Citrus Sinensis ID: 033773


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MEGNSKTVPSIVVYVTVPNKEAGKKLAESIVKAKLAACVNRVPGIESVYEWKGEIQTDAEELLIIKTRQSLLETLTEHVKANHEYDVPEVIALPITGGSQPYLEWLKSSTRD
cccccccccEEEEEEEcccHHHHHHHHHHHHHccEEEEEEEccccEEEEEEccEEEEccEEEEEEEcHHHHHHHHHHHHHHHccccccCEEEEEcccccHHHHHHHHHHccc
*********SIVVYVTVPNKEAGKKLAESIVKAKLAACVNRVPGIESVYEWKGEIQTDAEELLIIKTRQSLLETLTEHVKANHEYDVPEVIALPITGGSQPYLEWLKSST**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGNSKTVPSIVVYVTVPNKEAGKKLAESIVKAKLAACVNRVPGIESVYEWKGEIQTDAEELLIIKTRQSLLETLTEHVKANHEYDVPEVIALPITGGSQPYLEWLKSSTRD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein CutA, chloroplastic Involved in metal homeostasis. Specifically binds Cu(2+). The truncated isoform has less specificity in metal binding.probableP93009
Protein CutA 1, chloroplastic probableQ109R6
Divalent-cation tolerance protein CutA Involved in resistance toward heavy metals.probableA8A7N3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZOM, chain A
Confidence level:very confident
Coverage over the Query: 5-111
View the alignment between query and template
View the model in PyMOL