BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033775
         (112 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2X3L|A Chain A, Crystal Structure Of The Orn_lys_arg Decarboxylase Family
           Protein Sar0482 From Methicillin-Resistant
           Staphylococcus Aureus
 pdb|2X3L|B Chain B, Crystal Structure Of The Orn_lys_arg Decarboxylase Family
           Protein Sar0482 From Methicillin-Resistant
           Staphylococcus Aureus
          Length = 446

 Score = 25.4 bits (54), Expect = 9.0,   Method: Composition-based stats.
 Identities = 11/42 (26%), Positives = 23/42 (54%)

Query: 42  LISGSMTGVMCVYSALCMRFAWMVQPRNLHLLACHASNESVQ 83
           L++G+ +G++ V  +   +   ++  RN+H    HA + S Q
Sbjct: 77  LVNGTTSGILSVIQSFSQKKGDILMARNVHKSVLHALDISQQ 118


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.134    0.462 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,094,374
Number of Sequences: 62578
Number of extensions: 107862
Number of successful extensions: 220
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 219
Number of HSP's gapped (non-prelim): 1
length of query: 112
length of database: 14,973,337
effective HSP length: 76
effective length of query: 36
effective length of database: 10,217,409
effective search space: 367826724
effective search space used: 367826724
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)