Citrus Sinensis ID: 033778


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MGIEKQILTPGNGPKPVAGQKVTVHCTGYGKNGDLSQKFWSTKDPGQQPFTFQIGKGSVIKGWDEGVMGMQVGEVARLRCSPDYAYGAGGFPQWGIQPNSVLDFEIQVLQVE
ccEEEEEEccccccccccccEEEEEEEEEEccccccccECcccccccccEEEEcccccCCccHHHHHcccccccEEEEEEcccccccccccccccccccccEEEEEEEEEEc
MGIEKQILTPGNGPKPVAGQKVTVHCTGYGKNGDLSQKFWSTKDPGQQPFTFQIGKGSVIKGWDEGVMGMQVGEVARLRCSPDYAYGAGGFPQWGIQPNSVLDFEIQVLQVE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIEKQILTPGNGPKPVAGQKVTVHCTGYGKNGDLSQKFWSTKDPGQQPFTFQIGKGSVIKGWDEGVMGMQVGEVARLRCSPDYAYGAGGFPQWGIQPNSVLDFEIQVLQVE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP12 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity). Mediates rapamycin inactivation of TOR protein kinase activity.confidentQ8LGG0
Peptidyl-prolyl cis-trans isomerase FKBP12 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableO04287
12 kDa FK506-binding protein PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Binds to ligand-free TGF beta type I receptor, from which it is released upon a ligand-induced, type II receptor mediated phosphorylation of the type I receptor. Binding is inhibitory to the signaling pathways of the TGF beta family ligands.probableP48375

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YAT, chain A
Confidence level:very confident
Coverage over the Query: 1-112
View the alignment between query and template
View the model in PyMOL