999 9997


No 2  
>COG0211 RpmA Ribosomal protein L27 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=2.6e-34  Score=201.99  Aligned_cols=58  Identities=60%  Similarity=0.898  Sum_probs=57.3

Q ss_pred             eeeccCCcccCCCCCCCCcccceEeeCCeEeecCcEEEeecCCC---CCceeecccc-eeeC
Q 033772           55 SAHKKGAGSTKNGRDSRGQRLGVKIFGDQVAKPGAIIVRQRGTK---GKMWGLARTI-QYSL  112 (112)
Q Consensus        55 ~A~KK~gGStkNgrdS~~KrLGvK~~~Gq~V~~G~IIvRQRGtk---G~nVg~GrD~-lfAl  112 (112)
                      |||||++|||+|||||++||||+|++|||+|.+|+||||||||+   |+|||+|+|| ||||
T Consensus         1 mA~KKg~GSt~NgRDS~~krLGvK~~~Gq~v~aG~IivRQRGTk~hpG~NVG~GkDhTlFAl   62 (87)
T COG0211           1 MAHKKGGGSTRNGRDSESKRLGVKKFGGQFVKAGSIIVRQRGTKFHPGVNVGRGKDHTLFAL   62 (87)
T ss_pred             CcccccccccccCccccccccceeeeCCeEEecccEEEEeccccccCCcccccCCCceEEEe
Confidence            79999999999999999999999999999999999999999999   9999999999 9996


No 3  
>PRK05435 rpmA 50S ribosomal protein L27; Validated
Probab=100.00  E-value=9.4e-34  Score=197.25  Aligned_cols=58  Identities=60%  Similarity=0.888  Sum_probs=57.2

Q ss_pred             eeeccCCcccCCCCCCCCcccceEeeCCeEeecCcEEEeecCCC---CCceeecccc-eeeC
Q 033772           55 SAHKKGAGSTKNGRDSRGQRLGVKIFGDQVAKPGAIIVRQRGTK---GKMWGLARTI-QYSL  112 (112)
Q Consensus        55 ~A~KK~gGStkNgrdS~~KrLGvK~~~Gq~V~~G~IIvRQRGtk---G~nVg~GrD~-lfAl  112 (112)
                      |||||++|||+|||||+|||||||+++||+|.||+||||||||+   |+||+||||| |||+
T Consensus         1 mA~KK~~GStkNgrdS~~krLGvK~~~g~~V~~G~IivRQRGtk~~PG~nVg~GrD~TlfA~   62 (82)
T PRK05435          1 MAHKKGGGSTRNGRDSESKRLGVKRFGGQFVKAGNIIVRQRGTKFHPGVNVGRGKDHTLFAL   62 (82)
T ss_pred             CCcccccCcCCCCCCCCcccceeEecCCEEEcCCcEEEEeCCCeECCCCCEeecCCceEEEe
Confidence            79999999999999999999999999999999999999999999   9999999999 9996


No 4  
>CHL00121 rpl27 ribosomal protein L27; Reviewed
Probab=100.00  E-value=8.6e-34  Score=198.91  Aligned_cols=58  Identities=59%  Similarity=0.895  Sum_probs=57.3

Q ss_pred             eeeccCCcccCCCCCCCCcccceEeeCCeEeecCcEEEeecCCC---CCceeecccc-eeeC
Q 033772           55 SAHKKGAGSTKNGRDSRGQRLGVKIFGDQVAKPGAIIVRQRGTK---GKMWGLARTI-QYSL  112 (112)
Q Consensus        55 ~A~KK~gGStkNgrdS~~KrLGvK~~~Gq~V~~G~IIvRQRGtk---G~nVg~GrD~-lfAl  112 (112)
                      |||||++|||+|||||+|||||||+++||+|.||+||||||||+   |+|||||||| |||+
T Consensus         1 mA~KK~~GStkNgrdS~~KrLGvK~~~gq~V~~G~IivRQRGtk~hPG~NVg~GrD~TlfAl   62 (86)
T CHL00121          1 MAHKKGAGSTKNGRDSNAKRLGVKRFGGEKVSAGNILIRQRGTKFKPGLNVGCGKDFTLYAL   62 (86)
T ss_pred             CCcccccCcCCCCCCCCcccceeEEcCCEEEcCCcEEEEcCCCeECCCCcccccCCceEEEc
Confidence            79999999999999999999999999999999999999999999   9999999999 9996


No 5  
>TIGR00062 L27 ribosomal protein L27. Eubacterial, chloroplast, and mitochondrial. Mitochondrial members have an additional C-terminal domain.
Probab=100.00  E-value=1.3e-33  Score=196.93  Aligned_cols=58  Identities=57%  Similarity=0.848  Sum_probs=57.2

Q ss_pred             eeeccCCcccCCCCCCCCcccceEeeCCeEeecCcEEEeecCCC---CCceeecccc-eeeC
Q 033772           55 SAHKKGAGSTKNGRDSRGQRLGVKIFGDQVAKPGAIIVRQRGTK---GKMWGLARTI-QYSL  112 (112)
Q Consensus        55 ~A~KK~gGStkNgrdS~~KrLGvK~~~Gq~V~~G~IIvRQRGtk---G~nVg~GrD~-lfAl  112 (112)
                      |||||++|||+|||||+|||||||+++||+|.||+||||||||+   |+||+||||| |||+
T Consensus         1 ~A~Kk~~GSt~NgrdS~~krLGvK~~~gq~V~~G~IivRQRGtk~hPG~nVg~GrD~TlfAl   62 (83)
T TIGR00062         1 MATKKGVGSTKNGRDSEAKRLGVKRAGGQFVRAGSIIVRQRGTKFHPGNNVGMGKDHTLFAL   62 (83)
T ss_pred             CCcccccCcCCCCCCCCCccceeEecCCEEEcCCcEEEEcCCceECCCCcccccCCCeEEEe
Confidence            79999999999999999999999999999999999999999999   9999999999 9996


No 6  
>PF01016 Ribosomal_L27:  Ribosomal L27 protein;  InterPro: IPR001684 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. L27 is a protein from the large (50S) subunit; it is essential for ribosome function, but its exact role is unclear. It belongs to a family of ribosomal proteins, examples of which are found in bacteria, chloroplasts of plants and red algae and the mitochondria of fungi (e.g. MRP7 from yeast mitochondria). The schematic relationship between these groups of proteins is shown below.  Bacterial L27 Nxxxxxxxxx Algal L27 Nxxxxxxxxx Plant L27 tttttNxxxxxxxxxxxxx Yeast MRP7 tttNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 't': transit peptide. 'N': N-terminal of mature protein.  ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2ZJQ_T 2ZJP_T 3PIP_T 3DLL_T 3PIO_T 1Y69_U 3CF5_T 2ZJR_T 1VSA_U 3PYT_W ....
Probab=99.97  E-value=5e-33  Score=192.85  Aligned_cols=57  Identities=65%  Similarity=0.962  Sum_probs=51.6

Q ss_pred             eeccCCcccCCCCCCCCcccceEeeCCeEeecCcEEEeecCCC---CCceeecccc-eeeC
Q 033772           56 AHKKGAGSTKNGRDSRGQRLGVKIFGDQVAKPGAIIVRQRGTK---GKMWGLARTI-QYSL  112 (112)
Q Consensus        56 A~KK~gGStkNgrdS~~KrLGvK~~~Gq~V~~G~IIvRQRGtk---G~nVg~GrD~-lfAl  112 (112)
                      ||||++|||+|||||+|||||||+++||+|.||+||||||||+   |+||+||||| |||+
T Consensus         1 A~KK~~GSt~NgrdS~~krlGvK~~~G~~V~~G~IivRQRgtk~hPG~NVg~GrD~TLfAl   61 (81)
T PF01016_consen    1 AHKKGGGSTKNGRDSNPKRLGVKKFGGQFVKAGNIIVRQRGTKFHPGENVGMGRDHTLFAL   61 (81)
T ss_dssp             --SSSSSSSS--S-STTTTSEESSSTTCEESSTSEEEEBSSSSSEEBTTEEEETTSEEEES
T ss_pred             CCccccccccCCCCCCCcccEEEEeCCEEEcCCCEEEEeCCCcCcCCCCEEECCCCcEEEe
Confidence            8999999999999999999999999999999999999999999   9999999999 9996


No 7  
>PF14382 ECR1_N:  Exosome complex exonuclease RRP4 N-terminal region; PDB: 2NN6_I 3M7N_C 2BA1_A 3M85_C.
Probab=80.84  E-value=2.3  Score=25.73  Aligned_cols=28  Identities=18%  Similarity=0.144  Sum_probs=20.6

Q ss_pred             EeecCcEEEeecCCC-CCceeecccc-eeeC
Q 033772           84 VAKPGAIIVRQRGTK-GKMWGLARTI-QYSL  112 (112)
Q Consensus        84 ~V~~G~IIvRQRGtk-G~nVg~GrD~-lfAl  112 (112)
                      .|.||+.|....... |+++.. +|. |||.
T Consensus         1 iV~PG~~l~~~~e~~~G~GTY~-~~g~I~as   30 (39)
T PF14382_consen    1 IVVPGDRLGSSEEYMPGHGTYV-RDGNIYAS   30 (39)
T ss_dssp             EE-TT-EEEETTTSEESTTEEE-ETTEEEES
T ss_pred             CCCCCCEeecCCCEecCCCEEE-eCCEEEEE
Confidence            488999999987666 999988 666 9873


No 8  
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=78.84  E-value=1.9  Score=26.36  Aligned_cols=19  Identities=21%  Similarity=0.267  Sum_probs=15.9

Q ss_pred             ceEeeCCeEeecCcEEEee
Q 033772           76 GVKIFGDQVAKPGAIIVRQ   94 (112)
Q Consensus        76 GvK~~~Gq~V~~G~IIvRQ   94 (112)
                      =+...+|++|++|++|++=
T Consensus        15 ~v~V~~G~~VkkGd~L~~l   33 (50)
T PF13533_consen   15 SVYVKEGQQVKKGDVLLVL   33 (50)
T ss_pred             EEEecCCCEEcCCCEEEEE
Confidence            3566799999999999973


No 9  
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only]
Probab=45.12  E-value=6  Score=32.15  Aligned_cols=25  Identities=32%  Similarity=0.542  Sum_probs=22.5

Q ss_pred             eEeeCCeEeecCcEEEeecCCC-CCc
Q 033772           77 VKIFGDQVAKPGAIIVRQRGTK-GKM  101 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvRQRGtk-G~n  101 (112)
                      +-.+|||.|.+.+||.|..|.+ |+|
T Consensus        48 i~v~Dgqrve~dDiihrr~Ga~~GEy   73 (217)
T COG4015          48 IYVFDGQRVEEDDIIHRRLGAKVGEY   73 (217)
T ss_pred             EEEecCcccCchhhHHHHhCCCcchh
Confidence            5679999999999999999999 775


No 10 
>PF02749 QRPTase_N:  Quinolinate phosphoribosyl transferase, N-terminal domain;  InterPro: IPR022412 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2.4.2.19 from EC is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes. It catalyses the reaction of quinolinic acid with 5-phosphoribosyl-1-pyrophosphate (PRPP) in the presence of Mg2+ to give rise to nicotinic acid mononucleotide (NaMN), pyrophosphate and carbon dioxide [, ]. Unlike IPR004393 from INTERPRO, this domain also includes the molybdenum transport system protein ModD.; GO: 0016763 transferase activity, transferring pentosyl groups; PDB: 3L0G_B 1QAP_A 3C2O_A 3C2F_A 3C2E_A 3C2R_A 3C2V_A 2I14_C 1X1O_B 2B7Q_B ....
Probab=38.98  E-value=20  Score=23.91  Aligned_cols=21  Identities=19%  Similarity=0.381  Sum_probs=15.5

Q ss_pred             eEeeCCeEeecCcEEEeecCC
Q 033772           77 VKIFGDQVAKPGAIIVRQRGT   97 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvRQRGt   97 (112)
                      +.+.||+.|.||++|++=+|.
T Consensus        49 ~~~~dG~~v~~g~~i~~i~G~   69 (88)
T PF02749_consen   49 WLVKDGDRVEPGDVILEIEGP   69 (88)
T ss_dssp             ESS-TT-EEETTCEEEEEEEE
T ss_pred             EEeCCCCCccCCcEEEEEEeC
Confidence            345799999999999987763


No 11 
>PF00529 HlyD:  HlyD family secretion protein the corresponding Prosite entry.;  InterPro: IPR006143 This entry represents a large family of polypeptides, the MFP (for membrane fusion protein) family. MFPs are a component of the of the RND family of transporters (RND refers to resistance, nodulation, and cell division). MFPs are proposed to span the periplasm in some way linking the inner and outer membranes []. However, some members of this family are found in Gram-positive bacteria, where there is no outer membrane. MFPs are involved in the export of a variety of compounds, from drug molecules to large polypeptides, and are united by their similar overall structural organisation, combined with some conserved regions [].  This family includes:   Haemolysin secretion protein D (HlyD) from Escherichia coli.  Lactococcin A secretion protein LcnD from Lactococcus lactis []. RTX-I toxin determinant D from Actinobacillus pleuropneumoniae.  Calmodulin-sensitive adenylate cyclase-haemolysin (cyclolysin) CyaD from Bordetella pertussis.  Colicin V secretion protein CvaA from E. coli []. Proteases secretion protein PrtE from Erwinia chrysanthemi [].  Alkaline protease secretion protein AprE from Pseudomonas aeruginosa []. Several multidrug resistance proteins [].  ; GO: 0055085 transmembrane transport, 0016020 membrane; PDB: 1T5E_E 1VF7_K 2V4D_I 4DK1_C 2F1M_B.
Probab=36.70  E-value=23  Score=26.76  Aligned_cols=17  Identities=24%  Similarity=0.405  Sum_probs=12.5

Q ss_pred             eEeeCCeEeecCcEEEe
Q 033772           77 VKIFGDQVAKPGAIIVR   93 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvR   93 (112)
                      +-+-+||+|++|++|++
T Consensus        15 i~V~eG~~VkkGq~L~~   31 (305)
T PF00529_consen   15 ILVKEGQRVKKGQVLAR   31 (305)
T ss_dssp             E-S-TTEEE-TTSECEE
T ss_pred             EEccCcCEEeCCCEEEE
Confidence            45678999999999997


No 12 
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. DevB from Anabaena sp. strain PCC 7120 is partially characterized as a membrane fusion protein of the DevBCA ABC exporter, probably a glycolipid exporter, required for heterocyst formation. Most Cyanobacteria have one member only, but Nostoc sp. PCC 7120 has seven members.
Probab=28.82  E-value=42  Score=26.38  Aligned_cols=23  Identities=4%  Similarity=0.115  Sum_probs=19.0

Q ss_pred             CcccceEeeCCeEeecCcEEEee
Q 033772           72 GQRLGVKIFGDQVAKPGAIIVRQ   94 (112)
Q Consensus        72 ~KrLGvK~~~Gq~V~~G~IIvRQ   94 (112)
                      |+=.-+.+.+|+.|++|++|++=
T Consensus        25 G~V~~i~V~eG~~V~~G~~L~~l   47 (327)
T TIGR02971        25 DRIKKLLVAEGDRVQAGQVLAEL   47 (327)
T ss_pred             cEEEEEEccCCCEecCCcEEEEe
Confidence            45556778899999999999983


No 13 
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase. This domain functions in transferring CO2 from one subsite to another, allowing carboxylation, decarboxylation, or transcarboxylation. During this process, biotin is covalently attached to a specific lysine.
Probab=26.19  E-value=67  Score=18.73  Aligned_cols=17  Identities=12%  Similarity=0.118  Sum_probs=13.7

Q ss_pred             eEeeCCeEeecCcEEEe
Q 033772           77 VKIFGDQVAKPGAIIVR   93 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvR   93 (112)
                      +..-.|++|.+|+.|++
T Consensus        13 ~~v~~G~~v~~g~~l~~   29 (67)
T cd06850          13 VLVKEGDKVEAGQPLAV   29 (67)
T ss_pred             EEeCCCCEECCCCEEEE
Confidence            56677888888888886


No 14 
>PF00364 Biotin_lipoyl:  Biotin-requiring enzyme;  InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid. Biotin plays a catalytic role in some carboxyl transfer reactions and is covalently attached, via an amide bond, to a lysine residue in enzymes requiring this coenzyme []. E2 acyltransferases have an essential cofactor, lipoic acid, which is covalently bound via an amide linkage to a lysine group []. The lipoic acid cofactor is found in a variety of proteins that include, H-protein of the glycine cleavage system (GCS), mammalian and yeast pyruvate dehydrogenases and fast migrating protein (FMP) (gene acoC) from Ralstonia eutropha (Alcaligenes eutrophus).; PDB: 2EJG_D 2D5D_A 2EJF_C 2EVB_A 1IYV_A 1IYU_A 1LAC_A 1LAB_A 1DCZ_A 1DD2_A ....
Probab=22.68  E-value=56  Score=20.94  Aligned_cols=17  Identities=12%  Similarity=0.055  Sum_probs=14.4

Q ss_pred             eEeeCCeEeecCcEEEe
Q 033772           77 VKIFGDQVAKPGAIIVR   93 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvR   93 (112)
                      |.+..|+.|.+|+.|+.
T Consensus        20 ~~v~~G~~V~~G~~l~~   36 (74)
T PF00364_consen   20 WLVEEGDKVKKGDPLAE   36 (74)
T ss_dssp             ESSSTTEEESTTSEEEE
T ss_pred             EEECCCCEEEcCceEEE
Confidence            77888999999998865


No 15 
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism]
Probab=22.64  E-value=64  Score=27.21  Aligned_cols=21  Identities=19%  Similarity=0.366  Sum_probs=18.3

Q ss_pred             eEeeCCeEeecCcEEEeecCC
Q 033772           77 VKIFGDQVAKPGAIIVRQRGT   97 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvRQRGt   97 (112)
                      +.+-||++|+||++|.+=+|.
T Consensus        68 ~~~~DG~~v~~g~~i~~~~G~   88 (280)
T COG0157          68 WLVKDGDRVKPGDVLAEIEGP   88 (280)
T ss_pred             EEcCCCCEeCCCCEEEEEecc
Confidence            467899999999999998775


No 16 
>PF07831 PYNP_C:  Pyrimidine nucleoside phosphorylase C-terminal domain;  InterPro: IPR013102 This domain is found at the C-terminal end of the large alpha/beta domain making up various pyrimidine nucleoside phosphorylases [, ]. It has slightly different conformations in different members of this family. For example, in pyrimidine nucleoside phosphorylase (PYNP, P77826 from SWISSPROT) there is an added three-stranded anti-parallel beta sheet as compared to other members of the family, such as Escherichia coli thymidine phosphorylase (TP, P07650 from SWISSPROT) []. The domain contains an alpha/ beta hammerhead fold and residues in this domain seem to be important in formation of the homodimer []. ; GO: 0016763 transferase activity, transferring pentosyl groups, 0006213 pyrimidine nucleoside metabolic process; PDB: 1AZY_A 1OTP_A 2TPT_A 3H5Q_A 1BRW_A 2WK5_C 2J0F_C 2WK6_B 1UOU_A 2DSJ_B ....
Probab=21.73  E-value=63  Score=21.49  Aligned_cols=28  Identities=11%  Similarity=0.115  Sum_probs=16.7

Q ss_pred             CCCCCCcccceE--eeCCeEeecCcEEEee
Q 033772           67 GRDSRGQRLGVK--IFGDQVAKPGAIIVRQ   94 (112)
Q Consensus        67 grdS~~KrLGvK--~~~Gq~V~~G~IIvRQ   94 (112)
                      ..|..-..-|+.  +--|++|.+|+.|++=
T Consensus        24 k~d~ID~~vGi~l~~k~Gd~V~~Gd~l~~i   53 (75)
T PF07831_consen   24 KEDPIDPAVGIELHKKVGDRVEKGDPLATI   53 (75)
T ss_dssp             TTS---TT-EEEESS-TTSEEBTTSEEEEE
T ss_pred             CCCccCcCcCeEecCcCcCEECCCCeEEEE
Confidence            335555556654  3459999999999873


No 17 
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein. This family represents an accessory protein that works with the bacteriocin maturation and ABC transport secretion protein described by TIGR01193.
Probab=21.73  E-value=64  Score=27.25  Aligned_cols=20  Identities=15%  Similarity=0.162  Sum_probs=17.0

Q ss_pred             cceEeeCCeEeecCcEEEee
Q 033772           75 LGVKIFGDQVAKPGAIIVRQ   94 (112)
Q Consensus        75 LGvK~~~Gq~V~~G~IIvRQ   94 (112)
                      .-+.+-+||.|++|++|++=
T Consensus        71 ~~i~V~eG~~V~~G~~L~~l   90 (457)
T TIGR01000        71 KENYLKENKFVKKGDLLVVY   90 (457)
T ss_pred             EEEEcCCCCEecCCCEEEEE
Confidence            34778899999999999973


No 18 
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms]
Probab=20.34  E-value=75  Score=27.11  Aligned_cols=17  Identities=29%  Similarity=0.599  Sum_probs=15.5

Q ss_pred             eEeeCCeEeecCcEEEe
Q 033772           77 VKIFGDQVAKPGAIIVR   93 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvR   93 (112)
                      |-.-++|+|++|++|+|
T Consensus        67 V~V~dnq~Vk~Gd~L~~   83 (352)
T COG1566          67 VNVKDNQLVKKGDVLFR   83 (352)
T ss_pred             EEecCCCEecCCCeEEE
Confidence            66789999999999998


No 19 
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=20.13  E-value=99  Score=19.24  Aligned_cols=17  Identities=6%  Similarity=0.384  Sum_probs=13.8

Q ss_pred             eEeeCCeEeecCcEEEe
Q 033772           77 VKIFGDQVAKPGAIIVR   93 (112)
Q Consensus        77 vK~~~Gq~V~~G~IIvR   93 (112)
                      +....||.|.+|+.|++
T Consensus        52 ~~~~~G~~V~~g~~l~~   68 (70)
T PRK08225         52 INVQEGDFVNEGDVLLE   68 (70)
T ss_pred             EEecCCCEECCCCEEEE
Confidence            45677899999999875


Done!