Citrus Sinensis ID: 033791


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MRGEMATKSEKEIPKIVWNESKRRFETEDKEAYVEYVVRENGKVMDLVHTYVPSSKRGLGLASHLCRAAFNHAKSHSMSIIPTCSYVSDTYLPRNPTWNSIIYSEDPRSII
ccccccccccccccEEEEcccccEEEEcccEEEEEEEEEcccEEEEEEEEECccccccccHHHHHHHHHHHHHHHcccEEEECccccHHHHcHHccccccccccccccccc
***************IVWNESKRRFETEDKEAYVEYVVRENGKVMDLVHTYVPSSKRGLGLASHLCRAAFNHAKSHSMSIIPTCSYVSDTYLPRNPTWNSIIYSE******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGEMATKSEKEIPKIVWNESKRRFETEDKEAYVEYVVRENGKVMDLVHTYVPSSKRGLGLASHLCRAAFNHAKSHSMSIIPTCSYVSDTYLPRNPTWNSIIYSEDPRSII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acetyltransferase At1g77540 Possesses in vitro histone acetyltransferase activity with histones H3 and H4.probableQ9CAQ2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XMT, chain A
Confidence level:very confident
Coverage over the Query: 13-107
View the alignment between query and template
View the model in PyMOL