Query         033782
Match_columns 111
No_of_seqs    114 out of 144
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 06:13:47 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033782.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033782hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03031 hypothetical protein; 100.0 1.2E-51 2.6E-56  293.5   8.0  102    1-107     1-102 (102)
  2 TIGR03715 KxYKxGKxW KxYKxGKxW   64.8    0.52 1.1E-05   26.3  -2.5   12   16-27      9-20  (29)
  3 COG3761 NADH:ubiquinone oxidor  24.5      53  0.0012   24.2   1.7   19    9-27     26-48  (118)
  4 PF12221 HflK_N:  Bacterial mem  22.1      46   0.001   20.2   0.9   13   96-108    20-32  (42)
  5 PF10297 Hap4_Hap_bind:  Minima  22.0      33 0.00072   17.6   0.2    6   17-22      2-7   (17)
  6 PHA03417 E4 protein; Provision  21.6      86  0.0019   23.1   2.3   10   71-80     47-56  (118)
  7 PF02395 Peptidase_S6:  Immunog  20.6      50  0.0011   30.9   1.1   12   14-25    226-237 (769)
  8 COG1834 N-Dimethylarginine dim  19.0      77  0.0017   26.2   1.8   24   11-34    121-144 (267)
  9 PHA03416 hypothetical E4 prote  18.0 1.2E+02  0.0026   21.4   2.4   21   54-80     24-44  (92)
 10 PF14509 GH97_C:  Glycosyl-hydr  17.2      73  0.0016   22.3   1.1   11   16-26     25-35  (103)

No 1  
>PLN03031 hypothetical protein; Provisional
Probab=100.00  E-value=1.2e-51  Score=293.51  Aligned_cols=102  Identities=69%  Similarity=1.194  Sum_probs=94.2

Q ss_pred             CCCCCCCcccCcccCCCcceEEecccccCCCCceeeCCCCCcccccCCCCcccCCcCCCCCCCCCCCCCCCCCCCCCCCC
Q 033782            1 MGLSGKPQVDGGLESEGKRWVIAGIPLRAPLKPIYTNPVPTAVDKEVDSGTDEELSTTPTSEDARIPAKLTCPAAPRKRK   80 (111)
Q Consensus         1 mg~s~k~q~~~~~~~~~kkwviagi~l~a~LkPi~t~~~~~~~~~~~~~~e~~~C~TTPts~e~rIP~~~~CPPAPRK~r   80 (111)
                      ||||+|+||||+|||||||||||||+||||||||+|++...    +. ++|+++|.+|||+++||||..++|||||||++
T Consensus         1 mg~s~k~q~~~~~~~~~kkwviagi~~ra~LkPi~t~~~~~----~~-~ee~~~c~~TPts~~~rIP~~~~CPPAPrK~r   75 (102)
T PLN03031          1 MGFSKKSQVDGGLESDGKKWVIAGISIRAPLKPISTKPVAK----EE-DEEEDECSTTPTAKEARIPERLPCPPAPRKRK   75 (102)
T ss_pred             CCcCcccccccccccCCceEEEeccCcccccCceeccCCCc----cc-cccccccccCCCCccccCCCCCcCCCCCCCCC
Confidence            99999999999999999999999999999999999998873    22 67788995569999999999999999999999


Q ss_pred             CcccccCCCCccccCCCchhHHhhhhc
Q 033782           81 SSLKCNYSGVREFFSPPDLESVFIRHV  107 (111)
Q Consensus        81 ~~~~c~~~~~~~FF~~PDLe~~F~~~~  107 (111)
                      ++.+|++++.++||++||||+||+.|+
T Consensus        76 ~~~kc~~~p~~~FF~pPDLEsvFv~r~  102 (102)
T PLN03031         76 PSLKCNYNGVREFFTPPDLETVFIQRA  102 (102)
T ss_pred             ccccccCCCCCCccCCCChhheeEecC
Confidence            999998888999999999999998874


No 2  
>TIGR03715 KxYKxGKxW KxYKxGKxW signal peptide. This model describes a novel form of signal peptide that occurs as an N-terminal domain with a recognizable motif, reminiscent of the YSIRK and PEP-CTERM forms of signal peptide. This domain tends to occur on long, low-complexity (usually Serine-rich and heavily glycosylated) proteins of the Firmicutes, and (as with YSIRK) the majority of these proteins have the LPXTG cell wall-anchoring motif at the C-terminus.
Probab=64.77  E-value=0.52  Score=26.28  Aligned_cols=12  Identities=50%  Similarity=0.994  Sum_probs=9.7

Q ss_pred             CCcceEEecccc
Q 033782           16 EGKRWVIAGIPL   27 (111)
Q Consensus        16 ~~kkwviagi~l   27 (111)
                      .||.||+|+|..
T Consensus         9 sGK~Wv~a~~~~   20 (29)
T TIGR03715         9 SGKQWVFAAITT   20 (29)
T ss_pred             cccHHHHHHHHH
Confidence            489999999753


No 3  
>COG3761 NADH:ubiquinone oxidoreductase 17.2 kD subunit [Energy production and conversion]
Probab=24.53  E-value=53  Score=24.23  Aligned_cols=19  Identities=47%  Similarity=1.027  Sum_probs=13.8

Q ss_pred             ccC-cccCCC--cceEE-ecccc
Q 033782            9 VDG-GLESEG--KRWVI-AGIPL   27 (111)
Q Consensus         9 ~~~-~~~~~~--kkwvi-agi~l   27 (111)
                      .|| +.||+|  +.||| .|++=
T Consensus        26 ye~r~~ds~gr~RRwVIYngyaE   48 (118)
T COG3761          26 YEGRNIDSEGRTRRWVIYNGYAE   48 (118)
T ss_pred             eeccCCccCCCeeeEEEEcCcch
Confidence            366 889886  78999 45543


No 4  
>PF12221 HflK_N:  Bacterial membrane protein N terminal;  InterPro: IPR020980  HflK is a bacterial membrane protein which is thought, together with the HflC protein, to form a membrane protease complex whose activity is modulated by the GTPase HflX []. This entry represents the N-terminal, membrane-spanning, region of of HflK responsible for anchoring the protein in the bacterial membrane. It is often found in association with PF01145 from PFAM.
Probab=22.08  E-value=46  Score=20.25  Aligned_cols=13  Identities=38%  Similarity=0.902  Sum_probs=10.0

Q ss_pred             CCchhHHhhhhcc
Q 033782           96 PPDLESVFIRHVE  108 (111)
Q Consensus        96 ~PDLe~~F~~~~~  108 (111)
                      |||||.+|..-..
T Consensus        20 PPDLdel~r~l~~   32 (42)
T PF12221_consen   20 PPDLDELFRKLQD   32 (42)
T ss_pred             CCCHHHHHHHHHH
Confidence            7899999975443


No 5  
>PF10297 Hap4_Hap_bind:  Minimal binding motif of Hap4 for binding to Hap2/3/5   ;  InterPro: IPR018287 This entry represents an essential domain of the transcription activator Hap4 that allows it to associate with Hap2, Hap3 and Hap5 to form the Hap complex [, ]. In Saccharomyces cerevisiae (Baker's yeast), the haem-activated protein complex Hap2/3/4/5 plays a major role in the transcription of genes involved in respiration []. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=21.97  E-value=33  Score=17.56  Aligned_cols=6  Identities=50%  Similarity=1.348  Sum_probs=4.4

Q ss_pred             CcceEE
Q 033782           17 GKRWVI   22 (111)
Q Consensus        17 ~kkwvi   22 (111)
                      +|+|||
T Consensus         2 Sk~Wvl    7 (17)
T PF10297_consen    2 SKNWVL    7 (17)
T ss_pred             Cccccc
Confidence            477887


No 6  
>PHA03417 E4 protein; Provisional
Probab=21.59  E-value=86  Score=23.11  Aligned_cols=10  Identities=40%  Similarity=0.773  Sum_probs=8.1

Q ss_pred             CCCCCCCCCC
Q 033782           71 TCPAAPRKRK   80 (111)
Q Consensus        71 ~CPPAPRK~r   80 (111)
                      .||+||||.+
T Consensus        47 ~~p~ap~k~~   56 (118)
T PHA03417         47 LCPPAFQKNQ   56 (118)
T ss_pred             CCCCCCCCCC
Confidence            4999999864


No 7  
>PF02395 Peptidase_S6:  Immunoglobulin A1 protease Serine protease Prosite pattern;  InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to the MEROPS peptidase family S6 (clan PA(S)). The type sample being the IgA1-specific serine endopeptidase from Neisseria gonorrhoeae []. These cleave prolyl bonds in the hinge regions of immunoglobulin A heavy chains. Similar specificity is shown by the unrelated family of M26 metalloendopeptidases.; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis; PDB: 3SZE_A 3H09_B 3SYJ_A 1WXR_A 3AK5_B.
Probab=20.60  E-value=50  Score=30.94  Aligned_cols=12  Identities=42%  Similarity=1.149  Sum_probs=10.0

Q ss_pred             cCCCcceEEecc
Q 033782           14 ESEGKRWVIAGI   25 (111)
Q Consensus        14 ~~~~kkwviagi   25 (111)
                      |.+.|||||+|.
T Consensus       226 D~~~kKWvl~Gv  237 (769)
T PF02395_consen  226 DKEKKKWVLVGV  237 (769)
T ss_dssp             ETTTTEEEEEEE
T ss_pred             EccCCeEEEEEE
Confidence            456799999997


No 8  
>COG1834 N-Dimethylarginine dimethylaminohydrolase [Amino acid transport and metabolism]
Probab=18.95  E-value=77  Score=26.22  Aligned_cols=24  Identities=29%  Similarity=0.430  Sum_probs=17.6

Q ss_pred             CcccCCCcceEEecccccCCCCce
Q 033782           11 GGLESEGKRWVIAGIPLRAPLKPI   34 (111)
Q Consensus        11 ~~~~~~~kkwviagi~l~a~LkPi   34 (111)
                      |.+-.++.+||++|++-|+.+.=|
T Consensus       121 GD~l~~~~~~v~iG~s~RTn~egi  144 (267)
T COG1834         121 GDVLMDGGDTVYIGYSFRTNLEGI  144 (267)
T ss_pred             ccEEEeCCcEEEEEeccccchHHH
Confidence            444455699999999988765544


No 9  
>PHA03416 hypothetical E4 protein; Provisional
Probab=17.96  E-value=1.2e+02  Score=21.35  Aligned_cols=21  Identities=19%  Similarity=0.444  Sum_probs=12.1

Q ss_pred             CCcCCCCCCCCCCCCCCCCCCCCCCCC
Q 033782           54 ELSTTPTSEDARIPAKLTCPAAPRKRK   80 (111)
Q Consensus        54 ~C~TTPts~e~rIP~~~~CPPAPRK~r   80 (111)
                      .|.| |   ...||..  ||.||+|.+
T Consensus        24 ~~~t-P---p~ppP~p--~p~Ap~k~~   44 (92)
T PHA03416         24 DCND-P---QRPTPTP--APCATKTGG   44 (92)
T ss_pred             cCCC-C---CCCcCCC--CCCCCCCcc
Confidence            4654 6   3355544  777886643


No 10 
>PF14509 GH97_C:  Glycosyl-hydrolase 97 C-terminal, oligomerisation; PDB: 3A24_A 2JKP_A 2JKE_A 2D73_B 2ZQ0_B 2JKA_A.
Probab=17.18  E-value=73  Score=22.32  Aligned_cols=11  Identities=36%  Similarity=1.087  Sum_probs=9.3

Q ss_pred             CCcceEEeccc
Q 033782           16 EGKRWVIAGIP   26 (111)
Q Consensus        16 ~~kkwviagi~   26 (111)
                      ||..|-|+||.
T Consensus        25 ~G~~Wyvg~in   35 (103)
T PF14509_consen   25 DGDDWYVGGIN   35 (103)
T ss_dssp             TTTEEEEEEEE
T ss_pred             CCCCEEEEEee
Confidence            47899999984


Done!