Citrus Sinensis ID: 033795


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MDRFEILKDIGSGNFGVAKLVRDKWSGELYAVKYIQRGQKIDEHVQREIMNHRALKHPNIIRFKEVFLTPTELAIVMEYAAGGELFERICNAGRFSEDEVHALLLSYYFHY
cccEEEEEEECcccCEEEEEEEEcccccEEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEccccHHHHHHHHcccccHHHHHHHHHHHcccc
*DRFEILKDIGSGNFGVAKLVRDKWSGELYAVKYIQRGQKIDEHVQREIMNHRALKHPNIIRFKEVFLTPTELAIVMEYAAGGELFERICNAGRFSEDEVHALLLSYYFHY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRFEILKDIGSGNFGVAKLVRDKWSGELYAVKYIQRGQKIDEHVQREIMNHRALKHPNIIRFKEVFLTPTELAIVMEYAAGGELFERICNAGRFSEDEVHALLLSYYFHY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase SAPK1 May play a role in signal transduction of hyperosmotic response.probableQ75LR7
Serine/threonine-protein kinase SRK2F probableQ9SMQ4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UC3, chain A
Confidence level:very confident
Coverage over the Query: 2-107
View the alignment between query and template
View the model in PyMOL